1VQ6O

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 33
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vq6O00
3CCQO 1YIJO 1NJIP 1Q82P 1YJNO 2OTLL 1VQKL 1M1KM 1Q81P 2OTJL 3CCRO 1KQSK 1YJ9O 1VQML 1Q82M 1KC8M 1YHQL 1Q81M 3CCUL 1K73P 1K9MM 2QEXO 3CC7O 1VQLO 1YI2L 1YJWL 1K73M 3G6EO 3CCSO 1VQNO 1YJ9L 1S72O 1VQ4L 1QVFN 1YITO 3CC2L 1VQ7O 1M90P 3CMEO 3CC4O 1VQLL 3CMAO 1N8RP 1QVFK 3CCVL 3CXCN 3CCEO 1M90M 1NJIM 3CD6O 1Q86P 3CCMO 1VQPO 1VQ9O 3CCQL 1YIJL 1W2BN 1VQ5O 3CXCK 1YJNL 1Q86M 3CCRL 1KD1P 1JJ2N 3CD6L 1W2BK 3I55O 2QA4O 3CCML 3I56O 1VQ9L 3OW2N 2QEXL 1VQ6O 1KD1M 3CC7L 1JJ2K 1K8AP 3G6EL 3CCSL 1VQNL 1VQ8O 3OW2K 2OTLO 3CPWK 1VQKO 1VQOO 1S72L 3CCLO 1N8RM 2OTJO 1YITL 1QVGN 1VQMO 1VQ7L 3CMEL 1K8AM 3CC4L 3CCJO 3CMAL 1YHQO 3CCUO 3CCEL 1QVGK 1KC8P 1Q7YP 1VQ8L 1VQPL 1VQOL 3CCLL 1YI2O 1YJWO 1K9MP 3CPWN 1VQ5L 1VQ4O 1Q7YM 3G4SO 3G71O 3CCJL 3CC2O 3I55L 2QA4L 3CCVO 3I56L 1VQ6L 1M1KP 1KQSN 3G4SL 3G71L
chains in the Genus database with same CATH superfamily
3CCQO 1YIJO 3GODA 1NJIP 1Q82P 1YJNO 2OTLL 4QDLA 5DS6A 1VQKL 1M1KM 1Q81P 2OTJL 3CCRO 1KQSK 1YJ9O 1VQML 1Q82M 1KC8M 5FCLA 1YHQL 1Q81M 3CCUL 1K73P 1K9MM 2QEXO 3CC7O 1VQLO 1YI2L 1YJWL 1K73M 3G6EO 3CCSO 1VQNO 1YJ9L 2YZSA 1S72O 1VQ4L 1QVFN 1YITO 3CC2L 1VQ7O 1M90P 3CMEO 3CC4O 1VQLL 3CMAO 5DLJA 1N8RP 1QVFK 3CCVL 3CXCN 3CCEO 1M90M 1NJIM 3CD6O 1Q86P 3CCMO 1VQPO 1VQ9O 3CCQL 1YIJL 5DQZA 1W2BN 1VQ5O 3CXCK 1YJNL 1Q86M 3NKDA 3CCRL 1KD1P 1JJ2N 3CD6L 1W2BK 3I55O 2QA4O 3CCML 3I56O 1VQ9L 3OW2N 2QEXL 1VQ6O 1KD1M 3CC7L 5DS4A 1JJ2K 1K8AP 3G6EL 3CCSL 1VQNL 1VQ8O 3OW2K 2OTLO 3CPWK 4N06A 1VQKO 1VQOO 1S72L 3CCLO 1N8RM 2OTJO 1YITL 1QVGN 4W8KA 1VQMO 1VQ7L 3CMEL 1K8AM 3CC4L 3CCJO 3CMAL 1YHQO 3CCUO 4XTKA 3CCEL 1QVGK 1KC8P 1Q7YP 1VQ8L 1VQPL 1VQOL 3CCLL 1YI2O 1YJWO 5DS5A 1K9MP 3CPWN 1VQ5L 5DQTA 1VQ4O 1Q7YM 3G4SO 3G71O 3CCJL 3CC2O 4WJ0A 3I55L 2QA4L 3CCVO 3I56L 1VQ6L 4P6IC 1M1KP 1KQSN 3G4SL 3G71L
chains in the Genus database with same CATH topology
3CCQO 1YIJO 3GODA 1NJIP 1Q82P 1YJNO 2OTLL 4QDLA 5DS6A 1VQKL 1M1KM 1Q81P 2OTJL 3CCRO 1KQSK 1YJ9O 1VQML 1Q82M 1KC8M 5FCLA 1YHQL 1Q81M 3CCUL 1K73P 1K9MM 2QEXO 3CC7O 1VQLO 1YI2L 1YJWL 1K73M 3G6EO 3CCSO 1VQNO 1YJ9L 2YZSA 1S72O 1VQ4L 1QVFN 1YITO 3CC2L 1VQ7O 1M90P 3CMEO 3CC4O 1VQLL 3CMAO 5DLJA 1N8RP 1QVFK 3CCVL 3CXCN 3CCEO 1M90M 1NJIM 3CD6O 1Q86P 3CCMO 1VQPO 1VQ9O 3CCQL 1YIJL 5DQZA 1W2BN 1VQ5O 3CXCK 1YJNL 1Q86M 3NKDA 3CCRL 1KD1P 1JJ2N 3CD6L 1W2BK 3I55O 2QA4O 3CCML 3I56O 1VQ9L 3OW2N 2QEXL 1VQ6O 1KD1M 3CC7L 5DS4A 1JJ2K 1K8AP 3G6EL 3CCSL 1VQNL 1VQ8O 3OW2K 2OTLO 3CPWK 4N06A 1VQKO 1VQOO 1S72L 3CCLO 1N8RM 2OTJO 1YITL 1QVGN 4W8KA 1VQMO 1VQ7L 3CMEL 1K8AM 3CC4L 3CCJO 3CMAL 1YHQO 3CCUO 4XTKA 3CCEL 1QVGK 1KC8P 1Q7YP 1VQ8L 1VQPL 1VQOL 3CCLL 1YI2O 1YJWO 5DS5A 1K9MP 3CPWN 1VQ5L 5DQTA 1VQ4O 1Q7YM 3G4SO 3G71O 3CCJL 3CC2O 4WJ0A 3I55L 2QA4L 3CCVO 3I56L 1VQ6L 4P6IC 1M1KP 1KQSN 3G4SL 3G71L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ O;  1YIJ O;  1NJI P;  1Q82 P;  1YJN O;  2OTL L;  1VQK L;  1M1K M;  1Q81 P;  2OTJ L;  3CCR O;  1KQS K;  1YJ9 O;  1VQM L;  1Q82 M;  1KC8 M;  1YHQ L;  1Q81 M;  3CCU L;  1K73 P;  1K9M M;  2QEX O;  3CC7 O;  1VQL O;  1YI2 L;  1YJW L;  1K73 M;  3G6E O;  3CCS O;  1VQN O;  1YJ9 L;  1S72 O;  1VQ4 L;  1QVF N;  1YIT O;  3CC2 L;  1VQ7 O;  1M90 P;  3CME O;  3CC4 O;  1VQL L;  3CMA O;  1N8R P;  1QVF K;  3CCV L;  3CXC N;  3CCE O;  1M90 M;  1NJI M;  3CD6 O;  1Q86 P;  3CCM O;  1VQP O;  1VQ9 O;  3CCQ L;  1YIJ L;  1W2B N;  1VQ5 O;  3CXC K;  1YJN L;  1Q86 M;  3CCR L;  1KD1 P;  1JJ2 N;  3CD6 L;  1W2B K;  3I55 O;  2QA4 O;  3CCM L;  3I56 O;  1VQ9 L;  3OW2 N;  2QEX L;  1VQ6 O;  1KD1 M;  3CC7 L;  1JJ2 K;  1K8A P;  3G6E L;  3CCS L;  1VQN L;  1VQ8 O;  3OW2 K;  2OTL O;  3CPW K;  1VQK O;  1VQO O;  1S72 L;  3CCL O;  1N8R M;  2OTJ O;  1YIT L;  1QVG N;  1VQM O;  1VQ7 L;  3CME L;  1K8A M;  3CC4 L;  3CCJ O;  3CMA L;  1YHQ O;  3CCU O;  3CCE L;  1QVG K;  1KC8 P;  1Q7Y P;  1VQ8 L;  1VQP L;  1VQO L;  3CCL L;  1YI2 O;  1YJW O;  1K9M P;  3CPW N;  1VQ5 L;  1VQ4 O;  1Q7Y M;  3G4S O;  3G71 O;  3CCJ L;  3CC2 O;  3I55 L;  2QA4 L;  3CCV O;  3I56 L;  1VQ6 L;  1M1K P;  1KQS N;  3G4S L;  3G71 L; 
#chains in the Genus database with same CATH topology
 3CCQ O;  1YIJ O;  3GOD A;  1NJI P;  1Q82 P;  1YJN O;  2OTL L;  4QDL A;  5DS6 A;  1VQK L;  1M1K M;  1Q81 P;  2OTJ L;  3CCR O;  1KQS K;  1YJ9 O;  1VQM L;  1Q82 M;  1KC8 M;  5FCL A;  1YHQ L;  1Q81 M;  3CCU L;  1K73 P;  1K9M M;  2QEX O;  3CC7 O;  1VQL O;  1YI2 L;  1YJW L;  1K73 M;  3G6E O;  3CCS O;  1VQN O;  1YJ9 L;  2YZS A;  1S72 O;  1VQ4 L;  1QVF N;  1YIT O;  3CC2 L;  1VQ7 O;  1M90 P;  3CME O;  3CC4 O;  1VQL L;  3CMA O;  5DLJ A;  1N8R P;  1QVF K;  3CCV L;  3CXC N;  3CCE O;  1M90 M;  1NJI M;  3CD6 O;  1Q86 P;  3CCM O;  1VQP O;  1VQ9 O;  3CCQ L;  1YIJ L;  5DQZ A;  1W2B N;  1VQ5 O;  3CXC K;  1YJN L;  1Q86 M;  3NKD A;  3CCR L;  1KD1 P;  1JJ2 N;  3CD6 L;  1W2B K;  3I55 O;  2QA4 O;  3CCM L;  3I56 O;  1VQ9 L;  3OW2 N;  2QEX L;  1VQ6 O;  1KD1 M;  3CC7 L;  5DS4 A;  1JJ2 K;  1K8A P;  3G6E L;  3CCS L;  1VQN L;  1VQ8 O;  3OW2 K;  2OTL O;  3CPW K;  4N06 A;  1VQK O;  1VQO O;  1S72 L;  3CCL O;  1N8R M;  2OTJ O;  1YIT L;  1QVG N;  4W8K A;  1VQM O;  1VQ7 L;  3CME L;  1K8A M;  3CC4 L;  3CCJ O;  3CMA L;  1YHQ O;  3CCU O;  4XTK A;  3CCE L;  1QVG K;  1KC8 P;  1Q7Y P;  1VQ8 L;  1VQP L;  1VQO L;  3CCL L;  1YI2 O;  1YJW O;  5DS5 A;  1K9M P;  3CPW N;  1VQ5 L;  5DQT A;  1VQ4 O;  1Q7Y M;  3G4S O;  3G71 O;  3CCJ L;  3CC2 O;  4WJ0 A;  3I55 L;  2QA4 L;  3CCV O;  3I56 L;  1VQ6 L;  4P6I C;  1M1K P;  1KQS N;  3G4S L;  3G71 L; 
#chains in the Genus database with same CATH homology
 3CCQ O;  1YIJ O;  3GOD A;  1NJI P;  1Q82 P;  1YJN O;  2OTL L;  4QDL A;  5DS6 A;  1VQK L;  1M1K M;  1Q81 P;  2OTJ L;  3CCR O;  1KQS K;  1YJ9 O;  1VQM L;  1Q82 M;  1KC8 M;  5FCL A;  1YHQ L;  1Q81 M;  3CCU L;  1K73 P;  1K9M M;  2QEX O;  3CC7 O;  1VQL O;  1YI2 L;  1YJW L;  1K73 M;  3G6E O;  3CCS O;  1VQN O;  1YJ9 L;  2YZS A;  1S72 O;  1VQ4 L;  1QVF N;  1YIT O;  3CC2 L;  1VQ7 O;  1M90 P;  3CME O;  3CC4 O;  1VQL L;  3CMA O;  5DLJ A;  1N8R P;  1QVF K;  3CCV L;  3CXC N;  3CCE O;  1M90 M;  1NJI M;  3CD6 O;  1Q86 P;  3CCM O;  1VQP O;  1VQ9 O;  3CCQ L;  1YIJ L;  5DQZ A;  1W2B N;  1VQ5 O;  3CXC K;  1YJN L;  1Q86 M;  3NKD A;  3CCR L;  1KD1 P;  1JJ2 N;  3CD6 L;  1W2B K;  3I55 O;  2QA4 O;  3CCM L;  3I56 O;  1VQ9 L;  3OW2 N;  2QEX L;  1VQ6 O;  1KD1 M;  3CC7 L;  5DS4 A;  1JJ2 K;  1K8A P;  3G6E L;  3CCS L;  1VQN L;  1VQ8 O;  3OW2 K;  2OTL O;  3CPW K;  4N06 A;  1VQK O;  1VQO O;  1S72 L;  3CCL O;  1N8R M;  2OTJ O;  1YIT L;  1QVG N;  4W8K A;  1VQM O;  1VQ7 L;  3CME L;  1K8A M;  3CC4 L;  3CCJ O;  3CMA L;  1YHQ O;  3CCU O;  4XTK A;  3CCE L;  1QVG K;  1KC8 P;  1Q7Y P;  1VQ8 L;  1VQP L;  1VQO L;  3CCL L;  1YI2 O;  1YJW O;  5DS5 A;  1K9M P;  3CPW N;  1VQ5 L;  5DQT A;  1VQ4 O;  1Q7Y M;  3G4S O;  3G71 O;  3CCJ L;  3CC2 O;  4WJ0 A;  3I55 L;  2QA4 L;  3CCV O;  3I56 L;  1VQ6 L;  4P6I C;  1M1K P;  1KQS N;  3G4S L;  3G71 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...