1UGYA

Crystal structure of jacalin- mellibiose (gal-alpha(1-6)-glc) complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHVSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Carbohydrate Specificities of Jacalin: An X-ray and Modeling Study
pubmed doi rcsb
molecule keywords Agglutinin alpha chain
molecule tags Sugar binding protein
total genus 30
structure length 133
sequence length 133
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 1ugyA00
3R51A 5J4TA 4PIKA 2BMZA 1UGWA 5J4XA 1C3MA 1OUWA 4MQ0A 4AKDA 2GUCA 4R6OA 1M26A 3LL1A 4DDNA 1WS4C 1J4SA 3WOCA 1UGYA 5JM1A 3WOBA 4R6PA 1PXDA 4PITA 2NUOA 1WS5A 2BMYA 2GTYA 4PIFA 1JACA 3VY6A 3APAA 1KU8A 1J4TA 1UGXA 3VZGA 4WOGA 2HYRA 4R6NA 4AKCA 3VZEA 3MITA 1TP8A 1X1VA 4R6RA 3LLZA 1TOQA 1KUJA 2GUXA 5J51A 1C3NA 5AV7A 5BN6E 3MIVA 2GUDA 4AKBA 2NU5A 1UH1A 1ZGSA 3VY7A 3LL0A 3O44A 1JOTA 1UH0A 2JZ4A 4R6QA 2BN0A 4PIUA 1VBPA 1WS4A 3R50A 1UGWC 3VZFA 3LLYA 5J50A 1XXQA 1C3KA 5EXGA 1XXRA 4GX7A 2GUEA 3LL2A 1XEZA 3P8SA 1VBOA 1UGYC 3LKYA 1J4UA 3LM1A 4AK4A 3AQGA 3MIUA 1ZGRA 2HYQA 3R52A 1WS5C
chains in the Genus database with same CATH superfamily
1CIYA 3R51A 4PIKA 2BMZA 1UGWA 5J4TA 5J4XA 1C3MA 4ARYA 1OUWA 1DLCA 4MQ0A 4AKDA 2GUCA 4R6OA 1M26A 3LL1A 4DDNA 1WS4C 1J4SA 3WOCA 1UGYA 5JM1A 3WOBA 4R6PA 1PXDA 4PITA 2NUOA 1WS5A 2BMYA 2GTYA 4PIFA 1JACA 3VY6A 3APAA 1KU8A 1J4TA 1UGXA 3EB7A 3VZGA 2QP2A 4WOGA 2HYRA 4R6NA 4AKCA 3VZEA 3MITA 1TP8A 1X1VA 4R6RA 3LLZA 1TOQA 1KUJA 2GUXA 5J51A 4QX2A 1C3NA 1I5PA 1W99A 5AV7A 5BN6E 3MIVA 2GUDA 4AKBA 2NU5A 1UH1A 1JI6A 1ZGSA 3VY7A 3LL0A 3O44A 1JOTA 1UH0A 4ARXA 2JZ4A 4MOAA 4D8MA 4R6QA 2BN0A 4PIUA 1VBPA 1WS4A 3R50A 1UGWC 4QX3A 3VZFA 3TOWA 4QX0A 3LLYA 5J50A 1XXQA 2C9KA 1C3KA 5EXGA 1XXRA 4GX7A 2GUEA 3LL2A 1XEZA 3P8SA 1VBOA 1UGYC 3LKYA 1J4UA 3LM1A 4W8JA 1VMOA 4AK4A 4QX1A 3AQGA 3MIUA 1ZGRA 2HYQA 3R52A 1WS5C
chains in the Genus database with same CATH topology
3R51A 5J4TA 4PIKA 2BMZA 1UGWA 5J4XA 1C3MA 1OUWA 4MQ0A 4AKDA 2GUCA 4R6OA 1M26A 3LL1A 4DDNA 1WS4C 1J4SA 3WOCA 1UGYA 5JM1A 3WOBA 4R6PA 1PXDA 4PITA 2NUOA 1WS5A 2BMYA 2GTYA 4PIFA 1JACA 3VY6A 3APAA 1KU8A 1J4TA 1UGXA 3VZGA 4WOGA 2HYRA 4R6NA 4AKCA 3VZEA 3MITA 1TP8A 1X1VA 4R6RA 3LLZA 1TOQA 1KUJA 2GUXA 5J51A 1C3NA 5AV7A 5BN6E 3MIVA 2GUDA 4AKBA 2NU5A 1UH1A 1ZGSA 3VY7A 3LL0A 3O44A 1JOTA 1UH0A 2JZ4A 4R6QA 2BN0A 4PIUA 1VBPA 1WS4A 3R50A 1UGWC 3VZFA 3LLYA 5J50A 1XXQA 1C3KA 5EXGA 1XXRA 4GX7A 2GUEA 3LL2A 1XEZA 3P8SA 1VBOA 1UGYC 3LKYA 1J4UA 3LM1A 4AK4A 3AQGA 3MIUA 1ZGRA 2HYQA 3R52A 1WS5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R51 A;  5J4T A;  4PIK A;  2BMZ A;  1UGW A;  5J4X A;  1C3M A;  1OUW A;  4MQ0 A;  4AKD A;  2GUC A;  4R6O A;  1M26 A;  3LL1 A;  4DDN A;  1WS4 C;  1J4S A;  3WOC A;  1UGY A;  5JM1 A;  3WOB A;  4R6P A;  1PXD A;  4PIT A;  2NUO A;  1WS5 A;  2BMY A;  2GTY A;  4PIF A;  1JAC A;  3VY6 A;  3APA A;  1KU8 A;  1J4T A;  1UGX A;  3VZG A;  4WOG A;  2HYR A;  4R6N A;  4AKC A;  3VZE A;  3MIT A;  1TP8 A;  1X1V A;  4R6R A;  3LLZ A;  1TOQ A;  1KUJ A;  2GUX A;  5J51 A;  1C3N A;  5AV7 A;  5BN6 E;  3MIV A;  2GUD A;  4AKB A;  2NU5 A;  1UH1 A;  1ZGS A;  3VY7 A;  3LL0 A;  3O44 A;  1JOT A;  1UH0 A;  2JZ4 A;  4R6Q A;  2BN0 A;  4PIU A;  1VBP A;  1WS4 A;  3R50 A;  1UGW C;  3VZF A;  3LLY A;  5J50 A;  1XXQ A;  1C3K A;  5EXG A;  1XXR A;  4GX7 A;  2GUE A;  3LL2 A;  1XEZ A;  3P8S A;  1VBO A;  1UGY C;  3LKY A;  1J4U A;  3LM1 A;  4AK4 A;  3AQG A;  3MIU A;  1ZGR A;  2HYQ A;  3R52 A;  1WS5 C; 
#chains in the Genus database with same CATH topology
 1CIY A;  3R51 A;  4PIK A;  2BMZ A;  1UGW A;  5J4T A;  5J4X A;  1C3M A;  4ARY A;  1OUW A;  1DLC A;  4MQ0 A;  4AKD A;  2GUC A;  4R6O A;  1M26 A;  3LL1 A;  4DDN A;  1WS4 C;  1J4S A;  3WOC A;  1UGY A;  5JM1 A;  3WOB A;  4R6P A;  1PXD A;  4PIT A;  2NUO A;  1WS5 A;  2BMY A;  2GTY A;  4PIF A;  1JAC A;  3VY6 A;  3APA A;  1KU8 A;  1J4T A;  1UGX A;  3EB7 A;  3VZG A;  2QP2 A;  4WOG A;  2HYR A;  4R6N A;  4AKC A;  3VZE A;  3MIT A;  1TP8 A;  1X1V A;  4R6R A;  3LLZ A;  1TOQ A;  1KUJ A;  2GUX A;  5J51 A;  4QX2 A;  1C3N A;  1I5P A;  1W99 A;  5AV7 A;  5BN6 E;  3MIV A;  2GUD A;  4AKB A;  2NU5 A;  1UH1 A;  1JI6 A;  1ZGS A;  3VY7 A;  3LL0 A;  3O44 A;  1JOT A;  1UH0 A;  4ARX A;  2JZ4 A;  4MOA A;  4D8M A;  4R6Q A;  2BN0 A;  4PIU A;  1VBP A;  1WS4 A;  3R50 A;  1UGW C;  4QX3 A;  3VZF A;  3TOW A;  4QX0 A;  3LLY A;  5J50 A;  1XXQ A;  2C9K A;  1C3K A;  5EXG A;  1XXR A;  4GX7 A;  2GUE A;  3LL2 A;  1XEZ A;  3P8S A;  1VBO A;  1UGY C;  3LKY A;  1J4U A;  3LM1 A;  4W8J A;  1VMO A;  4AK4 A;  4QX1 A;  3AQG A;  3MIU A;  1ZGR A;  2HYQ A;  3R52 A;  1WS5 C; 
#chains in the Genus database with same CATH homology
 3R51 A;  5J4T A;  4PIK A;  2BMZ A;  1UGW A;  5J4X A;  1C3M A;  1OUW A;  4MQ0 A;  4AKD A;  2GUC A;  4R6O A;  1M26 A;  3LL1 A;  4DDN A;  1WS4 C;  1J4S A;  3WOC A;  1UGY A;  5JM1 A;  3WOB A;  4R6P A;  1PXD A;  4PIT A;  2NUO A;  1WS5 A;  2BMY A;  2GTY A;  4PIF A;  1JAC A;  3VY6 A;  3APA A;  1KU8 A;  1J4T A;  1UGX A;  3VZG A;  4WOG A;  2HYR A;  4R6N A;  4AKC A;  3VZE A;  3MIT A;  1TP8 A;  1X1V A;  4R6R A;  3LLZ A;  1TOQ A;  1KUJ A;  2GUX A;  5J51 A;  1C3N A;  5AV7 A;  5BN6 E;  3MIV A;  2GUD A;  4AKB A;  2NU5 A;  1UH1 A;  1ZGS A;  3VY7 A;  3LL0 A;  3O44 A;  1JOT A;  1UH0 A;  2JZ4 A;  4R6Q A;  2BN0 A;  4PIU A;  1VBP A;  1WS4 A;  3R50 A;  1UGW C;  3VZF A;  3LLY A;  5J50 A;  1XXQ A;  1C3K A;  5EXG A;  1XXR A;  4GX7 A;  2GUE A;  3LL2 A;  1XEZ A;  3P8S A;  1VBO A;  1UGY C;  3LKY A;  1J4U A;  3LM1 A;  4AK4 A;  3AQG A;  3MIU A;  1ZGR A;  2HYQ A;  3R52 A;  1WS5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...