1VQ5O

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 34
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vq5O00
3CCUO 1K73M 2OTLO 3CCML 1VQPL 3G6EL 1YJWO 1KC8M 1VQLL 3CD6L 1VQ7L 3CCEO 1YJNO 3CC7O 3CCQL 1VQML 3CC4L 2QA4O 1VQ5O 3CC2O 1Q7YP 3CCRL 3CCVL 1W2BK 1KQSK 3CCLL 1Q81P 1M1KM 3CMAL 3I56O 1YJ9L 1QVFK 3I55O 1K9MM 3OW2K 1KQSN 1QVGK 1VQOO 1K8AM 3CCUL 1NJIM 1QVFN 2OTLL 1M90P 1VQ4O 3OW2N 3G71O 1YIJO 1QVGN 1YHQO 1YJWL 1Q82P 1YI2O 1YJNL 3CCEL 3CC7L 3CCJO 2QA4L 3CXCK 1VQ5L 3CC2L 1JJ2K 1VQ6O 1KD1P 1Q86P 1VQ8O 3CXCN 3CCSO 3CMEO 2OTJO 1JJ2N 3I56L 1Q7YM 3I55L 1VQ7O 1N8RP 1VQNO 1VQ9O 1Q81M 1VQOL 1M1KP 3G4SO 1S72O 1VQ4L 2QEXO 3G71L 1K9MP 1YIJL 1K73P 1VQKO 1K8AP 1M90M 1YI2L 3CCJL 1YITO 1KC8P 1Q82M 3CCMO 1VQ6L 1VQPO 1VQ8L 3G6EO 3CCSL 3CMEL 2OTJL 1VQLO 3CD6O 3CCQO 1VQMO 1KD1M 3CC4O 1Q86M 1VQNL 1VQ9L 3CPWK 3CCRO 3CCVO 3G4SL 1S72L 1YHQL 2QEXL 3CCLO 1NJIP 1N8RM 3CPWN 3CMAO 1VQKL 1YJ9O 1W2BN 1YITL
chains in the Genus database with same CATH superfamily
3CCUO 1K73M 2OTLO 3CCML 1VQPL 3G6EL 1YJWO 1KC8M 1VQLL 3CD6L 1VQ7L 5DLJA 3CCEO 1YJNO 3CC7O 3CCQL 1VQML 3CC4L 5DS4A 2QA4O 4QDLA 2YZSA 1VQ5O 3CC2O 1Q7YP 3CCRL 3CCVL 1W2BK 4W8KA 1KQSK 3CCLL 1Q81P 1M1KM 3CMAL 3I56O 1YJ9L 1QVFK 3I55O 1K9MM 3OW2K 1KQSN 1QVGK 1VQOO 1K8AM 3CCUL 1NJIM 1QVFN 2OTLL 1M90P 1VQ4O 3OW2N 3G71O 1YIJO 1QVGN 1YHQO 1YJWL 1Q82P 4P6IC 1YI2O 1YJNL 3CCEL 3CC7L 3CCJO 2QA4L 3CXCK 1VQ5L 3CC2L 1JJ2K 1VQ6O 1KD1P 3NKDA 1Q86P 1VQ8O 3CXCN 3GODA 3CCSO 3CMEO 2OTJO 5DQTA 1JJ2N 3I56L 1Q7YM 3I55L 5DQZA 5DS6A 1VQ7O 1N8RP 1VQNO 1VQ9O 1Q81M 1VQOL 1M1KP 3G4SO 1S72O 1VQ4L 2QEXO 3G71L 1K9MP 1YIJL 1K73P 1VQKO 1K8AP 5DS5A 4N06A 1M90M 1YI2L 3CCJL 1YITO 1KC8P 1Q82M 3CCMO 1VQ6L 1VQPO 1VQ8L 3G6EO 3CCSL 3CMEL 2OTJL 1VQLO 3CD6O 5FCLA 3CCQO 1VQMO 1KD1M 3CC4O 1Q86M 1VQNL 1VQ9L 3CPWK 3CCRO 3CCVO 3G4SL 1S72L 1YHQL 2QEXL 3CCLO 4XTKA 1NJIP 1N8RM 3CMAO 3CPWN 1VQKL 1YJ9O 1W2BN 4WJ0A 1YITL
chains in the Genus database with same CATH topology
3CCUO 1K73M 2OTLO 3CCML 1VQPL 3G6EL 1YJWO 1KC8M 1VQLL 3CD6L 1VQ7L 5DLJA 3CCEO 1YJNO 3CC7O 3CCQL 1VQML 3CC4L 5DS4A 2QA4O 4QDLA 2YZSA 1VQ5O 3CC2O 1Q7YP 3CCRL 3CCVL 1W2BK 4W8KA 1KQSK 3CCLL 1Q81P 1M1KM 3CMAL 3I56O 1YJ9L 1QVFK 3I55O 1K9MM 3OW2K 1KQSN 1QVGK 1VQOO 1K8AM 3CCUL 1NJIM 1QVFN 2OTLL 1M90P 1VQ4O 3OW2N 3G71O 1YIJO 1QVGN 1YHQO 1YJWL 1Q82P 4P6IC 1YI2O 1YJNL 3CCEL 3CC7L 3CCJO 2QA4L 3CXCK 1VQ5L 3CC2L 1JJ2K 1VQ6O 1KD1P 3NKDA 1Q86P 1VQ8O 3CXCN 3GODA 3CCSO 3CMEO 2OTJO 5DQTA 1JJ2N 3I56L 1Q7YM 3I55L 5DQZA 5DS6A 1VQ7O 1N8RP 1VQNO 1VQ9O 1Q81M 1VQOL 1M1KP 3G4SO 1S72O 1VQ4L 2QEXO 3G71L 1K9MP 1YIJL 1K73P 1VQKO 1K8AP 5DS5A 4N06A 1M90M 1YI2L 3CCJL 1YITO 1KC8P 1Q82M 3CCMO 1VQ6L 1VQPO 1VQ8L 3G6EO 3CCSL 3CMEL 2OTJL 1VQLO 3CD6O 5FCLA 3CCQO 1VQMO 1KD1M 3CC4O 1Q86M 1VQNL 1VQ9L 3CPWK 3CCRO 3CCVO 3G4SL 1S72L 1YHQL 2QEXL 3CCLO 4XTKA 1NJIP 1N8RM 3CMAO 3CPWN 1VQKL 1YJ9O 1W2BN 4WJ0A 1YITL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU O;  1K73 M;  2OTL O;  3CCM L;  1VQP L;  3G6E L;  1YJW O;  1KC8 M;  1VQL L;  3CD6 L;  1VQ7 L;  3CCE O;  1YJN O;  3CC7 O;  3CCQ L;  1VQM L;  3CC4 L;  2QA4 O;  1VQ5 O;  3CC2 O;  1Q7Y P;  3CCR L;  3CCV L;  1W2B K;  1KQS K;  3CCL L;  1Q81 P;  1M1K M;  3CMA L;  3I56 O;  1YJ9 L;  1QVF K;  3I55 O;  1K9M M;  3OW2 K;  1KQS N;  1QVG K;  1VQO O;  1K8A M;  3CCU L;  1NJI M;  1QVF N;  2OTL L;  1M90 P;  1VQ4 O;  3OW2 N;  3G71 O;  1YIJ O;  1QVG N;  1YHQ O;  1YJW L;  1Q82 P;  1YI2 O;  1YJN L;  3CCE L;  3CC7 L;  3CCJ O;  2QA4 L;  3CXC K;  1VQ5 L;  3CC2 L;  1JJ2 K;  1VQ6 O;  1KD1 P;  1Q86 P;  1VQ8 O;  3CXC N;  3CCS O;  3CME O;  2OTJ O;  1JJ2 N;  3I56 L;  1Q7Y M;  3I55 L;  1VQ7 O;  1N8R P;  1VQN O;  1VQ9 O;  1Q81 M;  1VQO L;  1M1K P;  3G4S O;  1S72 O;  1VQ4 L;  2QEX O;  3G71 L;  1K9M P;  1YIJ L;  1K73 P;  1VQK O;  1K8A P;  1M90 M;  1YI2 L;  3CCJ L;  1YIT O;  1KC8 P;  1Q82 M;  3CCM O;  1VQ6 L;  1VQP O;  1VQ8 L;  3G6E O;  3CCS L;  3CME L;  2OTJ L;  1VQL O;  3CD6 O;  3CCQ O;  1VQM O;  1KD1 M;  3CC4 O;  1Q86 M;  1VQN L;  1VQ9 L;  3CPW K;  3CCR O;  3CCV O;  3G4S L;  1S72 L;  1YHQ L;  2QEX L;  3CCL O;  1NJI P;  1N8R M;  3CPW N;  3CMA O;  1VQK L;  1YJ9 O;  1W2B N;  1YIT L; 
#chains in the Genus database with same CATH topology
 3CCU O;  1K73 M;  2OTL O;  3CCM L;  1VQP L;  3G6E L;  1YJW O;  1KC8 M;  1VQL L;  3CD6 L;  1VQ7 L;  5DLJ A;  3CCE O;  1YJN O;  3CC7 O;  3CCQ L;  1VQM L;  3CC4 L;  5DS4 A;  2QA4 O;  4QDL A;  2YZS A;  1VQ5 O;  3CC2 O;  1Q7Y P;  3CCR L;  3CCV L;  1W2B K;  4W8K A;  1KQS K;  3CCL L;  1Q81 P;  1M1K M;  3CMA L;  3I56 O;  1YJ9 L;  1QVF K;  3I55 O;  1K9M M;  3OW2 K;  1KQS N;  1QVG K;  1VQO O;  1K8A M;  3CCU L;  1NJI M;  1QVF N;  2OTL L;  1M90 P;  1VQ4 O;  3OW2 N;  3G71 O;  1YIJ O;  1QVG N;  1YHQ O;  1YJW L;  1Q82 P;  4P6I C;  1YI2 O;  1YJN L;  3CCE L;  3CC7 L;  3CCJ O;  2QA4 L;  3CXC K;  1VQ5 L;  3CC2 L;  1JJ2 K;  1VQ6 O;  1KD1 P;  3NKD A;  1Q86 P;  1VQ8 O;  3CXC N;  3GOD A;  3CCS O;  3CME O;  2OTJ O;  5DQT A;  1JJ2 N;  3I56 L;  1Q7Y M;  3I55 L;  5DQZ A;  5DS6 A;  1VQ7 O;  1N8R P;  1VQN O;  1VQ9 O;  1Q81 M;  1VQO L;  1M1K P;  3G4S O;  1S72 O;  1VQ4 L;  2QEX O;  3G71 L;  1K9M P;  1YIJ L;  1K73 P;  1VQK O;  1K8A P;  5DS5 A;  4N06 A;  1M90 M;  1YI2 L;  3CCJ L;  1YIT O;  1KC8 P;  1Q82 M;  3CCM O;  1VQ6 L;  1VQP O;  1VQ8 L;  3G6E O;  3CCS L;  3CME L;  2OTJ L;  1VQL O;  3CD6 O;  5FCL A;  3CCQ O;  1VQM O;  1KD1 M;  3CC4 O;  1Q86 M;  1VQN L;  1VQ9 L;  3CPW K;  3CCR O;  3CCV O;  3G4S L;  1S72 L;  1YHQ L;  2QEX L;  3CCL O;  4XTK A;  1NJI P;  1N8R M;  3CMA O;  3CPW N;  1VQK L;  1YJ9 O;  1W2B N;  4WJ0 A;  1YIT L; 
#chains in the Genus database with same CATH homology
 3CCU O;  1K73 M;  2OTL O;  3CCM L;  1VQP L;  3G6E L;  1YJW O;  1KC8 M;  1VQL L;  3CD6 L;  1VQ7 L;  5DLJ A;  3CCE O;  1YJN O;  3CC7 O;  3CCQ L;  1VQM L;  3CC4 L;  5DS4 A;  2QA4 O;  4QDL A;  2YZS A;  1VQ5 O;  3CC2 O;  1Q7Y P;  3CCR L;  3CCV L;  1W2B K;  4W8K A;  1KQS K;  3CCL L;  1Q81 P;  1M1K M;  3CMA L;  3I56 O;  1YJ9 L;  1QVF K;  3I55 O;  1K9M M;  3OW2 K;  1KQS N;  1QVG K;  1VQO O;  1K8A M;  3CCU L;  1NJI M;  1QVF N;  2OTL L;  1M90 P;  1VQ4 O;  3OW2 N;  3G71 O;  1YIJ O;  1QVG N;  1YHQ O;  1YJW L;  1Q82 P;  4P6I C;  1YI2 O;  1YJN L;  3CCE L;  3CC7 L;  3CCJ O;  2QA4 L;  3CXC K;  1VQ5 L;  3CC2 L;  1JJ2 K;  1VQ6 O;  1KD1 P;  3NKD A;  1Q86 P;  1VQ8 O;  3CXC N;  3GOD A;  3CCS O;  3CME O;  2OTJ O;  5DQT A;  1JJ2 N;  3I56 L;  1Q7Y M;  3I55 L;  5DQZ A;  5DS6 A;  1VQ7 O;  1N8R P;  1VQN O;  1VQ9 O;  1Q81 M;  1VQO L;  1M1K P;  3G4S O;  1S72 O;  1VQ4 L;  2QEX O;  3G71 L;  1K9M P;  1YIJ L;  1K73 P;  1VQK O;  1K8A P;  5DS5 A;  4N06 A;  1M90 M;  1YI2 L;  3CCJ L;  1YIT O;  1KC8 P;  1Q82 M;  3CCM O;  1VQ6 L;  1VQP O;  1VQ8 L;  3G6E O;  3CCS L;  3CME L;  2OTJ L;  1VQL O;  3CD6 O;  5FCL A;  3CCQ O;  1VQM O;  1KD1 M;  3CC4 O;  1Q86 M;  1VQN L;  1VQ9 L;  3CPW K;  3CCR O;  3CCV O;  3G4S L;  1S72 L;  1YHQ L;  2QEX L;  3CCL O;  4XTK A;  1NJI P;  1N8R M;  3CMA O;  3CPW N;  1VQK L;  1YJ9 O;  1W2B N;  4WJ0 A;  1YIT L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...