The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
3
|
sequence length |
119
|
structure length |
119
|
Chain Sequence |
GSGMKETAAAKFERQHMDSPDLGTTLLEQYCHRTTIGNFSGPYTYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
NMR structure and peptide hormone binding site of the first extracellular domain of a type B1 G protein-coupled receptor
pubmed doi rcsb |
molecule tags |
Signaling protein
|
source organism |
Mus musculus
|
molecule keywords |
Corticotropin releasing factor receptor 2
|
total genus |
3
|
structure length |
119
|
sequence length |
119
|
ec nomenclature | |
pdb deposition date | 2004-07-20 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02793 | HRM | Hormone receptor domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Hormone receptor fold | GPCR, family 2, extracellular hormone receptor domain |
#chains in the Genus database with same CATH superfamily 2JND A; 3C4M A; 3EHT A; 2JOD A; 5II0 A; 2L27 A; 3EHU A; 3IOL A; 3N7S A; 4DLQ A; 3H3G A; 1U34 A; 4LF3 C; 4HJ0 A; 2XDG A; 3C59 A; 3EHS A; 3N7R A; 3N7P A; 3AQF B; 4DLO A; 2JNC A; 4ZGM A; 2QKH A; 3L2J A; 3C5T A; 4ERS A; #chains in the Genus database with same CATH topology 2JND A; 3C4M A; 3EHT A; 2JOD A; 5II0 A; 2L27 A; 3EHU A; 3IOL A; 3N7S A; 4DLQ A; 3H3G A; 1U34 A; 4LF3 C; 4HJ0 A; 2XDG A; 3C59 A; 3EHS A; 3N7R A; 3N7P A; 3AQF B; 4DLO A; 2JNC A; 4ZGM A; 2QKH A; 3L2J A; 3C5T A; 4ERS A; #chains in the Genus database with same CATH homology 2JND A; 3C4M A; 3EHT A; 2JOD A; 5II0 A; 2L27 A; 3EHU A; 3IOL A; 3N7S A; 4DLQ A; 3H3G A; 1U34 A; 4LF3 C; 4HJ0 A; 2XDG A; 3C59 A; 3EHS A; 3N7R A; 3N7P A; 3AQF B; 4DLO A; 2JNC A; 4ZGM A; 2QKH A; 3L2J A; 3C5T A; 4ERS A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...