1VQ4O

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 34
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vq4O00
3CCMO 1VQ4L 2OTJL 1VQ5O 3I55L 3CC7O 1KQSK 3CC4O 3CCVO 1VQLL 3CCJL 2QEXO 1K73M 1NJIM 1VQ9O 3CD6O 2OTLL 3CMAL 3CMEL 1YI2O 1S72O 3CCEL 1VQPO 1K73P 1YJNL 1NJIP 3CXCK 3CXCN 1VQNO 1VQ6L 3G6EL 1Q7YM 3I56L 3CCQO 1VQOO 1YJ9O 1VQML 1Q7YP 1VQ8L 2QA4O 1YIJO 3CCRO 1YHQO 3CCLL 1YITL 1Q86M 1KQSN 3CC2O 3CCUL 1VQKO 3CCML 1VQ4O 1VQ7L 1Q86P 2OTJO 1KC8M 1QVGK 1QVGN 1N8RM 1VQ5L 3CC7L 3CCSO 1KC8P 3CC4L 3CCJO 3CCVL 1N8RP 2QEXL 1VQ9L 3CMAO 3G4SO 1S72L 1YJWL 1VQPL 1QVFK 3G71O 1QVFN 1VQ6O 1VQNL 3I56O 1Q82M 1VQOL 1YJ9L 1W2BK 1W2BN 1JJ2K 1JJ2N 1VQ8O 1YIJL 3CCLO 3CCRL 1Q82P 3I55O 1YHQL 1M90M 1Q81M 3CC2L 1VQKL 1VQLO 1VQ7O 1KD1M 1M90P 2OTLO 1Q81P 3CD6L 3CMEO 1KD1P 3CCEO 1YI2L 1K9MM 3CCSL 1YJNO 1K8AM 3G6EO 1K9MP 3CCQL 1K8AP 1VQMO 1M1KM 3G4SL 3CPWK 3CPWN 1YJWO 2QA4L 1YITO 3G71L 3OW2K 3OW2N 1M1KP 3CCUO
chains in the Genus database with same CATH superfamily
3CCMO 1VQ4L 5DQZA 2OTJL 1VQ5O 3I55L 3CC7O 1KQSK 3CC4O 3CCVO 1VQLL 3CCJL 2QEXO 1K73M 1NJIM 1VQ9O 3CD6O 2OTLL 3CMAL 4WJ0A 3CMEL 1YI2O 1S72O 3CCEL 1VQPO 1K73P 1YJNL 1NJIP 3CXCK 3CXCN 1VQNO 1VQ6L 3G6EL 3GODA 1Q7YM 3I56L 3CCQO 5DQTA 1VQOO 1YJ9O 1VQML 1Q7YP 1VQ8L 2QA4O 1YIJO 3CCRO 1YHQO 3CCLL 1YITL 1Q86M 1KQSN 3CC2O 3CCUL 1VQKO 5DS5A 3CCML 1VQ4O 1VQ7L 4P6IC 1Q86P 2OTJO 1KC8M 4QDLA 1QVGK 1QVGN 1N8RM 1VQ5L 3CC7L 3CCSO 1KC8P 3CC4L 3CCJO 3CCVL 1N8RP 2QEXL 1VQ9L 3CMAO 3G4SO 1S72L 1YJWL 1VQPL 1QVFK 3G71O 1QVFN 1VQ6O 1VQNL 3I56O 1Q82M 1VQOL 2YZSA 1YJ9L 1W2BK 1W2BN 1JJ2K 1JJ2N 1VQ8O 1YIJL 3CCLO 3CCRL 1Q82P 5FCLA 1YHQL 3I55O 1M90M 1Q81M 3CC2L 5DS6A 1VQKL 1VQLO 1VQ7O 1KD1M 1M90P 2OTLO 4N06A 1Q81P 3CD6L 3NKDA 3CMEO 1KD1P 3CCEO 1YI2L 1K9MM 3CCSL 1YJNO 1K8AM 3G6EO 4XTKA 1K9MP 3CCQL 1K8AP 1VQMO 1M1KM 3G4SL 3CPWK 3CPWN 1YJWO 5DS4A 2QA4L 1YITO 3G71L 3OW2K 3OW2N 5DLJA 1M1KP 3CCUO 4W8KA
chains in the Genus database with same CATH topology
3CCMO 1VQ4L 5DQZA 2OTJL 1VQ5O 3I55L 3CC7O 1KQSK 3CC4O 3CCVO 1VQLL 3CCJL 2QEXO 1K73M 1NJIM 1VQ9O 3CD6O 2OTLL 3CMAL 4WJ0A 3CMEL 1YI2O 1S72O 3CCEL 1VQPO 1K73P 1YJNL 1NJIP 3CXCK 3CXCN 1VQNO 1VQ6L 3G6EL 3GODA 1Q7YM 3I56L 3CCQO 5DQTA 1VQOO 1YJ9O 1VQML 1Q7YP 1VQ8L 2QA4O 1YIJO 3CCRO 1YHQO 3CCLL 1YITL 1Q86M 1KQSN 3CC2O 3CCUL 1VQKO 5DS5A 3CCML 1VQ4O 1VQ7L 4P6IC 1Q86P 2OTJO 1KC8M 4QDLA 1QVGK 1QVGN 1N8RM 1VQ5L 3CC7L 3CCSO 1KC8P 3CC4L 3CCJO 3CCVL 1N8RP 2QEXL 1VQ9L 3CMAO 3G4SO 1S72L 1YJWL 1VQPL 1QVFK 3G71O 1QVFN 1VQ6O 1VQNL 3I56O 1Q82M 1VQOL 2YZSA 1YJ9L 1W2BK 1W2BN 1JJ2K 1JJ2N 1VQ8O 1YIJL 3CCLO 3CCRL 1Q82P 5FCLA 1YHQL 3I55O 1M90M 1Q81M 3CC2L 5DS6A 1VQKL 1VQLO 1VQ7O 1KD1M 1M90P 2OTLO 4N06A 1Q81P 3CD6L 3NKDA 3CMEO 1KD1P 3CCEO 1YI2L 1K9MM 3CCSL 1YJNO 1K8AM 3G6EO 4XTKA 1K9MP 3CCQL 1K8AP 1VQMO 1M1KM 3G4SL 3CPWK 3CPWN 1YJWO 5DS4A 2QA4L 1YITO 3G71L 3OW2K 3OW2N 5DLJA 1M1KP 3CCUO 4W8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM O;  1VQ4 L;  2OTJ L;  1VQ5 O;  3I55 L;  3CC7 O;  1KQS K;  3CC4 O;  3CCV O;  1VQL L;  3CCJ L;  2QEX O;  1K73 M;  1NJI M;  1VQ9 O;  3CD6 O;  2OTL L;  3CMA L;  3CME L;  1YI2 O;  1S72 O;  3CCE L;  1VQP O;  1K73 P;  1YJN L;  1NJI P;  3CXC K;  3CXC N;  1VQN O;  1VQ6 L;  3G6E L;  1Q7Y M;  3I56 L;  3CCQ O;  1VQO O;  1YJ9 O;  1VQM L;  1Q7Y P;  1VQ8 L;  2QA4 O;  1YIJ O;  3CCR O;  1YHQ O;  3CCL L;  1YIT L;  1Q86 M;  1KQS N;  3CC2 O;  3CCU L;  1VQK O;  3CCM L;  1VQ4 O;  1VQ7 L;  1Q86 P;  2OTJ O;  1KC8 M;  1QVG K;  1QVG N;  1N8R M;  1VQ5 L;  3CC7 L;  3CCS O;  1KC8 P;  3CC4 L;  3CCJ O;  3CCV L;  1N8R P;  2QEX L;  1VQ9 L;  3CMA O;  3G4S O;  1S72 L;  1YJW L;  1VQP L;  1QVF K;  3G71 O;  1QVF N;  1VQ6 O;  1VQN L;  3I56 O;  1Q82 M;  1VQO L;  1YJ9 L;  1W2B K;  1W2B N;  1JJ2 K;  1JJ2 N;  1VQ8 O;  1YIJ L;  3CCL O;  3CCR L;  1Q82 P;  3I55 O;  1YHQ L;  1M90 M;  1Q81 M;  3CC2 L;  1VQK L;  1VQL O;  1VQ7 O;  1KD1 M;  1M90 P;  2OTL O;  1Q81 P;  3CD6 L;  3CME O;  1KD1 P;  3CCE O;  1YI2 L;  1K9M M;  3CCS L;  1YJN O;  1K8A M;  3G6E O;  1K9M P;  3CCQ L;  1K8A P;  1VQM O;  1M1K M;  3G4S L;  3CPW K;  3CPW N;  1YJW O;  2QA4 L;  1YIT O;  3G71 L;  3OW2 K;  3OW2 N;  1M1K P;  3CCU O; 
#chains in the Genus database with same CATH topology
 3CCM O;  1VQ4 L;  5DQZ A;  2OTJ L;  1VQ5 O;  3I55 L;  3CC7 O;  1KQS K;  3CC4 O;  3CCV O;  1VQL L;  3CCJ L;  2QEX O;  1K73 M;  1NJI M;  1VQ9 O;  3CD6 O;  2OTL L;  3CMA L;  4WJ0 A;  3CME L;  1YI2 O;  1S72 O;  3CCE L;  1VQP O;  1K73 P;  1YJN L;  1NJI P;  3CXC K;  3CXC N;  1VQN O;  1VQ6 L;  3G6E L;  3GOD A;  1Q7Y M;  3I56 L;  3CCQ O;  5DQT A;  1VQO O;  1YJ9 O;  1VQM L;  1Q7Y P;  1VQ8 L;  2QA4 O;  1YIJ O;  3CCR O;  1YHQ O;  3CCL L;  1YIT L;  1Q86 M;  1KQS N;  3CC2 O;  3CCU L;  1VQK O;  5DS5 A;  3CCM L;  1VQ4 O;  1VQ7 L;  4P6I C;  1Q86 P;  2OTJ O;  1KC8 M;  4QDL A;  1QVG K;  1QVG N;  1N8R M;  1VQ5 L;  3CC7 L;  3CCS O;  1KC8 P;  3CC4 L;  3CCJ O;  3CCV L;  1N8R P;  2QEX L;  1VQ9 L;  3CMA O;  3G4S O;  1S72 L;  1YJW L;  1VQP L;  1QVF K;  3G71 O;  1QVF N;  1VQ6 O;  1VQN L;  3I56 O;  1Q82 M;  1VQO L;  2YZS A;  1YJ9 L;  1W2B K;  1W2B N;  1JJ2 K;  1JJ2 N;  1VQ8 O;  1YIJ L;  3CCL O;  3CCR L;  1Q82 P;  5FCL A;  1YHQ L;  3I55 O;  1M90 M;  1Q81 M;  3CC2 L;  5DS6 A;  1VQK L;  1VQL O;  1VQ7 O;  1KD1 M;  1M90 P;  2OTL O;  4N06 A;  1Q81 P;  3CD6 L;  3NKD A;  3CME O;  1KD1 P;  3CCE O;  1YI2 L;  1K9M M;  3CCS L;  1YJN O;  1K8A M;  3G6E O;  4XTK A;  1K9M P;  3CCQ L;  1K8A P;  1VQM O;  1M1K M;  3G4S L;  3CPW K;  3CPW N;  1YJW O;  5DS4 A;  2QA4 L;  1YIT O;  3G71 L;  3OW2 K;  3OW2 N;  5DLJ A;  1M1K P;  3CCU O;  4W8K A; 
#chains in the Genus database with same CATH homology
 3CCM O;  1VQ4 L;  5DQZ A;  2OTJ L;  1VQ5 O;  3I55 L;  3CC7 O;  1KQS K;  3CC4 O;  3CCV O;  1VQL L;  3CCJ L;  2QEX O;  1K73 M;  1NJI M;  1VQ9 O;  3CD6 O;  2OTL L;  3CMA L;  4WJ0 A;  3CME L;  1YI2 O;  1S72 O;  3CCE L;  1VQP O;  1K73 P;  1YJN L;  1NJI P;  3CXC K;  3CXC N;  1VQN O;  1VQ6 L;  3G6E L;  3GOD A;  1Q7Y M;  3I56 L;  3CCQ O;  5DQT A;  1VQO O;  1YJ9 O;  1VQM L;  1Q7Y P;  1VQ8 L;  2QA4 O;  1YIJ O;  3CCR O;  1YHQ O;  3CCL L;  1YIT L;  1Q86 M;  1KQS N;  3CC2 O;  3CCU L;  1VQK O;  5DS5 A;  3CCM L;  1VQ4 O;  1VQ7 L;  4P6I C;  1Q86 P;  2OTJ O;  1KC8 M;  4QDL A;  1QVG K;  1QVG N;  1N8R M;  1VQ5 L;  3CC7 L;  3CCS O;  1KC8 P;  3CC4 L;  3CCJ O;  3CCV L;  1N8R P;  2QEX L;  1VQ9 L;  3CMA O;  3G4S O;  1S72 L;  1YJW L;  1VQP L;  1QVF K;  3G71 O;  1QVF N;  1VQ6 O;  1VQN L;  3I56 O;  1Q82 M;  1VQO L;  2YZS A;  1YJ9 L;  1W2B K;  1W2B N;  1JJ2 K;  1JJ2 N;  1VQ8 O;  1YIJ L;  3CCL O;  3CCR L;  1Q82 P;  5FCL A;  1YHQ L;  3I55 O;  1M90 M;  1Q81 M;  3CC2 L;  5DS6 A;  1VQK L;  1VQL O;  1VQ7 O;  1KD1 M;  1M90 P;  2OTL O;  4N06 A;  1Q81 P;  3CD6 L;  3NKD A;  3CME O;  1KD1 P;  3CCE O;  1YI2 L;  1K9M M;  3CCS L;  1YJN O;  1K8A M;  3G6E O;  4XTK A;  1K9M P;  3CCQ L;  1K8A P;  1VQM O;  1M1K M;  3G4S L;  3CPW K;  3CPW N;  1YJW O;  5DS4 A;  2QA4 L;  1YIT O;  3G71 L;  3OW2 K;  3OW2 N;  5DLJ A;  1M1K P;  3CCU O;  4W8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...