1VQ6L

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 28
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vq6L02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1vq6L01
1QVGN 1K9MM 3CCQL 3G71L 3CMAO 1VQ8O 3CCVL 2QEXO 3CCUL 1Q7YM 1VQNL 1VQLO 3CC2O 3CCJO 1K9MP 1NJIM 3G6EO 1K73P 1VQPO 1YITO 1YHQL 3G4SO 1YI2O 1VQ6O 1VQ5O 1M1KM 3CCRL 3I56L 1YJWL 1NJIP 3CXCK 1K8AP 3I55O 1VQOO 1VQMO 1VQKO 1M1KP 1K73M 3CC7L 1YIJO 2OTLL 2OTJO 2QA4L 3CCQO 3G71O 1YJNL 1K8AM 3CCVO 3CCUO 1VQNO 1QVFK 3CD6L 3CCLL 1YJ9L 3CC4L 3CPWK 1VQ4O 1YHQO 3CCSL 1KQSK 3CCML 3CMEL 3CCRO 3CXCN 3I56O 3OW2K 1YJWO 1VQ9O 1VQ7L 1KQSN 3CCEL 3OW2N 1S72L 1VQLL 1KC8M 1QVGK 3CC7O 2OTLO 3CMAL 1VQ8L 1Q81M 2QEXL 1M90P 1YJNO 1KD1P 2OTJL 3CC2L 1KC8P 3CCJL 1Q82P 1QVFN 3G6EL 3CD6O 1Q81P 1VQPL 3CCLO 1YJ9O 1YITL 3CPWN 3CC4O 3G4SL 1YI2L 1VQ6L 1VQ5L 1Q86M 1N8RM 3CCSO 1M90M 3CCMO 1W2BK 1KD1M 1VQ4L 3I55L 3CMEO 1VQOL 1Q7YP 1VQML 1Q82M 1JJ2K 1VQ7O 1VQKL 1Q86P 1N8RP 1W2BN 2QA4O 1VQ9L 3CCEO 1S72O 1YIJL 1JJ2N
chains in the Genus database with same CATH superfamily
1QVGN 1K9MM 3CCQL 3G71L 3CMAO 1VQ8O 3CCVL 2QEXO 3CCUL 1Q7YM 1VQNL 5DS4A 1VQLO 3CC2O 3CCJO 1K9MP 1NJIM 3G6EO 4N06A 1VQPO 1K73P 1YITO 1YHQL 3G4SO 1YI2O 1VQ6O 1VQ5O 1M1KM 4W8KA 3CCRL 3I56L 1YJWL 1NJIP 3CXCK 1K8AP 3I55O 1VQOO 1VQMO 5DQZA 1VQKO 1M1KP 1K73M 3CC7L 5DLJA 1YIJO 2OTLL 2OTJO 2QA4L 3CCQO 3G71O 5FCLA 1YJNL 1K8AM 3CCVO 3CCUO 1VQNO 1QVFK 3CD6L 5DS5A 3CCLL 1YJ9L 3CC4L 3CPWK 1VQ4O 1YHQO 3CCSL 4XTKA 1KQSK 3CCML 3CMEL 3CCRO 3I56O 3CXCN 3OW2K 1YJWO 1VQ9O 1VQ7L 1KQSN 5DQTA 3CCEL 3OW2N 1S72L 1VQLL 1KC8M 5DS6A 1QVGK 3CC7O 2OTLO 3CMAL 1VQ8L 1Q81M 2QEXL 1M90P 1YJNO 1KD1P 2YZSA 2OTJL 4P6IC 3CC2L 1KC8P 3CCJL 1Q82P 1QVFN 4WJ0A 3G6EL 3CD6O 1Q81P 1VQPL 3CCLO 1YJ9O 1YITL 3CPWN 3CC4O 3G4SL 1YI2L 1VQ6L 1VQ5L 1Q86M 1N8RM 3CCSO 4QDLA 1M90M 3CCMO 1W2BK 1KD1M 1VQ4L 3I55L 3CMEO 1VQOL 1Q7YP 1VQML 1Q82M 1JJ2K 1VQ7O 1VQKL 1Q86P 1N8RP 3NKDA 2QA4O 3GODA 1W2BN 1VQ9L 3CCEO 1S72O 1YIJL 1JJ2N
chains in the Genus database with same CATH topology
1QVGN 1K9MM 3CCQL 3G71L 3CMAO 1VQ8O 3CCVL 2QEXO 3CCUL 1Q7YM 1VQNL 5DS4A 1VQLO 3CC2O 3CCJO 1K9MP 1NJIM 3G6EO 4N06A 1VQPO 1K73P 1YITO 1YHQL 3G4SO 1YI2O 1VQ6O 1VQ5O 1M1KM 4W8KA 3CCRL 3I56L 1YJWL 1NJIP 3CXCK 1K8AP 3I55O 1VQOO 1VQMO 5DQZA 1VQKO 1M1KP 1K73M 3CC7L 5DLJA 1YIJO 2OTLL 2OTJO 2QA4L 3CCQO 3G71O 5FCLA 1YJNL 1K8AM 3CCVO 3CCUO 1VQNO 1QVFK 3CD6L 5DS5A 3CCLL 1YJ9L 3CC4L 3CPWK 1VQ4O 1YHQO 3CCSL 4XTKA 1KQSK 3CCML 3CMEL 3CCRO 3I56O 3CXCN 3OW2K 1YJWO 1VQ9O 1VQ7L 1KQSN 5DQTA 3CCEL 3OW2N 1S72L 1VQLL 1KC8M 5DS6A 1QVGK 3CC7O 2OTLO 3CMAL 1VQ8L 1Q81M 2QEXL 1M90P 1YJNO 1KD1P 2YZSA 2OTJL 4P6IC 3CC2L 1KC8P 3CCJL 1Q82P 1QVFN 4WJ0A 3G6EL 3CD6O 1Q81P 1VQPL 3CCLO 1YJ9O 1YITL 3CPWN 3CC4O 3G4SL 1YI2L 1VQ6L 1VQ5L 1Q86M 1N8RM 3CCSO 4QDLA 1M90M 3CCMO 1W2BK 1KD1M 1VQ4L 3I55L 3CMEO 1VQOL 1Q7YP 1VQML 1Q82M 1JJ2K 1VQ7O 1VQKL 1Q86P 1N8RP 3NKDA 2QA4O 3GODA 1W2BN 1VQ9L 3CCEO 1S72O 1YIJL 1JJ2N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG N;  1K9M M;  3CCQ L;  3G71 L;  3CMA O;  1VQ8 O;  3CCV L;  2QEX O;  3CCU L;  1Q7Y M;  1VQN L;  1VQL O;  3CC2 O;  3CCJ O;  1K9M P;  1NJI M;  3G6E O;  1K73 P;  1VQP O;  1YIT O;  1YHQ L;  3G4S O;  1YI2 O;  1VQ6 O;  1VQ5 O;  1M1K M;  3CCR L;  3I56 L;  1YJW L;  1NJI P;  3CXC K;  1K8A P;  3I55 O;  1VQO O;  1VQM O;  1VQK O;  1M1K P;  1K73 M;  3CC7 L;  1YIJ O;  2OTL L;  2OTJ O;  2QA4 L;  3CCQ O;  3G71 O;  1YJN L;  1K8A M;  3CCV O;  3CCU O;  1VQN O;  1QVF K;  3CD6 L;  3CCL L;  1YJ9 L;  3CC4 L;  3CPW K;  1VQ4 O;  1YHQ O;  3CCS L;  1KQS K;  3CCM L;  3CME L;  3CCR O;  3CXC N;  3I56 O;  3OW2 K;  1YJW O;  1VQ9 O;  1VQ7 L;  1KQS N;  3CCE L;  3OW2 N;  1S72 L;  1VQL L;  1KC8 M;  1QVG K;  3CC7 O;  2OTL O;  3CMA L;  1VQ8 L;  1Q81 M;  2QEX L;  1M90 P;  1YJN O;  1KD1 P;  2OTJ L;  3CC2 L;  1KC8 P;  3CCJ L;  1Q82 P;  1QVF N;  3G6E L;  3CD6 O;  1Q81 P;  1VQP L;  3CCL O;  1YJ9 O;  1YIT L;  3CPW N;  3CC4 O;  3G4S L;  1YI2 L;  1VQ6 L;  1VQ5 L;  1Q86 M;  1N8R M;  3CCS O;  1M90 M;  3CCM O;  1W2B K;  1KD1 M;  1VQ4 L;  3I55 L;  3CME O;  1VQO L;  1Q7Y P;  1VQM L;  1Q82 M;  1JJ2 K;  1VQ7 O;  1VQK L;  1Q86 P;  1N8R P;  1W2B N;  2QA4 O;  1VQ9 L;  3CCE O;  1S72 O;  1YIJ L;  1JJ2 N; 
#chains in the Genus database with same CATH topology
 1QVG N;  1K9M M;  3CCQ L;  3G71 L;  3CMA O;  1VQ8 O;  3CCV L;  2QEX O;  3CCU L;  1Q7Y M;  1VQN L;  5DS4 A;  1VQL O;  3CC2 O;  3CCJ O;  1K9M P;  1NJI M;  3G6E O;  4N06 A;  1VQP O;  1K73 P;  1YIT O;  1YHQ L;  3G4S O;  1YI2 O;  1VQ6 O;  1VQ5 O;  1M1K M;  4W8K A;  3CCR L;  3I56 L;  1YJW L;  1NJI P;  3CXC K;  1K8A P;  3I55 O;  1VQO O;  1VQM O;  5DQZ A;  1VQK O;  1M1K P;  1K73 M;  3CC7 L;  5DLJ A;  1YIJ O;  2OTL L;  2OTJ O;  2QA4 L;  3CCQ O;  3G71 O;  5FCL A;  1YJN L;  1K8A M;  3CCV O;  3CCU O;  1VQN O;  1QVF K;  3CD6 L;  5DS5 A;  3CCL L;  1YJ9 L;  3CC4 L;  3CPW K;  1VQ4 O;  1YHQ O;  3CCS L;  4XTK A;  1KQS K;  3CCM L;  3CME L;  3CCR O;  3I56 O;  3CXC N;  3OW2 K;  1YJW O;  1VQ9 O;  1VQ7 L;  1KQS N;  5DQT A;  3CCE L;  3OW2 N;  1S72 L;  1VQL L;  1KC8 M;  5DS6 A;  1QVG K;  3CC7 O;  2OTL O;  3CMA L;  1VQ8 L;  1Q81 M;  2QEX L;  1M90 P;  1YJN O;  1KD1 P;  2YZS A;  2OTJ L;  4P6I C;  3CC2 L;  1KC8 P;  3CCJ L;  1Q82 P;  1QVF N;  4WJ0 A;  3G6E L;  3CD6 O;  1Q81 P;  1VQP L;  3CCL O;  1YJ9 O;  1YIT L;  3CPW N;  3CC4 O;  3G4S L;  1YI2 L;  1VQ6 L;  1VQ5 L;  1Q86 M;  1N8R M;  3CCS O;  4QDL A;  1M90 M;  3CCM O;  1W2B K;  1KD1 M;  1VQ4 L;  3I55 L;  3CME O;  1VQO L;  1Q7Y P;  1VQM L;  1Q82 M;  1JJ2 K;  1VQ7 O;  1VQK L;  1Q86 P;  1N8R P;  3NKD A;  2QA4 O;  3GOD A;  1W2B N;  1VQ9 L;  3CCE O;  1S72 O;  1YIJ L;  1JJ2 N; 
#chains in the Genus database with same CATH homology
 1QVG N;  1K9M M;  3CCQ L;  3G71 L;  3CMA O;  1VQ8 O;  3CCV L;  2QEX O;  3CCU L;  1Q7Y M;  1VQN L;  5DS4 A;  1VQL O;  3CC2 O;  3CCJ O;  1K9M P;  1NJI M;  3G6E O;  4N06 A;  1VQP O;  1K73 P;  1YIT O;  1YHQ L;  3G4S O;  1YI2 O;  1VQ6 O;  1VQ5 O;  1M1K M;  4W8K A;  3CCR L;  3I56 L;  1YJW L;  1NJI P;  3CXC K;  1K8A P;  3I55 O;  1VQO O;  1VQM O;  5DQZ A;  1VQK O;  1M1K P;  1K73 M;  3CC7 L;  5DLJ A;  1YIJ O;  2OTL L;  2OTJ O;  2QA4 L;  3CCQ O;  3G71 O;  5FCL A;  1YJN L;  1K8A M;  3CCV O;  3CCU O;  1VQN O;  1QVF K;  3CD6 L;  5DS5 A;  3CCL L;  1YJ9 L;  3CC4 L;  3CPW K;  1VQ4 O;  1YHQ O;  3CCS L;  4XTK A;  1KQS K;  3CCM L;  3CME L;  3CCR O;  3I56 O;  3CXC N;  3OW2 K;  1YJW O;  1VQ9 O;  1VQ7 L;  1KQS N;  5DQT A;  3CCE L;  3OW2 N;  1S72 L;  1VQL L;  1KC8 M;  5DS6 A;  1QVG K;  3CC7 O;  2OTL O;  3CMA L;  1VQ8 L;  1Q81 M;  2QEX L;  1M90 P;  1YJN O;  1KD1 P;  2YZS A;  2OTJ L;  4P6I C;  3CC2 L;  1KC8 P;  3CCJ L;  1Q82 P;  1QVF N;  4WJ0 A;  3G6E L;  3CD6 O;  1Q81 P;  1VQP L;  3CCL O;  1YJ9 O;  1YIT L;  3CPW N;  3CC4 O;  3G4S L;  1YI2 L;  1VQ6 L;  1VQ5 L;  1Q86 M;  1N8R M;  3CCS O;  4QDL A;  1M90 M;  3CCM O;  1W2B K;  1KD1 M;  1VQ4 L;  3I55 L;  3CME O;  1VQO L;  1Q7Y P;  1VQM L;  1Q82 M;  1JJ2 K;  1VQ7 O;  1VQK L;  1Q86 P;  1N8R P;  3NKD A;  2QA4 O;  3GOD A;  1W2B N;  1VQ9 L;  3CCE O;  1S72 O;  1YIJ L;  1JJ2 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...