1TG9A

Effect of shuttle location and ph environment on h+ transfer in human carbonic anhydrase ii
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNHGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Characterization of Active-Site Histidine as a Proton Shuttle in Catalysis by Human Carbonic Anhydrase II
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Carbonic anhydrase II
total genus 75
structure length 258
sequence length 258
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1tg9A00
2QOAA 5JG5B 1XPZA 4Z1JA 1KWRA 4Q87A 1CVAA 3R17B 5EH7A 3V3IB 4ITPA 2WEGA 3RYYA 1I8ZA 5G0CA 4Q8XA 4WR7A 1TB0X 1RZCA 1UGGA 3HKNA 8CA2A 4KNMA 3TVOX 3MNKA 3DVBA 2WD3A 4E4AA 3M1QA 5FNKA 1FQMA 4RN4A 2HL4A 5E28A 1LZVA 3KKXA 1CAYA 1G3ZA 1JCZA 4Q09A 4Z1EA 2POVA 5DSIA 4YGKA 5LMDA 4QK1A 1FR4A 3KONA 5EHEA 5JEPB 3ZP9A 1FR7A 4E49A 3PO6A 2NWYA 3DCCA 4MLXA 5FNIA 3D93A 2VVBX 5E2KA 2FNNA 4ZX0A 5FNJA 5EH8A 1CNKA 1AZMA 1CNHA 4Y0JA 4WW6A 2EU3A 2Q38A 5AMDA 1IF9A 2CABA 3HKUA 5EKJA 4E3GA 3B1BA 4GL1X 3M98A 5SZ4A 1HEDA 3MZCA 1G4JA 4MTYA 3M1JA 3S77B 3RG3A 1Z93A 7CA2A 5E2MA 1BNVA 4K0TA 12CAA 5FL6A 4RFDA 1G0EA 3U3AX 3M5TA 3MHIA 3P55A 1ZSAA 5DOGA 1RJ6A 1OQ5A 5JGSB 3BL1A 3R16A 3DA2A 1I9OA 3TVNX 4JSSA 3OIKA 3DCSA 5CA2A 4KNIA 3EFIA 3RJ7A 3T83A 4BCWA 3W6IA 2IT4A 4QSBA 1RZBA 4WL4A 3M5SA 3N3JA 3HS4A 3V3FA 4MDLA 3CZVA 4XIWA 4COQA 3P58A 3S76A 3IBNA 2NMXA 2ILIA 4TWMA 2X7SA 4QJ0A 4KNNA 5EHVA 1CAKA 4JSAA 1RAYA 3K34A 1YO2A 5DRSA 3IGPA 4WW8A 2GEHA 4QSJA 3RLDA 3SBIA 3HFPA 4RUYA 3MHLA 5DVXA 5DSNA 1CAZA 4KUVA 1ZSCA 1CRAA 3FW3A 4CACA 3F4XA 3NJ9A 1UGAA 1TTMA 4YYTA 1Y7WA 4BF6A 3B4FA 3U45X 3D8WA 4M2WA 4ZWZA 2VVAX 3JXGA 4Q9YA 5SZ1A 4PZHA 4YXIA 1F2WA 4QEFA 2H15A 1G4OA 4KP5A 3RYZA 3U7CA 9CA2A 1H9NA 5G03A 4ZWXA 1TG3A 2FMGA 2OSFA 5AMGA 1EOUA 2NXRA 3QYKA 2NWOA 4Q78A 4E5QA 1CCTA 4G0CA 5SZ6A 1IF8A 4TWLA 3JXHC 4YX4A 4L5UA 3T84A 1HEBA 3N4BA 5E5RA 2WEJA 5FLQA 3P5AA 1BNUA 4QIZA 1CA3A 3M14A 4HBAA 5FLPA 1HCAA 3P4VA 4N16A 1CILA 4Q08A 4K1QA 4E3DA 5BYIA 5SZ2A 1XEGA 3S9TA 2NXSA 1TBTX 4HF3A 3UYNA 4FVNA 3DVCA 1RAZA 3P44A 3T5UA 3OYSA 4Z1NA 2X7UA 3S72B 1CAIA 1ZGFA 1CAMA 1BICA 1T9NA 3DCWA 3V3HB 2CA2A 3ML2A 3M2NA 4M2VA 4PYXA 4CA2A 4K0ZA 3N2PA 5A25A 2CBBA 2HNCA 4G7AA 4ZAOA 2Q1QA 3KOIA 1FSQA 3IBUA 3NI5A 4HEYA 4MLTA 3RZ8A 1CVFA 3MNJA 4FVOA 4L5WA 5G01A 1OKNA 4KNJA 4YHAA 4YXUA 1THKA 1CIMA 1CRMA 3S8XA 1I91A 3SAPA 3BETA 2AW1A 1BZMA 2ZNCA 4QK2A 4FRCA 3S78B 3OILA 3KS3A 2FW4A 1UGBA 4FU5A 4QJPA 1TH9A 4JS6A 2NWPA 1MOOA 1CCSA 4HT0A 2FMZA 1CINA 1YO1A 4XZ5A 2ABEA 3MYQA 5FLOA 1DMYA 1UGFA 3D92A 3DD8A 3T5ZA 4LP6A 2EU2A 1DCBA 3MNAA 1FQLA 2HKKA 1JV0A 3M1WA 3M3XA 5DSMA 5BNLA 1CNGA 3ML5A 1IF7A 3RYJB 3RZ1B 3HLJA 1BNTA 1CNCA 4CNRA 3D9ZA 1G0FA 4HEZA 5J8ZA 3DAZA 1I90A 5SZ5A 1TG9A 1G6VA 4YWPA 3V2JA 5C8IA 4YVYA 2NNVA 3HKTA 4Q06A 4PYYA 5AMLA 4FL7A 3FFPX 3LXEA 5FNGA 4Q6DA 4R59A 2FOSA 4ZWIA 1RZAA 1KWQA 4QIYA 2FOVA 1CVCA 3CAJA 5EKMA 1HUGA 1V9EA 1UGCA 2FOYA 2Q1BA 3CA2A 1ZH9A 5JQ0A 1RJ5A 2WD2A 1LG5A 4Q0LA 3SAXA 3M1KA 2FOUA 3Q31A 1FSNA 4JSZA 5SZ3A 3OKVA 4M2RA 1RZEA 3NB5A 3OKUA 1CA2A 4WUQA 2NNSA 3MMFA 2CBAA 1ZNCA 1ZGEA 2HFWA 3DC9A 4RUZA 2NXTA 4RFCA 4QK3A 4QJOA 2QP6A 3RZ7A 4QJXA 4QSAA 4CNWA 3M04A 4YGNA 1CVHA 4ZWYA 5A6HA 4Q99A 5EZTX 4JSWA 5FDCA 3F7BA 3K2FA 1CVEA 1JD0A 5FLRA 1V9IC 2EZ7A 4L5VA 1ZFKA 1CAHA 2CBCA 2WEHA 2QO8A 1YO0A 2NNGA 5G0BA 4CNXA 1HVAA 4Q7PA 5SZ7A 2CBEA 1IF6A 4Z0QA 4E3HA 5JG3B 3N0NA 1BNNA 1FQNA 4QY3A 5DSPA 4QSIA 1HCBA 4ILXA 3KLDB 3RYXB 5EHWA 2NN1A 3MHMA 5HPJA 4DZ7A 4K0SA 5FNHA 5IPZA 5CJFA 3T82A 5BRVA 2HD6A 4Q81A 4Z1KA 4MDGA 3S73B 3F8EA 4PXXA 1BCDA 4QTLA 4XFWA 3OYQA 1RZDA 3KOKA 5JDVB 4IWZA 2CBDA 1CVBA 1AVNA 1H9QA 5FNLA 2HOCA 1YDDA 1G45A 5E5UA 3MNUA 3KNEA 1MUAA 4E9OX 2POWA 3PYKA 5E2SA 2WEOA 1CNWA 1YDCA 4R5BA 3S75B 5JEGB 1OKMA 5L3OA 1YDBA 1FLJA 4YGFA 1UGEA 4KUWA 2NNOA 1FQRA 2POUA 3IBIA 1CAJA 5E2RA 5FDIA 3MWOA 5FL4A 3M67A 3RYVB 1AM6A 1I9MA 1DMXA 1LUGA 4LHIA 5FNMA 4YXOA 3RG4A 4MDMA 5JEHB 3HKQA 4DZ9A 5JQTA 1ZSBA 3MHOA 2O4ZA 5E2NA 2FOQA 3MNIA 3F7UA 3V3GB 3S71B 5L6KA 4ITOA 4C3TA 3JXFA 3MDZA 3KWAA 4Q07A 1G46A 1J9WA 3U47A 4XE1A 5DSLA 1HUHA 5EH5A 5EOIA 4Q7VA 1CNBA 1KEQA 4HT2A 1IF5A 4N0XB 1URTA 2F14A 3D0NA 4LU3A 5EKHA 4YGLA 5DSQA 4HEWA 1I9LA 3SBHA 4R5AA 3V3JA 1BV3A 1BNWA 2FNMA 5CLUA 3M5EA 3V2MA 5DSJA 1CNJA 1LGDA 3V5GA 1BN1A 1UGDA 1YDAA 3IBLA 3K7KA 1CALA 2NWZA 4Q6EA 3DD0A 1CNIA 3RZ0B 4RUXA 1Z9YA 1CNYA 4X5SA 1TEUX 1LG6A 1A42A 4FPTA 4E3FA 3IEOA 3ZNCA 5JGTB 1HEAA 1DCAA 1XQ0A 3FE4A 2W2JA 4Q8YA 4K13A 1G54A 1G53A 1IF4A 5DSKA 3S97A 3UYQA 1XEVA 3C7PA 3CYUA 3L14A 2GD8A 4M2UA 1KOPA 4KAPA 4Q90A 3S74B 4CNVA 5DOHA 4RH2A 3TMJA 4XIXA 5FL5A 5FLSA 5JESB 1BN4A 3P3JA 4Q8ZA 3W6HA 4QJWA 3RGEA 5DSOA 1H4NA 6CA2A 4CQ0A 5CACA 1KOQA 1I9QA 3BL0A 1TE3X 3IAIA 1BN3A 4MO8A 4Q83A 1G48A 1BNQA 3P5LA 4KUYA 3MNHA 4RIVA 3EFTA 3DV7A 4ETQC 4FIKA 3RZ5A 1ZE8A 3M2ZA 2X7TA 3T85A 4HU1A 3M2YA 1CCUA 1G1DA 4Q7WA 4YGJA 4IDRX 3P3HA 1CZMA 3M40A 1ZFQA 3PJJA 5DSRA 3KIGA 4WUPA 5SZ0A 2OSMA 1TEQX 1BNMA 2FNKA 4KV0A 2H4NA 3V7XA 3OIMA 1CAOA 1CVDA 3VBDA 1I9NA 1CANA 3DBUA 4PQ7A 1I9PA 3GZ0A 4ZX1A 1FSRA 3MHCA 4RIUA 5FLTA 1CNXA 1Z97A 1HECA 4UOVA 1OKLA 4BF1A 4QJMA 1G52A 5BRUA 3DC3A 3M96A 2NN7A 3DVDA 3OY0A 3M2XA 4Q7SA 4KP8A 5EIJA 5BRWA 4Q49A 2AX2A
chains in the Genus database with same CATH superfamily
2QOAA 5JG5B 1XPZA 4Z1JA 1KWRA 4Q87A 1CVAA 3R17B 5EH7A 3V3IB 4ITPA 2WEGA 3RYYA 1I8ZA 5G0CA 4Q8XA 4WR7A 1TB0X 1RZCA 1UGGA 3HKNA 8CA2A 4KNMA 3TVOX 3MNKA 3DVBA 2WD3A 4E4AA 3M1QA 5FNKA 1FQMA 4RN4A 2HL4A 5E28A 1LZVA 3KKXA 1CAYA 1G3ZA 1JCZA 4Q09A 4Z1EA 2POVA 5DSIA 4YGKA 5LMDA 4QK1A 1FR4A 3KONA 5EHEA 5JEPB 3ZP9A 1FR7A 4E49A 3PO6A 2NWYA 3DCCA 4MLXA 5FNIA 3D93A 2VVBX 5E2KA 2FNNA 4ZX0A 5FNJA 5EH8A 1CNKA 1AZMA 1CNHA 4Y0JA 4WW6A 2EU3A 2Q38A 5AMDA 1IF9A 2CABA 3HKUA 5EKJA 4E3GA 3B1BA 4GL1X 3M98A 5SZ4A 1HEDA 3MZCA 1G4JA 4MTYA 3M1JA 3S77B 3RG3A 1Z93A 7CA2A 5E2MA 1BNVA 4K0TA 12CAA 5FL6A 4RFDA 1G0EA 3U3AX 3M5TA 3MHIA 3P55A 1ZSAA 5DOGA 1RJ6A 1OQ5A 5JGSB 3BL1A 3R16A 3DA2A 1I9OA 3TVNX 4JSSA 3OIKA 3DCSA 5CA2A 4KNIA 3EFIA 3RJ7A 3T83A 4BCWA 3W6IA 2IT4A 4QSBA 1RZBA 4WL4A 3M5SA 3N3JA 3HS4A 3V3FA 4MDLA 3CZVA 4XIWA 4COQA 3P58A 3S76A 3IBNA 2NMXA 2ILIA 4TWMA 2X7SA 4QJ0A 4KNNA 5EHVA 1CAKA 4JSAA 1RAYA 3K34A 1YO2A 5DRSA 3IGPA 4WW8A 2GEHA 4QSJA 3RLDA 3SBIA 3HFPA 4RUYA 3MHLA 5DVXA 5DSNA 1CAZA 4KUVA 1ZSCA 1CRAA 3FW3A 4CACA 3F4XA 3NJ9A 1UGAA 1TTMA 4YYTA 1Y7WA 4BF6A 3B4FA 3U45X 3D8WA 4M2WA 4ZWZA 2VVAX 3JXGA 4Q9YA 5SZ1A 4PZHA 4YXIA 1F2WA 4QEFA 2H15A 1G4OA 4KP5A 3RYZA 3U7CA 9CA2A 1H9NA 5G03A 4ZWXA 1TG3A 2FMGA 2OSFA 5AMGA 1EOUA 2NXRA 3QYKA 2NWOA 4Q78A 4E5QA 1CCTA 4G0CA 5SZ6A 1IF8A 4TWLA 3JXHC 4YX4A 4L5UA 3T84A 1HEBA 3N4BA 5E5RA 2WEJA 5FLQA 3P5AA 1BNUA 4QIZA 1CA3A 3M14A 4HBAA 5FLPA 1HCAA 3P4VA 4N16A 1CILA 4Q08A 4K1QA 4E3DA 5BYIA 5SZ2A 1XEGA 3S9TA 2NXSA 1TBTX 4HF3A 3UYNA 4FVNA 3DVCA 1RAZA 3P44A 3T5UA 3OYSA 4Z1NA 2X7UA 3S72B 1CAIA 1ZGFA 1CAMA 1BICA 1T9NA 3DCWA 3V3HB 2CA2A 3ML2A 3M2NA 4M2VA 4PYXA 4CA2A 4K0ZA 3N2PA 5A25A 2CBBA 2HNCA 4G7AA 4ZAOA 2Q1QA 3KOIA 1FSQA 3IBUA 3NI5A 4HEYA 4MLTA 3RZ8A 1CVFA 3MNJA 4FVOA 4L5WA 5G01A 1OKNA 4KNJA 4YHAA 4YXUA 1THKA 1CIMA 1CRMA 3S8XA 1I91A 3SAPA 3BETA 2AW1A 1BZMA 2ZNCA 4QK2A 4FRCA 3S78B 3OILA 3KS3A 2FW4A 1UGBA 4FU5A 4QJPA 1TH9A 4JS6A 2NWPA 1MOOA 1CCSA 4HT0A 2FMZA 1CINA 1YO1A 4XZ5A 2ABEA 3MYQA 5FLOA 1DMYA 1UGFA 3D92A 3DD8A 3T5ZA 4LP6A 2EU2A 1DCBA 3MNAA 1FQLA 2HKKA 1JV0A 3M1WA 3M3XA 5DSMA 5BNLA 1CNGA 3ML5A 1IF7A 3RYJB 3RZ1B 3HLJA 1BNTA 1CNCA 4CNRA 3D9ZA 1G0FA 4HEZA 5J8ZA 3DAZA 1I90A 5SZ5A 1TG9A 1G6VA 4YWPA 3V2JA 5C8IA 4YVYA 2NNVA 3HKTA 4Q06A 4PYYA 5AMLA 4FL7A 3FFPX 3LXEA 5FNGA 4Q6DA 4R59A 2FOSA 4ZWIA 1RZAA 1KWQA 4QIYA 2FOVA 1CVCA 3CAJA 5EKMA 1HUGA 1V9EA 1UGCA 2FOYA 2Q1BA 3CA2A 1ZH9A 5JQ0A 1RJ5A 2WD2A 1LG5A 4Q0LA 3SAXA 3M1KA 2FOUA 3Q31A 1FSNA 4JSZA 5SZ3A 3OKVA 4M2RA 1RZEA 3NB5A 3OKUA 1CA2A 4WUQA 2NNSA 3MMFA 2CBAA 1ZNCA 1ZGEA 2HFWA 3DC9A 4RUZA 2NXTA 4RFCA 4QK3A 4QJOA 2QP6A 3RZ7A 4QJXA 4QSAA 4CNWA 3M04A 4YGNA 1CVHA 4ZWYA 5A6HA 4Q99A 5EZTX 4JSWA 5FDCA 3F7BA 3K2FA 1CVEA 1JD0A 5FLRA 1V9IC 2EZ7A 4L5VA 1ZFKA 1CAHA 2CBCA 2WEHA 2QO8A 1YO0A 2NNGA 5G0BA 4CNXA 1HVAA 4Q7PA 5SZ7A 2CBEA 1IF6A 4Z0QA 4E3HA 5JG3B 3N0NA 1BNNA 1FQNA 4QY3A 5DSPA 4QSIA 1HCBA 4ILXA 3KLDB 3RYXB 5EHWA 2NN1A 3MHMA 5HPJA 4DZ7A 4K0SA 5FNHA 5IPZA 5CJFA 3T82A 5BRVA 2HD6A 4Q81A 4Z1KA 4MDGA 3S73B 3F8EA 4PXXA 1BCDA 4QTLA 4XFWA 3OYQA 1RZDA 3KOKA 5JDVB 4IWZA 2CBDA 1CVBA 1AVNA 1H9QA 5FNLA 2HOCA 1YDDA 1G45A 5E5UA 3MNUA 3KNEA 1MUAA 4E9OX 2POWA 3PYKA 5E2SA 2WEOA 1CNWA 1YDCA 4R5BA 3S75B 5JEGB 1OKMA 5L3OA 1YDBA 1FLJA 4YGFA 1UGEA 4KUWA 2NNOA 1FQRA 2POUA 3IBIA 1CAJA 5E2RA 5FDIA 3MWOA 5FL4A 3M67A 3RYVB 1AM6A 1I9MA 1DMXA 1LUGA 4LHIA 5FNMA 4YXOA 3RG4A 4MDMA 5JEHB 3HKQA 4DZ9A 5JQTA 1ZSBA 3MHOA 2O4ZA 5E2NA 2FOQA 3MNIA 3F7UA 3V3GB 3S71B 5L6KA 4ITOA 4C3TA 3JXFA 3MDZA 3KWAA 4Q07A 1G46A 1J9WA 3U47A 4XE1A 5DSLA 1HUHA 5EH5A 5EOIA 4Q7VA 1CNBA 1KEQA 4HT2A 1IF5A 4N0XB 1URTA 2F14A 3D0NA 4LU3A 5EKHA 4YGLA 5DSQA 4HEWA 1I9LA 3SBHA 4R5AA 3V3JA 1BV3A 1BNWA 2FNMA 5CLUA 3M5EA 3V2MA 5DSJA 1CNJA 1LGDA 3V5GA 1BN1A 1UGDA 1YDAA 3IBLA 3K7KA 1CALA 2NWZA 4Q6EA 3DD0A 1CNIA 3RZ0B 4RUXA 1Z9YA 1CNYA 4X5SA 1TEUX 1LG6A 1A42A 4FPTA 4E3FA 3IEOA 3ZNCA 5JGTB 1HEAA 1DCAA 1XQ0A 3FE4A 2W2JA 4Q8YA 4K13A 1G54A 1G53A 1IF4A 5DSKA 3S97A 3UYQA 1XEVA 3C7PA 3CYUA 3L14A 2GD8A 4M2UA 1KOPA 4KAPA 4Q90A 3S74B 4CNVA 5DOHA 4RH2A 3TMJA 4XIXA 5FL5A 5FLSA 5JESB 1BN4A 3P3JA 4Q8ZA 3W6HA 4QJWA 3RGEA 5DSOA 1H4NA 6CA2A 4CQ0A 5CACA 1KOQA 1I9QA 3BL0A 1TE3X 3IAIA 1BN3A 4MO8A 4Q83A 1G48A 1BNQA 3P5LA 4KUYA 3MNHA 4RIVA 3EFTA 3DV7A 4ETQC 4FIKA 3RZ5A 1ZE8A 3M2ZA 2X7TA 3T85A 4HU1A 3M2YA 1CCUA 1G1DA 4Q7WA 4YGJA 4IDRX 3P3HA 1CZMA 3M40A 1ZFQA 3PJJA 5DSRA 3KIGA 4WUPA 5SZ0A 2OSMA 1TEQX 1BNMA 2FNKA 4KV0A 2H4NA 3V7XA 3OIMA 1CAOA 1CVDA 3VBDA 1I9NA 1CANA 3DBUA 4PQ7A 1I9PA 3GZ0A 4ZX1A 1FSRA 3MHCA 4RIUA 5FLTA 1CNXA 1Z97A 1HECA 4UOVA 1OKLA 4BF1A 4QJMA 1G52A 5BRUA 3DC3A 3M96A 2NN7A 3DVDA 3OY0A 3M2XA 4Q7SA 4KP8A 5EIJA 5BRWA 4Q49A 2AX2A
chains in the Genus database with same CATH topology
2QOAA 5JG5B 1XPZA 4Z1JA 1KWRA 4Q87A 1CVAA 3R17B 5EH7A 3V3IB 4ITPA 2WEGA 3RYYA 1I8ZA 5G0CA 4Q8XA 4WR7A 1TB0X 1RZCA 1UGGA 3HKNA 8CA2A 4KNMA 3TVOX 3MNKA 3DVBA 2WD3A 4E4AA 3M1QA 5FNKA 1FQMA 4RN4A 2HL4A 5E28A 1LZVA 3KKXA 1CAYA 1G3ZA 1JCZA 4Q09A 4Z1EA 2POVA 5DSIA 4YGKA 5LMDA 4QK1A 1FR4A 3KONA 5EHEA 5JEPB 3ZP9A 1FR7A 4E49A 3PO6A 2NWYA 3DCCA 4MLXA 5FNIA 3D93A 2VVBX 5E2KA 2FNNA 4ZX0A 5FNJA 5EH8A 1CNKA 1AZMA 1CNHA 4Y0JA 4WW6A 2EU3A 2Q38A 5AMDA 1IF9A 2CABA 3HKUA 5EKJA 4E3GA 3B1BA 4GL1X 3M98A 5SZ4A 1HEDA 3MZCA 1G4JA 4MTYA 3M1JA 3S77B 3RG3A 1Z93A 7CA2A 5E2MA 1BNVA 4K0TA 12CAA 5FL6A 4RFDA 1G0EA 3U3AX 3M5TA 3MHIA 3P55A 1ZSAA 5DOGA 1RJ6A 1OQ5A 5JGSB 3BL1A 3R16A 3DA2A 1I9OA 3TVNX 4JSSA 3OIKA 3DCSA 5CA2A 4KNIA 3EFIA 3RJ7A 3T83A 4BCWA 3W6IA 2IT4A 4QSBA 1RZBA 4WL4A 3M5SA 3N3JA 3HS4A 3V3FA 4MDLA 3CZVA 4XIWA 4COQA 3P58A 3S76A 3IBNA 2NMXA 2ILIA 4TWMA 2X7SA 4QJ0A 4KNNA 5EHVA 1CAKA 4JSAA 1RAYA 3K34A 1YO2A 5DRSA 3IGPA 4WW8A 2GEHA 4QSJA 3RLDA 3SBIA 3HFPA 4RUYA 3MHLA 5DVXA 5DSNA 1CAZA 4KUVA 1ZSCA 1CRAA 3FW3A 4CACA 3F4XA 3NJ9A 1UGAA 1TTMA 4YYTA 1Y7WA 4BF6A 3B4FA 3U45X 3D8WA 4M2WA 4ZWZA 2VVAX 3JXGA 4Q9YA 5SZ1A 4PZHA 4YXIA 1F2WA 4QEFA 2H15A 1G4OA 4KP5A 3RYZA 3U7CA 9CA2A 1H9NA 5G03A 4ZWXA 1TG3A 2FMGA 2OSFA 5AMGA 1EOUA 2NXRA 3QYKA 2NWOA 4Q78A 4E5QA 1CCTA 4G0CA 5SZ6A 1IF8A 4TWLA 3JXHC 4YX4A 4L5UA 3T84A 1HEBA 3N4BA 5E5RA 2WEJA 5FLQA 3P5AA 1BNUA 4QIZA 1CA3A 3M14A 4HBAA 5FLPA 1HCAA 3P4VA 4N16A 1CILA 4Q08A 4K1QA 4E3DA 5BYIA 5SZ2A 1XEGA 3S9TA 2NXSA 1TBTX 4HF3A 3UYNA 4FVNA 3DVCA 1RAZA 3P44A 3T5UA 3OYSA 4Z1NA 2X7UA 3S72B 1CAIA 1ZGFA 1CAMA 1BICA 1T9NA 3DCWA 3V3HB 2CA2A 3ML2A 3M2NA 4M2VA 4PYXA 4CA2A 4K0ZA 3N2PA 5A25A 2CBBA 2HNCA 4G7AA 4ZAOA 2Q1QA 3KOIA 1FSQA 3IBUA 3NI5A 4HEYA 4MLTA 3RZ8A 1CVFA 3MNJA 4FVOA 4L5WA 5G01A 1OKNA 4KNJA 4YHAA 4YXUA 1THKA 1CIMA 1CRMA 3S8XA 1I91A 3SAPA 3BETA 2AW1A 1BZMA 2ZNCA 4QK2A 4FRCA 3S78B 3OILA 3KS3A 2FW4A 1UGBA 4FU5A 4QJPA 1TH9A 4JS6A 2NWPA 1MOOA 1CCSA 4HT0A 2FMZA 1CINA 1YO1A 4XZ5A 2ABEA 3MYQA 5FLOA 1DMYA 1UGFA 3D92A 3DD8A 3T5ZA 4LP6A 2EU2A 1DCBA 3MNAA 1FQLA 2HKKA 1JV0A 3M1WA 3M3XA 5DSMA 5BNLA 1CNGA 3ML5A 1IF7A 3RYJB 3RZ1B 3HLJA 1BNTA 1CNCA 4CNRA 3D9ZA 1G0FA 4HEZA 5J8ZA 3DAZA 1I90A 5SZ5A 1TG9A 1G6VA 4YWPA 3V2JA 5C8IA 4YVYA 2NNVA 3HKTA 4Q06A 4PYYA 5AMLA 4FL7A 3FFPX 3LXEA 5FNGA 4Q6DA 4R59A 2FOSA 4ZWIA 1RZAA 1KWQA 4QIYA 2FOVA 1CVCA 3CAJA 5EKMA 1HUGA 1V9EA 1UGCA 2FOYA 2Q1BA 3CA2A 1ZH9A 5JQ0A 1RJ5A 2WD2A 1LG5A 4Q0LA 3SAXA 3M1KA 2FOUA 3Q31A 1FSNA 4JSZA 5SZ3A 3OKVA 4M2RA 1RZEA 3NB5A 3OKUA 1CA2A 4WUQA 2NNSA 3MMFA 2CBAA 1ZNCA 1ZGEA 2HFWA 3DC9A 4RUZA 2NXTA 4RFCA 4QK3A 4QJOA 2QP6A 3RZ7A 4QJXA 4QSAA 4CNWA 3M04A 4YGNA 1CVHA 4ZWYA 5A6HA 4Q99A 5EZTX 4JSWA 5FDCA 3F7BA 3K2FA 1CVEA 1JD0A 5FLRA 1V9IC 2EZ7A 4L5VA 1ZFKA 1CAHA 2CBCA 2WEHA 2QO8A 1YO0A 2NNGA 5G0BA 4CNXA 1HVAA 4Q7PA 5SZ7A 2CBEA 1IF6A 4Z0QA 4E3HA 5JG3B 3N0NA 1BNNA 1FQNA 4QY3A 5DSPA 4QSIA 1HCBA 4ILXA 3KLDB 3RYXB 5EHWA 2NN1A 3MHMA 5HPJA 4DZ7A 4K0SA 5FNHA 5IPZA 5CJFA 3T82A 5BRVA 2HD6A 4Q81A 4Z1KA 4MDGA 3S73B 3F8EA 4PXXA 1BCDA 4QTLA 4XFWA 3OYQA 1RZDA 3KOKA 5JDVB 4IWZA 2CBDA 1CVBA 1AVNA 1H9QA 5FNLA 2HOCA 1YDDA 1G45A 5E5UA 3MNUA 3KNEA 1MUAA 4E9OX 2POWA 3PYKA 5E2SA 2WEOA 1CNWA 1YDCA 4R5BA 3S75B 5JEGB 1OKMA 5L3OA 1YDBA 1FLJA 4YGFA 1UGEA 4KUWA 2NNOA 1FQRA 2POUA 3IBIA 1CAJA 5E2RA 5FDIA 3MWOA 5FL4A 3M67A 3RYVB 1AM6A 1I9MA 1DMXA 1LUGA 4LHIA 5FNMA 4YXOA 3RG4A 4MDMA 5JEHB 3HKQA 4DZ9A 5JQTA 1ZSBA 3MHOA 2O4ZA 5E2NA 2FOQA 3MNIA 3F7UA 3V3GB 3S71B 5L6KA 4ITOA 4C3TA 3JXFA 3MDZA 3KWAA 4Q07A 1G46A 1J9WA 3U47A 4XE1A 5DSLA 1HUHA 5EH5A 5EOIA 4Q7VA 1CNBA 1KEQA 4HT2A 1IF5A 4N0XB 1URTA 2F14A 3D0NA 4LU3A 5EKHA 4YGLA 5DSQA 4HEWA 1I9LA 3SBHA 4R5AA 3V3JA 1BV3A 1BNWA 2FNMA 5CLUA 3M5EA 3V2MA 5DSJA 1CNJA 1LGDA 3V5GA 1BN1A 1UGDA 1YDAA 3IBLA 3K7KA 1CALA 2NWZA 4Q6EA 3DD0A 1CNIA 3RZ0B 4RUXA 1Z9YA 1CNYA 4X5SA 1TEUX 1LG6A 1A42A 4FPTA 4E3FA 3IEOA 3ZNCA 5JGTB 1HEAA 1DCAA 1XQ0A 3FE4A 2W2JA 4Q8YA 4K13A 1G54A 1G53A 1IF4A 5DSKA 3S97A 3UYQA 1XEVA 3C7PA 3CYUA 3L14A 2GD8A 4M2UA 1KOPA 4KAPA 4Q90A 3S74B 4CNVA 5DOHA 4RH2A 3TMJA 4XIXA 5FL5A 5FLSA 5JESB 1BN4A 3P3JA 4Q8ZA 3W6HA 4QJWA 3RGEA 5DSOA 1H4NA 6CA2A 4CQ0A 5CACA 1KOQA 1I9QA 3BL0A 1TE3X 3IAIA 1BN3A 4MO8A 4Q83A 1G48A 1BNQA 3P5LA 4KUYA 3MNHA 4RIVA 3EFTA 3DV7A 4ETQC 4FIKA 3RZ5A 1ZE8A 3M2ZA 2X7TA 3T85A 4HU1A 3M2YA 1CCUA 1G1DA 4Q7WA 4YGJA 4IDRX 3P3HA 1CZMA 3M40A 1ZFQA 3PJJA 5DSRA 3KIGA 4WUPA 5SZ0A 2OSMA 1TEQX 1BNMA 2FNKA 4KV0A 2H4NA 3V7XA 3OIMA 1CAOA 1CVDA 3VBDA 1I9NA 1CANA 3DBUA 4PQ7A 1I9PA 3GZ0A 4ZX1A 1FSRA 3MHCA 4RIUA 5FLTA 1CNXA 1Z97A 1HECA 4UOVA 1OKLA 4BF1A 4QJMA 1G52A 5BRUA 3DC3A 3M96A 2NN7A 3DVDA 3OY0A 3M2XA 4Q7SA 4KP8A 5EIJA 5BRWA 4Q49A 2AX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QOA A;  5JG5 B;  1XPZ A;  4Z1J A;  1KWR A;  4Q87 A;  1CVA A;  3R17 B;  5EH7 A;  3V3I B;  4ITP A;  2WEG A;  3RYY A;  1I8Z A;  5G0C A;  4Q8X A;  4WR7 A;  1TB0 X;  1RZC A;  1UGG A;  3HKN A;  8CA2 A;  4KNM A;  3TVO X;  3MNK A;  3DVB A;  2WD3 A;  4E4A A;  3M1Q A;  5FNK A;  1FQM A;  4RN4 A;  2HL4 A;  5E28 A;  1LZV A;  3KKX A;  1CAY A;  1G3Z A;  1JCZ A;  4Q09 A;  4Z1E A;  2POV A;  5DSI A;  4YGK A;  5LMD A;  4QK1 A;  1FR4 A;  3KON A;  5EHE A;  5JEP B;  3ZP9 A;  1FR7 A;  4E49 A;  3PO6 A;  2NWY A;  3DCC A;  4MLX A;  5FNI A;  3D93 A;  2VVB X;  5E2K A;  2FNN A;  4ZX0 A;  5FNJ A;  5EH8 A;  1CNK A;  1AZM A;  1CNH A;  4Y0J A;  4WW6 A;  2EU3 A;  2Q38 A;  5AMD A;  1IF9 A;  2CAB A;  3HKU A;  5EKJ A;  4E3G A;  3B1B A;  4GL1 X;  3M98 A;  5SZ4 A;  1HED A;  3MZC A;  1G4J A;  4MTY A;  3M1J A;  3S77 B;  3RG3 A;  1Z93 A;  7CA2 A;  5E2M A;  1BNV A;  4K0T A;  12CA A;  5FL6 A;  4RFD A;  1G0E A;  3U3A X;  3M5T A;  3MHI A;  3P55 A;  1ZSA A;  5DOG A;  1RJ6 A;  1OQ5 A;  5JGS B;  3BL1 A;  3R16 A;  3DA2 A;  1I9O A;  3TVN X;  4JSS A;  3OIK A;  3DCS A;  5CA2 A;  4KNI A;  3EFI A;  3RJ7 A;  3T83 A;  4BCW A;  3W6I A;  2IT4 A;  4QSB A;  1RZB A;  4WL4 A;  3M5S A;  3N3J A;  3HS4 A;  3V3F A;  4MDL A;  3CZV A;  4XIW A;  4COQ A;  3P58 A;  3S76 A;  3IBN A;  2NMX A;  2ILI A;  4TWM A;  2X7S A;  4QJ0 A;  4KNN A;  5EHV A;  1CAK A;  4JSA A;  1RAY A;  3K34 A;  1YO2 A;  5DRS A;  3IGP A;  4WW8 A;  2GEH A;  4QSJ A;  3RLD A;  3SBI A;  3HFP A;  4RUY A;  3MHL A;  5DVX A;  5DSN A;  1CAZ A;  4KUV A;  1ZSC A;  1CRA A;  3FW3 A;  4CAC A;  3F4X A;  3NJ9 A;  1UGA A;  1TTM A;  4YYT A;  1Y7W A;  4BF6 A;  3B4F A;  3U45 X;  3D8W A;  4M2W A;  4ZWZ A;  2VVA X;  3JXG A;  4Q9Y A;  5SZ1 A;  4PZH A;  4YXI A;  1F2W A;  4QEF A;  2H15 A;  1G4O A;  4KP5 A;  3RYZ A;  3U7C A;  9CA2 A;  1H9N A;  5G03 A;  4ZWX A;  1TG3 A;  2FMG A;  2OSF A;  5AMG A;  1EOU A;  2NXR A;  3QYK A;  2NWO A;  4Q78 A;  4E5Q A;  1CCT A;  4G0C A;  5SZ6 A;  1IF8 A;  4TWL A;  3JXH C;  4YX4 A;  4L5U A;  3T84 A;  1HEB A;  3N4B A;  5E5R A;  2WEJ A;  5FLQ A;  3P5A A;  1BNU A;  4QIZ A;  1CA3 A;  3M14 A;  4HBA A;  5FLP A;  1HCA A;  3P4V A;  4N16 A;  1CIL A;  4Q08 A;  4K1Q A;  4E3D A;  5BYI A;  5SZ2 A;  1XEG A;  3S9T A;  2NXS A;  1TBT X;  4HF3 A;  3UYN A;  4FVN A;  3DVC A;  1RAZ A;  3P44 A;  3T5U A;  3OYS A;  4Z1N A;  2X7U A;  3S72 B;  1CAI A;  1ZGF A;  1CAM A;  1BIC A;  1T9N A;  3DCW A;  3V3H B;  2CA2 A;  3ML2 A;  3M2N A;  4M2V A;  4PYX A;  4CA2 A;  4K0Z A;  3N2P A;  5A25 A;  2CBB A;  2HNC A;  4G7A A;  4ZAO A;  2Q1Q A;  3KOI A;  1FSQ A;  3IBU A;  3NI5 A;  4HEY A;  4MLT A;  3RZ8 A;  1CVF A;  3MNJ A;  4FVO A;  4L5W A;  5G01 A;  1OKN A;  4KNJ A;  4YHA A;  4YXU A;  1THK A;  1CIM A;  1CRM A;  3S8X A;  1I91 A;  3SAP A;  3BET A;  2AW1 A;  1BZM A;  2ZNC A;  4QK2 A;  4FRC A;  3S78 B;  3OIL A;  3KS3 A;  2FW4 A;  1UGB A;  4FU5 A;  4QJP A;  1TH9 A;  4JS6 A;  2NWP A;  1MOO A;  1CCS A;  4HT0 A;  2FMZ A;  1CIN A;  1YO1 A;  4XZ5 A;  2ABE A;  3MYQ A;  5FLO A;  1DMY A;  1UGF A;  3D92 A;  3DD8 A;  3T5Z A;  4LP6 A;  2EU2 A;  1DCB A;  3MNA A;  1FQL A;  2HKK A;  1JV0 A;  3M1W A;  3M3X A;  5DSM A;  5BNL A;  1CNG A;  3ML5 A;  1IF7 A;  3RYJ B;  3RZ1 B;  3HLJ A;  1BNT A;  1CNC A;  4CNR A;  3D9Z A;  1G0F A;  4HEZ A;  5J8Z A;  3DAZ A;  1I90 A;  5SZ5 A;  1TG9 A;  1G6V A;  4YWP A;  3V2J A;  5C8I A;  4YVY A;  2NNV A;  3HKT A;  4Q06 A;  4PYY A;  5AML A;  4FL7 A;  3FFP X;  3LXE A;  5FNG A;  4Q6D A;  4R59 A;  2FOS A;  4ZWI A;  1RZA A;  1KWQ A;  4QIY A;  2FOV A;  1CVC A;  3CAJ A;  5EKM A;  1HUG A;  1V9E A;  1UGC A;  2FOY A;  2Q1B A;  3CA2 A;  1ZH9 A;  5JQ0 A;  1RJ5 A;  2WD2 A;  1LG5 A;  4Q0L A;  3SAX A;  3M1K A;  2FOU A;  3Q31 A;  1FSN A;  4JSZ A;  5SZ3 A;  3OKV A;  4M2R A;  1RZE A;  3NB5 A;  3OKU A;  1CA2 A;  4WUQ A;  2NNS A;  3MMF A;  2CBA A;  1ZNC A;  1ZGE A;  2HFW A;  3DC9 A;  4RUZ A;  2NXT A;  4RFC A;  4QK3 A;  4QJO A;  2QP6 A;  3RZ7 A;  4QJX A;  4QSA A;  4CNW A;  3M04 A;  4YGN A;  1CVH A;  4ZWY A;  5A6H A;  4Q99 A;  5EZT X;  4JSW A;  5FDC A;  3F7B A;  3K2F A;  1CVE A;  1JD0 A;  5FLR A;  1V9I C;  2EZ7 A;  4L5V A;  1ZFK A;  1CAH A;  2CBC A;  2WEH A;  2QO8 A;  1YO0 A;  2NNG A;  5G0B A;  4CNX A;  1HVA A;  4Q7P A;  5SZ7 A;  2CBE A;  1IF6 A;  4Z0Q A;  4E3H A;  5JG3 B;  3N0N A;  1BNN A;  1FQN A;  4QY3 A;  5DSP A;  4QSI A;  1HCB A;  4ILX A;  3KLD B;  3RYX B;  5EHW A;  2NN1 A;  3MHM A;  5HPJ A;  4DZ7 A;  4K0S A;  5FNH A;  5IPZ A;  5CJF A;  3T82 A;  5BRV A;  2HD6 A;  4Q81 A;  4Z1K A;  4MDG A;  3S73 B;  3F8E A;  4PXX A;  1BCD A;  4QTL A;  4XFW A;  3OYQ A;  1RZD A;  3KOK A;  5JDV B;  4IWZ A;  2CBD A;  1CVB A;  1AVN A;  1H9Q A;  5FNL A;  2HOC A;  1YDD A;  1G45 A;  5E5U A;  3MNU A;  3KNE A;  1MUA A;  4E9O X;  2POW A;  3PYK A;  5E2S A;  2WEO A;  1CNW A;  1YDC A;  4R5B A;  3S75 B;  5JEG B;  1OKM A;  5L3O A;  1YDB A;  1FLJ A;  4YGF A;  1UGE A;  4KUW A;  2NNO A;  1FQR A;  2POU A;  3IBI A;  1CAJ A;  5E2R A;  5FDI A;  3MWO A;  5FL4 A;  3M67 A;  3RYV B;  1AM6 A;  1I9M A;  1DMX A;  1LUG A;  4LHI A;  5FNM A;  4YXO A;  3RG4 A;  4MDM A;  5JEH B;  3HKQ A;  4DZ9 A;  5JQT A;  1ZSB A;  3MHO A;  2O4Z A;  5E2N A;  2FOQ A;  3MNI A;  3F7U A;  3V3G B;  3S71 B;  5L6K A;  4ITO A;  4C3T A;  3JXF A;  3MDZ A;  3KWA A;  4Q07 A;  1G46 A;  1J9W A;  3U47 A;  4XE1 A;  5DSL A;  1HUH A;  5EH5 A;  5EOI A;  4Q7V A;  1CNB A;  1KEQ A;  4HT2 A;  1IF5 A;  4N0X B;  1URT A;  2F14 A;  3D0N A;  4LU3 A;  5EKH A;  4YGL A;  5DSQ A;  4HEW A;  1I9L A;  3SBH A;  4R5A A;  3V3J A;  1BV3 A;  1BNW A;  2FNM A;  5CLU A;  3M5E A;  3V2M A;  5DSJ A;  1CNJ A;  1LGD A;  3V5G A;  1BN1 A;  1UGD A;  1YDA A;  3IBL A;  3K7K A;  1CAL A;  2NWZ A;  4Q6E A;  3DD0 A;  1CNI A;  3RZ0 B;  4RUX A;  1Z9Y A;  1CNY A;  4X5S A;  1TEU X;  1LG6 A;  1A42 A;  4FPT A;  4E3F A;  3IEO A;  3ZNC A;  5JGT B;  1HEA A;  1DCA A;  1XQ0 A;  3FE4 A;  2W2J A;  4Q8Y A;  4K13 A;  1G54 A;  1G53 A;  1IF4 A;  5DSK A;  3S97 A;  3UYQ A;  1XEV A;  3C7P A;  3CYU A;  3L14 A;  2GD8 A;  4M2U A;  1KOP A;  4KAP A;  4Q90 A;  3S74 B;  4CNV A;  5DOH A;  4RH2 A;  3TMJ A;  4XIX A;  5FL5 A;  5FLS A;  5JES B;  1BN4 A;  3P3J A;  4Q8Z A;  3W6H A;  4QJW A;  3RGE A;  5DSO A;  1H4N A;  6CA2 A;  4CQ0 A;  5CAC A;  1KOQ A;  1I9Q A;  3BL0 A;  1TE3 X;  3IAI A;  1BN3 A;  4MO8 A;  4Q83 A;  1G48 A;  1BNQ A;  3P5L A;  4KUY A;  3MNH A;  4RIV A;  3EFT A;  3DV7 A;  4ETQ C;  4FIK A;  3RZ5 A;  1ZE8 A;  3M2Z A;  2X7T A;  3T85 A;  4HU1 A;  3M2Y A;  1CCU A;  1G1D A;  4Q7W A;  4YGJ A;  4IDR X;  3P3H A;  1CZM A;  3M40 A;  1ZFQ A;  3PJJ A;  5DSR A;  3KIG A;  4WUP A;  5SZ0 A;  2OSM A;  1TEQ X;  1BNM A;  2FNK A;  4KV0 A;  2H4N A;  3V7X A;  3OIM A;  1CAO A;  1CVD A;  3VBD A;  1I9N A;  1CAN A;  3DBU A;  4PQ7 A;  1I9P A;  3GZ0 A;  4ZX1 A;  1FSR A;  3MHC A;  4RIU A;  5FLT A;  1CNX A;  1Z97 A;  1HEC A;  4UOV A;  1OKL A;  4BF1 A;  4QJM A;  1G52 A;  5BRU A;  3DC3 A;  3M96 A;  2NN7 A;  3DVD A;  3OY0 A;  3M2X A;  4Q7S A;  4KP8 A;  5EIJ A;  5BRW A;  4Q49 A;  2AX2 A; 
#chains in the Genus database with same CATH topology
 2QOA A;  5JG5 B;  1XPZ A;  4Z1J A;  1KWR A;  4Q87 A;  1CVA A;  3R17 B;  5EH7 A;  3V3I B;  4ITP A;  2WEG A;  3RYY A;  1I8Z A;  5G0C A;  4Q8X A;  4WR7 A;  1TB0 X;  1RZC A;  1UGG A;  3HKN A;  8CA2 A;  4KNM A;  3TVO X;  3MNK A;  3DVB A;  2WD3 A;  4E4A A;  3M1Q A;  5FNK A;  1FQM A;  4RN4 A;  2HL4 A;  5E28 A;  1LZV A;  3KKX A;  1CAY A;  1G3Z A;  1JCZ A;  4Q09 A;  4Z1E A;  2POV A;  5DSI A;  4YGK A;  5LMD A;  4QK1 A;  1FR4 A;  3KON A;  5EHE A;  5JEP B;  3ZP9 A;  1FR7 A;  4E49 A;  3PO6 A;  2NWY A;  3DCC A;  4MLX A;  5FNI A;  3D93 A;  2VVB X;  5E2K A;  2FNN A;  4ZX0 A;  5FNJ A;  5EH8 A;  1CNK A;  1AZM A;  1CNH A;  4Y0J A;  4WW6 A;  2EU3 A;  2Q38 A;  5AMD A;  1IF9 A;  2CAB A;  3HKU A;  5EKJ A;  4E3G A;  3B1B A;  4GL1 X;  3M98 A;  5SZ4 A;  1HED A;  3MZC A;  1G4J A;  4MTY A;  3M1J A;  3S77 B;  3RG3 A;  1Z93 A;  7CA2 A;  5E2M A;  1BNV A;  4K0T A;  12CA A;  5FL6 A;  4RFD A;  1G0E A;  3U3A X;  3M5T A;  3MHI A;  3P55 A;  1ZSA A;  5DOG A;  1RJ6 A;  1OQ5 A;  5JGS B;  3BL1 A;  3R16 A;  3DA2 A;  1I9O A;  3TVN X;  4JSS A;  3OIK A;  3DCS A;  5CA2 A;  4KNI A;  3EFI A;  3RJ7 A;  3T83 A;  4BCW A;  3W6I A;  2IT4 A;  4QSB A;  1RZB A;  4WL4 A;  3M5S A;  3N3J A;  3HS4 A;  3V3F A;  4MDL A;  3CZV A;  4XIW A;  4COQ A;  3P58 A;  3S76 A;  3IBN A;  2NMX A;  2ILI A;  4TWM A;  2X7S A;  4QJ0 A;  4KNN A;  5EHV A;  1CAK A;  4JSA A;  1RAY A;  3K34 A;  1YO2 A;  5DRS A;  3IGP A;  4WW8 A;  2GEH A;  4QSJ A;  3RLD A;  3SBI A;  3HFP A;  4RUY A;  3MHL A;  5DVX A;  5DSN A;  1CAZ A;  4KUV A;  1ZSC A;  1CRA A;  3FW3 A;  4CAC A;  3F4X A;  3NJ9 A;  1UGA A;  1TTM A;  4YYT A;  1Y7W A;  4BF6 A;  3B4F A;  3U45 X;  3D8W A;  4M2W A;  4ZWZ A;  2VVA X;  3JXG A;  4Q9Y A;  5SZ1 A;  4PZH A;  4YXI A;  1F2W A;  4QEF A;  2H15 A;  1G4O A;  4KP5 A;  3RYZ A;  3U7C A;  9CA2 A;  1H9N A;  5G03 A;  4ZWX A;  1TG3 A;  2FMG A;  2OSF A;  5AMG A;  1EOU A;  2NXR A;  3QYK A;  2NWO A;  4Q78 A;  4E5Q A;  1CCT A;  4G0C A;  5SZ6 A;  1IF8 A;  4TWL A;  3JXH C;  4YX4 A;  4L5U A;  3T84 A;  1HEB A;  3N4B A;  5E5R A;  2WEJ A;  5FLQ A;  3P5A A;  1BNU A;  4QIZ A;  1CA3 A;  3M14 A;  4HBA A;  5FLP A;  1HCA A;  3P4V A;  4N16 A;  1CIL A;  4Q08 A;  4K1Q A;  4E3D A;  5BYI A;  5SZ2 A;  1XEG A;  3S9T A;  2NXS A;  1TBT X;  4HF3 A;  3UYN A;  4FVN A;  3DVC A;  1RAZ A;  3P44 A;  3T5U A;  3OYS A;  4Z1N A;  2X7U A;  3S72 B;  1CAI A;  1ZGF A;  1CAM A;  1BIC A;  1T9N A;  3DCW A;  3V3H B;  2CA2 A;  3ML2 A;  3M2N A;  4M2V A;  4PYX A;  4CA2 A;  4K0Z A;  3N2P A;  5A25 A;  2CBB A;  2HNC A;  4G7A A;  4ZAO A;  2Q1Q A;  3KOI A;  1FSQ A;  3IBU A;  3NI5 A;  4HEY A;  4MLT A;  3RZ8 A;  1CVF A;  3MNJ A;  4FVO A;  4L5W A;  5G01 A;  1OKN A;  4KNJ A;  4YHA A;  4YXU A;  1THK A;  1CIM A;  1CRM A;  3S8X A;  1I91 A;  3SAP A;  3BET A;  2AW1 A;  1BZM A;  2ZNC A;  4QK2 A;  4FRC A;  3S78 B;  3OIL A;  3KS3 A;  2FW4 A;  1UGB A;  4FU5 A;  4QJP A;  1TH9 A;  4JS6 A;  2NWP A;  1MOO A;  1CCS A;  4HT0 A;  2FMZ A;  1CIN A;  1YO1 A;  4XZ5 A;  2ABE A;  3MYQ A;  5FLO A;  1DMY A;  1UGF A;  3D92 A;  3DD8 A;  3T5Z A;  4LP6 A;  2EU2 A;  1DCB A;  3MNA A;  1FQL A;  2HKK A;  1JV0 A;  3M1W A;  3M3X A;  5DSM A;  5BNL A;  1CNG A;  3ML5 A;  1IF7 A;  3RYJ B;  3RZ1 B;  3HLJ A;  1BNT A;  1CNC A;  4CNR A;  3D9Z A;  1G0F A;  4HEZ A;  5J8Z A;  3DAZ A;  1I90 A;  5SZ5 A;  1TG9 A;  1G6V A;  4YWP A;  3V2J A;  5C8I A;  4YVY A;  2NNV A;  3HKT A;  4Q06 A;  4PYY A;  5AML A;  4FL7 A;  3FFP X;  3LXE A;  5FNG A;  4Q6D A;  4R59 A;  2FOS A;  4ZWI A;  1RZA A;  1KWQ A;  4QIY A;  2FOV A;  1CVC A;  3CAJ A;  5EKM A;  1HUG A;  1V9E A;  1UGC A;  2FOY A;  2Q1B A;  3CA2 A;  1ZH9 A;  5JQ0 A;  1RJ5 A;  2WD2 A;  1LG5 A;  4Q0L A;  3SAX A;  3M1K A;  2FOU A;  3Q31 A;  1FSN A;  4JSZ A;  5SZ3 A;  3OKV A;  4M2R A;  1RZE A;  3NB5 A;  3OKU A;  1CA2 A;  4WUQ A;  2NNS A;  3MMF A;  2CBA A;  1ZNC A;  1ZGE A;  2HFW A;  3DC9 A;  4RUZ A;  2NXT A;  4RFC A;  4QK3 A;  4QJO A;  2QP6 A;  3RZ7 A;  4QJX A;  4QSA A;  4CNW A;  3M04 A;  4YGN A;  1CVH A;  4ZWY A;  5A6H A;  4Q99 A;  5EZT X;  4JSW A;  5FDC A;  3F7B A;  3K2F A;  1CVE A;  1JD0 A;  5FLR A;  1V9I C;  2EZ7 A;  4L5V A;  1ZFK A;  1CAH A;  2CBC A;  2WEH A;  2QO8 A;  1YO0 A;  2NNG A;  5G0B A;  4CNX A;  1HVA A;  4Q7P A;  5SZ7 A;  2CBE A;  1IF6 A;  4Z0Q A;  4E3H A;  5JG3 B;  3N0N A;  1BNN A;  1FQN A;  4QY3 A;  5DSP A;  4QSI A;  1HCB A;  4ILX A;  3KLD B;  3RYX B;  5EHW A;  2NN1 A;  3MHM A;  5HPJ A;  4DZ7 A;  4K0S A;  5FNH A;  5IPZ A;  5CJF A;  3T82 A;  5BRV A;  2HD6 A;  4Q81 A;  4Z1K A;  4MDG A;  3S73 B;  3F8E A;  4PXX A;  1BCD A;  4QTL A;  4XFW A;  3OYQ A;  1RZD A;  3KOK A;  5JDV B;  4IWZ A;  2CBD A;  1CVB A;  1AVN A;  1H9Q A;  5FNL A;  2HOC A;  1YDD A;  1G45 A;  5E5U A;  3MNU A;  3KNE A;  1MUA A;  4E9O X;  2POW A;  3PYK A;  5E2S A;  2WEO A;  1CNW A;  1YDC A;  4R5B A;  3S75 B;  5JEG B;  1OKM A;  5L3O A;  1YDB A;  1FLJ A;  4YGF A;  1UGE A;  4KUW A;  2NNO A;  1FQR A;  2POU A;  3IBI A;  1CAJ A;  5E2R A;  5FDI A;  3MWO A;  5FL4 A;  3M67 A;  3RYV B;  1AM6 A;  1I9M A;  1DMX A;  1LUG A;  4LHI A;  5FNM A;  4YXO A;  3RG4 A;  4MDM A;  5JEH B;  3HKQ A;  4DZ9 A;  5JQT A;  1ZSB A;  3MHO A;  2O4Z A;  5E2N A;  2FOQ A;  3MNI A;  3F7U A;  3V3G B;  3S71 B;  5L6K A;  4ITO A;  4C3T A;  3JXF A;  3MDZ A;  3KWA A;  4Q07 A;  1G46 A;  1J9W A;  3U47 A;  4XE1 A;  5DSL A;  1HUH A;  5EH5 A;  5EOI A;  4Q7V A;  1CNB A;  1KEQ A;  4HT2 A;  1IF5 A;  4N0X B;  1URT A;  2F14 A;  3D0N A;  4LU3 A;  5EKH A;  4YGL A;  5DSQ A;  4HEW A;  1I9L A;  3SBH A;  4R5A A;  3V3J A;  1BV3 A;  1BNW A;  2FNM A;  5CLU A;  3M5E A;  3V2M A;  5DSJ A;  1CNJ A;  1LGD A;  3V5G A;  1BN1 A;  1UGD A;  1YDA A;  3IBL A;  3K7K A;  1CAL A;  2NWZ A;  4Q6E A;  3DD0 A;  1CNI A;  3RZ0 B;  4RUX A;  1Z9Y A;  1CNY A;  4X5S A;  1TEU X;  1LG6 A;  1A42 A;  4FPT A;  4E3F A;  3IEO A;  3ZNC A;  5JGT B;  1HEA A;  1DCA A;  1XQ0 A;  3FE4 A;  2W2J A;  4Q8Y A;  4K13 A;  1G54 A;  1G53 A;  1IF4 A;  5DSK A;  3S97 A;  3UYQ A;  1XEV A;  3C7P A;  3CYU A;  3L14 A;  2GD8 A;  4M2U A;  1KOP A;  4KAP A;  4Q90 A;  3S74 B;  4CNV A;  5DOH A;  4RH2 A;  3TMJ A;  4XIX A;  5FL5 A;  5FLS A;  5JES B;  1BN4 A;  3P3J A;  4Q8Z A;  3W6H A;  4QJW A;  3RGE A;  5DSO A;  1H4N A;  6CA2 A;  4CQ0 A;  5CAC A;  1KOQ A;  1I9Q A;  3BL0 A;  1TE3 X;  3IAI A;  1BN3 A;  4MO8 A;  4Q83 A;  1G48 A;  1BNQ A;  3P5L A;  4KUY A;  3MNH A;  4RIV A;  3EFT A;  3DV7 A;  4ETQ C;  4FIK A;  3RZ5 A;  1ZE8 A;  3M2Z A;  2X7T A;  3T85 A;  4HU1 A;  3M2Y A;  1CCU A;  1G1D A;  4Q7W A;  4YGJ A;  4IDR X;  3P3H A;  1CZM A;  3M40 A;  1ZFQ A;  3PJJ A;  5DSR A;  3KIG A;  4WUP A;  5SZ0 A;  2OSM A;  1TEQ X;  1BNM A;  2FNK A;  4KV0 A;  2H4N A;  3V7X A;  3OIM A;  1CAO A;  1CVD A;  3VBD A;  1I9N A;  1CAN A;  3DBU A;  4PQ7 A;  1I9P A;  3GZ0 A;  4ZX1 A;  1FSR A;  3MHC A;  4RIU A;  5FLT A;  1CNX A;  1Z97 A;  1HEC A;  4UOV A;  1OKL A;  4BF1 A;  4QJM A;  1G52 A;  5BRU A;  3DC3 A;  3M96 A;  2NN7 A;  3DVD A;  3OY0 A;  3M2X A;  4Q7S A;  4KP8 A;  5EIJ A;  5BRW A;  4Q49 A;  2AX2 A; 
#chains in the Genus database with same CATH homology
 2QOA A;  5JG5 B;  1XPZ A;  4Z1J A;  1KWR A;  4Q87 A;  1CVA A;  3R17 B;  5EH7 A;  3V3I B;  4ITP A;  2WEG A;  3RYY A;  1I8Z A;  5G0C A;  4Q8X A;  4WR7 A;  1TB0 X;  1RZC A;  1UGG A;  3HKN A;  8CA2 A;  4KNM A;  3TVO X;  3MNK A;  3DVB A;  2WD3 A;  4E4A A;  3M1Q A;  5FNK A;  1FQM A;  4RN4 A;  2HL4 A;  5E28 A;  1LZV A;  3KKX A;  1CAY A;  1G3Z A;  1JCZ A;  4Q09 A;  4Z1E A;  2POV A;  5DSI A;  4YGK A;  5LMD A;  4QK1 A;  1FR4 A;  3KON A;  5EHE A;  5JEP B;  3ZP9 A;  1FR7 A;  4E49 A;  3PO6 A;  2NWY A;  3DCC A;  4MLX A;  5FNI A;  3D93 A;  2VVB X;  5E2K A;  2FNN A;  4ZX0 A;  5FNJ A;  5EH8 A;  1CNK A;  1AZM A;  1CNH A;  4Y0J A;  4WW6 A;  2EU3 A;  2Q38 A;  5AMD A;  1IF9 A;  2CAB A;  3HKU A;  5EKJ A;  4E3G A;  3B1B A;  4GL1 X;  3M98 A;  5SZ4 A;  1HED A;  3MZC A;  1G4J A;  4MTY A;  3M1J A;  3S77 B;  3RG3 A;  1Z93 A;  7CA2 A;  5E2M A;  1BNV A;  4K0T A;  12CA A;  5FL6 A;  4RFD A;  1G0E A;  3U3A X;  3M5T A;  3MHI A;  3P55 A;  1ZSA A;  5DOG A;  1RJ6 A;  1OQ5 A;  5JGS B;  3BL1 A;  3R16 A;  3DA2 A;  1I9O A;  3TVN X;  4JSS A;  3OIK A;  3DCS A;  5CA2 A;  4KNI A;  3EFI A;  3RJ7 A;  3T83 A;  4BCW A;  3W6I A;  2IT4 A;  4QSB A;  1RZB A;  4WL4 A;  3M5S A;  3N3J A;  3HS4 A;  3V3F A;  4MDL A;  3CZV A;  4XIW A;  4COQ A;  3P58 A;  3S76 A;  3IBN A;  2NMX A;  2ILI A;  4TWM A;  2X7S A;  4QJ0 A;  4KNN A;  5EHV A;  1CAK A;  4JSA A;  1RAY A;  3K34 A;  1YO2 A;  5DRS A;  3IGP A;  4WW8 A;  2GEH A;  4QSJ A;  3RLD A;  3SBI A;  3HFP A;  4RUY A;  3MHL A;  5DVX A;  5DSN A;  1CAZ A;  4KUV A;  1ZSC A;  1CRA A;  3FW3 A;  4CAC A;  3F4X A;  3NJ9 A;  1UGA A;  1TTM A;  4YYT A;  1Y7W A;  4BF6 A;  3B4F A;  3U45 X;  3D8W A;  4M2W A;  4ZWZ A;  2VVA X;  3JXG A;  4Q9Y A;  5SZ1 A;  4PZH A;  4YXI A;  1F2W A;  4QEF A;  2H15 A;  1G4O A;  4KP5 A;  3RYZ A;  3U7C A;  9CA2 A;  1H9N A;  5G03 A;  4ZWX A;  1TG3 A;  2FMG A;  2OSF A;  5AMG A;  1EOU A;  2NXR A;  3QYK A;  2NWO A;  4Q78 A;  4E5Q A;  1CCT A;  4G0C A;  5SZ6 A;  1IF8 A;  4TWL A;  3JXH C;  4YX4 A;  4L5U A;  3T84 A;  1HEB A;  3N4B A;  5E5R A;  2WEJ A;  5FLQ A;  3P5A A;  1BNU A;  4QIZ A;  1CA3 A;  3M14 A;  4HBA A;  5FLP A;  1HCA A;  3P4V A;  4N16 A;  1CIL A;  4Q08 A;  4K1Q A;  4E3D A;  5BYI A;  5SZ2 A;  1XEG A;  3S9T A;  2NXS A;  1TBT X;  4HF3 A;  3UYN A;  4FVN A;  3DVC A;  1RAZ A;  3P44 A;  3T5U A;  3OYS A;  4Z1N A;  2X7U A;  3S72 B;  1CAI A;  1ZGF A;  1CAM A;  1BIC A;  1T9N A;  3DCW A;  3V3H B;  2CA2 A;  3ML2 A;  3M2N A;  4M2V A;  4PYX A;  4CA2 A;  4K0Z A;  3N2P A;  5A25 A;  2CBB A;  2HNC A;  4G7A A;  4ZAO A;  2Q1Q A;  3KOI A;  1FSQ A;  3IBU A;  3NI5 A;  4HEY A;  4MLT A;  3RZ8 A;  1CVF A;  3MNJ A;  4FVO A;  4L5W A;  5G01 A;  1OKN A;  4KNJ A;  4YHA A;  4YXU A;  1THK A;  1CIM A;  1CRM A;  3S8X A;  1I91 A;  3SAP A;  3BET A;  2AW1 A;  1BZM A;  2ZNC A;  4QK2 A;  4FRC A;  3S78 B;  3OIL A;  3KS3 A;  2FW4 A;  1UGB A;  4FU5 A;  4QJP A;  1TH9 A;  4JS6 A;  2NWP A;  1MOO A;  1CCS A;  4HT0 A;  2FMZ A;  1CIN A;  1YO1 A;  4XZ5 A;  2ABE A;  3MYQ A;  5FLO A;  1DMY A;  1UGF A;  3D92 A;  3DD8 A;  3T5Z A;  4LP6 A;  2EU2 A;  1DCB A;  3MNA A;  1FQL A;  2HKK A;  1JV0 A;  3M1W A;  3M3X A;  5DSM A;  5BNL A;  1CNG A;  3ML5 A;  1IF7 A;  3RYJ B;  3RZ1 B;  3HLJ A;  1BNT A;  1CNC A;  4CNR A;  3D9Z A;  1G0F A;  4HEZ A;  5J8Z A;  3DAZ A;  1I90 A;  5SZ5 A;  1TG9 A;  1G6V A;  4YWP A;  3V2J A;  5C8I A;  4YVY A;  2NNV A;  3HKT A;  4Q06 A;  4PYY A;  5AML A;  4FL7 A;  3FFP X;  3LXE A;  5FNG A;  4Q6D A;  4R59 A;  2FOS A;  4ZWI A;  1RZA A;  1KWQ A;  4QIY A;  2FOV A;  1CVC A;  3CAJ A;  5EKM A;  1HUG A;  1V9E A;  1UGC A;  2FOY A;  2Q1B A;  3CA2 A;  1ZH9 A;  5JQ0 A;  1RJ5 A;  2WD2 A;  1LG5 A;  4Q0L A;  3SAX A;  3M1K A;  2FOU A;  3Q31 A;  1FSN A;  4JSZ A;  5SZ3 A;  3OKV A;  4M2R A;  1RZE A;  3NB5 A;  3OKU A;  1CA2 A;  4WUQ A;  2NNS A;  3MMF A;  2CBA A;  1ZNC A;  1ZGE A;  2HFW A;  3DC9 A;  4RUZ A;  2NXT A;  4RFC A;  4QK3 A;  4QJO A;  2QP6 A;  3RZ7 A;  4QJX A;  4QSA A;  4CNW A;  3M04 A;  4YGN A;  1CVH A;  4ZWY A;  5A6H A;  4Q99 A;  5EZT X;  4JSW A;  5FDC A;  3F7B A;  3K2F A;  1CVE A;  1JD0 A;  5FLR A;  1V9I C;  2EZ7 A;  4L5V A;  1ZFK A;  1CAH A;  2CBC A;  2WEH A;  2QO8 A;  1YO0 A;  2NNG A;  5G0B A;  4CNX A;  1HVA A;  4Q7P A;  5SZ7 A;  2CBE A;  1IF6 A;  4Z0Q A;  4E3H A;  5JG3 B;  3N0N A;  1BNN A;  1FQN A;  4QY3 A;  5DSP A;  4QSI A;  1HCB A;  4ILX A;  3KLD B;  3RYX B;  5EHW A;  2NN1 A;  3MHM A;  5HPJ A;  4DZ7 A;  4K0S A;  5FNH A;  5IPZ A;  5CJF A;  3T82 A;  5BRV A;  2HD6 A;  4Q81 A;  4Z1K A;  4MDG A;  3S73 B;  3F8E A;  4PXX A;  1BCD A;  4QTL A;  4XFW A;  3OYQ A;  1RZD A;  3KOK A;  5JDV B;  4IWZ A;  2CBD A;  1CVB A;  1AVN A;  1H9Q A;  5FNL A;  2HOC A;  1YDD A;  1G45 A;  5E5U A;  3MNU A;  3KNE A;  1MUA A;  4E9O X;  2POW A;  3PYK A;  5E2S A;  2WEO A;  1CNW A;  1YDC A;  4R5B A;  3S75 B;  5JEG B;  1OKM A;  5L3O A;  1YDB A;  1FLJ A;  4YGF A;  1UGE A;  4KUW A;  2NNO A;  1FQR A;  2POU A;  3IBI A;  1CAJ A;  5E2R A;  5FDI A;  3MWO A;  5FL4 A;  3M67 A;  3RYV B;  1AM6 A;  1I9M A;  1DMX A;  1LUG A;  4LHI A;  5FNM A;  4YXO A;  3RG4 A;  4MDM A;  5JEH B;  3HKQ A;  4DZ9 A;  5JQT A;  1ZSB A;  3MHO A;  2O4Z A;  5E2N A;  2FOQ A;  3MNI A;  3F7U A;  3V3G B;  3S71 B;  5L6K A;  4ITO A;  4C3T A;  3JXF A;  3MDZ A;  3KWA A;  4Q07 A;  1G46 A;  1J9W A;  3U47 A;  4XE1 A;  5DSL A;  1HUH A;  5EH5 A;  5EOI A;  4Q7V A;  1CNB A;  1KEQ A;  4HT2 A;  1IF5 A;  4N0X B;  1URT A;  2F14 A;  3D0N A;  4LU3 A;  5EKH A;  4YGL A;  5DSQ A;  4HEW A;  1I9L A;  3SBH A;  4R5A A;  3V3J A;  1BV3 A;  1BNW A;  2FNM A;  5CLU A;  3M5E A;  3V2M A;  5DSJ A;  1CNJ A;  1LGD A;  3V5G A;  1BN1 A;  1UGD A;  1YDA A;  3IBL A;  3K7K A;  1CAL A;  2NWZ A;  4Q6E A;  3DD0 A;  1CNI A;  3RZ0 B;  4RUX A;  1Z9Y A;  1CNY A;  4X5S A;  1TEU X;  1LG6 A;  1A42 A;  4FPT A;  4E3F A;  3IEO A;  3ZNC A;  5JGT B;  1HEA A;  1DCA A;  1XQ0 A;  3FE4 A;  2W2J A;  4Q8Y A;  4K13 A;  1G54 A;  1G53 A;  1IF4 A;  5DSK A;  3S97 A;  3UYQ A;  1XEV A;  3C7P A;  3CYU A;  3L14 A;  2GD8 A;  4M2U A;  1KOP A;  4KAP A;  4Q90 A;  3S74 B;  4CNV A;  5DOH A;  4RH2 A;  3TMJ A;  4XIX A;  5FL5 A;  5FLS A;  5JES B;  1BN4 A;  3P3J A;  4Q8Z A;  3W6H A;  4QJW A;  3RGE A;  5DSO A;  1H4N A;  6CA2 A;  4CQ0 A;  5CAC A;  1KOQ A;  1I9Q A;  3BL0 A;  1TE3 X;  3IAI A;  1BN3 A;  4MO8 A;  4Q83 A;  1G48 A;  1BNQ A;  3P5L A;  4KUY A;  3MNH A;  4RIV A;  3EFT A;  3DV7 A;  4ETQ C;  4FIK A;  3RZ5 A;  1ZE8 A;  3M2Z A;  2X7T A;  3T85 A;  4HU1 A;  3M2Y A;  1CCU A;  1G1D A;  4Q7W A;  4YGJ A;  4IDR X;  3P3H A;  1CZM A;  3M40 A;  1ZFQ A;  3PJJ A;  5DSR A;  3KIG A;  4WUP A;  5SZ0 A;  2OSM A;  1TEQ X;  1BNM A;  2FNK A;  4KV0 A;  2H4N A;  3V7X A;  3OIM A;  1CAO A;  1CVD A;  3VBD A;  1I9N A;  1CAN A;  3DBU A;  4PQ7 A;  1I9P A;  3GZ0 A;  4ZX1 A;  1FSR A;  3MHC A;  4RIU A;  5FLT A;  1CNX A;  1Z97 A;  1HEC A;  4UOV A;  1OKL A;  4BF1 A;  4QJM A;  1G52 A;  5BRU A;  3DC3 A;  3M96 A;  2NN7 A;  3DVD A;  3OY0 A;  3M2X A;  4Q7S A;  4KP8 A;  5EIJ A;  5BRW A;  4Q49 A;  2AX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...