1VQ7H

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
171
structure length
160
Chain Sequence
KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 39
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1vq7H00
1WKIA 2ZJRJ 3I55H 3DLLJ 2QEXH 4IO9J 1Q86J 1YJWH 2ZJQJ 1JJ2H 4IOAJ 5DM7J 1N8RJ 5GADN 1KD1J 3PIOJ 3CC7H 4WCEJ 1VQ6H 5MLCO 4UY8M 3CF5J 2OTLH 3PIPJ 2ZJPJ 5JVHJ 3I56H 3CCLH 2QA4H 5AN9F 1QVGH 5GAGN 1YJ9H 1YJNH 3G71H 5DM6J 1VQ8H 3OW2H 1VQ9H 5H1SO 1VQPH 3CC4H 1VQMH 3J7ZM 5GAEN 1KC8J 1KQSH 3CCSH 3CCMH 3CCRH 1K73J 1QVFH 3CCQH 1K8AJ 1VQOH 3CC2H 1YITH 1Q7YJ 2OTJH 1VQ5H 5JVGJ 3CPWH 3CCEH 3CMAH 5GAHN 3CCUH 1NJIJ 1W2BH 3CCVH 1Y69K 1S72H 3CXCH 1M1KJ 4WF9J 3CD6H 5HL7J 1M90J 4WFBJ 1Q82J 1VQLH 2PA2A 4IOCJ 1VQKH 1Q81J 1K9MJ 3CMEH 1VQ4H 4WFNJ 1YI2H 4U67J 3G4SH 1VQ7H 3CCJH 1VQNH 1YIJH 4WFAJ 3G6EH 1YHQH
chains in the Genus database with same CATH superfamily
1WKIA 2ZJRJ 3AM9A 5AYZA 3I55H 3DLLJ 2TPTA 2QEXH 4IO9J 3AN1A 1JROB 3TQVA 4YYYA 1Q86J 1YJWH 2WK6A 1SB3A 4C7YA 1FO4A 1WYGA 3BIIE 4US8A 2ZJQJ 3C2VA 1FMAE 1JJ2H 4IOAJ 5DM7J 1N8RJ 2QIEA 5GADN 1KD1J 3PIOJ 4C80A 1N63B 1N61B 3FC4A 3CC7H 1QPRA 1QPQA 3NVYC 4WCEJ 4I9AA 2J0FA 3C2RA 1VQ6H 5MLCO 4UY8M 3CF5J 2OTLH 3PIPJ 3L0GA 2W54B 1N62B 5AYXA 4AP8A 3NVVC 3I56H 2ZJPJ 3C2FA 5JVHJ 1YTEA 1RM6A 2I1OA 3SR6C 3CCLH 4C7ZA 2QA4H 3C2EA 5AN9F 2I14A 4ZOHA 1QVGH 2B7QA 1FFVB 2W55B 1N5WB 3WNZA 5GAGN 1YJ9H 1YJNH 1O4UA 3G71H 5AYYA 3GNNA 3WO1A 5DM6J 1VQ8H 3OW2H 1VQ9H 5MPOC 5H1SO 1VQPH 3CC4H 1VQMH 1N5XA 3NS1C 1BRWA 3J7ZM 3H5QA 3NRZC 2Q5WE 1NVJA 5GAEN 1KC8J 1KQSH 4GA4A 4XR5A 3PAJA 1X1OA 5HUOA 3EUB4 5EY3A 3CCSH 1UOUA 1VLBA 1DGJA 3CCMH 3CCRH 1QPNA 4GA6A 4X46A 1K73J 1QVFH 2E3TA 4KWVA 3VMMA 3CCQH 1K8AJ 1VQOH 1ZXIB 5HULA 1FIQC 3CC2H 4YEKA 2B7PA 4EADA 2DSJA 1YITH 1V97A 1Q7YJ 2W3SB 2OTJH 1QAPA 1OTPA 3WO0A 2B7NA 1SIJA 3AMZA 5JVGJ 1VQ5H 3NVWC 2OMDA 3CPWH 3CCEH 3L4PA 5HUPA 3CMAH 1QPOA 2WK5A 5GAHN 3CCUH 1NJIJ 1W2BH 1FM0E 1YTKA 3CCVH 1FFUB 1Y69K 1S72H 3CXCH 4KWWA 1AZYA 1N60B 1M1KJ 4WF9J 3CD6H 4EAFA 1JRPB 2W3RB 3B9JC 4GA5A 2WP4A 4USAA 4LHMA 5HL7J 1M90J 4WFBJ 1Q82J 1VQLH 2PA2A 4IOCJ 2JBMA 1VQKH 1Q81J 3C2OA 1K9MJ 3CMEH 3RPFA 3ETRC 1VQ4H 4WFNJ 1YI2H 3NVZC 1VDVA 4US9A 4U67J 3G4SH 1NVIE 1VQ7H 3CCJH 1YTDA 3FAHA 1VQNH 1YIJH 4WFAJ 3G6EH 1YHQH 5EP8A
chains in the Genus database with same CATH topology
1WKIA 2ZJRJ 3I55H 3DLLJ 2QEXH 4IO9J 1Q86J 1YJWH 2ZJQJ 1JJ2H 4IOAJ 5DM7J 1N8RJ 5GADN 1KD1J 3PIOJ 3CC7H 4WCEJ 1VQ6H 5MLCO 4UY8M 3CF5J 2OTLH 3PIPJ 2ZJPJ 5JVHJ 3I56H 3CCLH 2QA4H 5AN9F 1QVGH 5GAGN 1YJ9H 1YJNH 3G71H 5DM6J 1VQ8H 3OW2H 1VQ9H 5H1SO 1VQPH 3CC4H 1VQMH 3J7ZM 5GAEN 1KC8J 1KQSH 3CCSH 3CCMH 3CCRH 1K73J 1QVFH 3CCQH 1K8AJ 1VQOH 3CC2H 1YITH 1Q7YJ 2OTJH 1VQ5H 5JVGJ 3CPWH 3CCEH 3CMAH 5GAHN 3CCUH 1NJIJ 1W2BH 3CCVH 1Y69K 1S72H 3CXCH 1M1KJ 4WF9J 3CD6H 5HL7J 1M90J 4WFBJ 1Q82J 1VQLH 2PA2A 4IOCJ 1VQKH 1Q81J 1K9MJ 3CMEH 1VQ4H 4WFNJ 1YI2H 4U67J 3G4SH 1VQ7H 3CCJH 1VQNH 1YIJH 4WFAJ 3G6EH 1YHQH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKI A;  2ZJR J;  3I55 H;  3DLL J;  2QEX H;  4IO9 J;  1Q86 J;  1YJW H;  2ZJQ J;  1JJ2 H;  4IOA J;  5DM7 J;  1N8R J;  5GAD N;  1KD1 J;  3PIO J;  3CC7 H;  4WCE J;  1VQ6 H;  5MLC O;  4UY8 M;  3CF5 J;  2OTL H;  3PIP J;  2ZJP J;  5JVH J;  3I56 H;  3CCL H;  2QA4 H;  5AN9 F;  1QVG H;  5GAG N;  1YJ9 H;  1YJN H;  3G71 H;  5DM6 J;  1VQ8 H;  3OW2 H;  1VQ9 H;  5H1S O;  1VQP H;  3CC4 H;  1VQM H;  3J7Z M;  5GAE N;  1KC8 J;  1KQS H;  3CCS H;  3CCM H;  3CCR H;  1K73 J;  1QVF H;  3CCQ H;  1K8A J;  1VQO H;  3CC2 H;  1YIT H;  1Q7Y J;  2OTJ H;  1VQ5 H;  5JVG J;  3CPW H;  3CCE H;  3CMA H;  5GAH N;  3CCU H;  1NJI J;  1W2B H;  3CCV H;  1Y69 K;  1S72 H;  3CXC H;  1M1K J;  4WF9 J;  3CD6 H;  5HL7 J;  1M90 J;  4WFB J;  1Q82 J;  1VQL H;  2PA2 A;  4IOC J;  1VQK H;  1Q81 J;  1K9M J;  3CME H;  1VQ4 H;  4WFN J;  1YI2 H;  4U67 J;  3G4S H;  1VQ7 H;  3CCJ H;  1VQN H;  1YIJ H;  4WFA J;  3G6E H;  1YHQ H; 
#chains in the Genus database with same CATH topology
 1WKI A;  2ZJR J;  3AM9 A;  5AYZ A;  3I55 H;  3DLL J;  2TPT A;  2QEX H;  4IO9 J;  3AN1 A;  1JRO B;  3TQV A;  4YYY A;  1Q86 J;  1YJW H;  2WK6 A;  1SB3 A;  4C7Y A;  1FO4 A;  1WYG A;  3BII E;  4US8 A;  2ZJQ J;  3C2V A;  1FMA E;  1JJ2 H;  4IOA J;  5DM7 J;  1N8R J;  2QIE A;  5GAD N;  1KD1 J;  3PIO J;  4C80 A;  1N63 B;  1N61 B;  3FC4 A;  3CC7 H;  1QPR A;  1QPQ A;  3NVY C;  4WCE J;  4I9A A;  2J0F A;  3C2R A;  1VQ6 H;  5MLC O;  4UY8 M;  3CF5 J;  2OTL H;  3PIP J;  3L0G A;  2W54 B;  1N62 B;  5AYX A;  4AP8 A;  3NVV C;  3I56 H;  2ZJP J;  3C2F A;  5JVH J;  1YTE A;  1RM6 A;  2I1O A;  3SR6 C;  3CCL H;  4C7Z A;  2QA4 H;  3C2E A;  5AN9 F;  2I14 A;  4ZOH A;  1QVG H;  2B7Q A;  1FFV B;  2W55 B;  1N5W B;  3WNZ A;  5GAG N;  1YJ9 H;  1YJN H;  1O4U A;  3G71 H;  5AYY A;  3GNN A;  3WO1 A;  5DM6 J;  1VQ8 H;  3OW2 H;  1VQ9 H;  5MPO C;  5H1S O;  1VQP H;  3CC4 H;  1VQM H;  1N5X A;  3NS1 C;  1BRW A;  3J7Z M;  3H5Q A;  3NRZ C;  2Q5W E;  1NVJ A;  5GAE N;  1KC8 J;  1KQS H;  4GA4 A;  4XR5 A;  3PAJ A;  1X1O A;  5HUO A;  3EUB 4;  5EY3 A;  3CCS H;  1UOU A;  1VLB A;  1DGJ A;  3CCM H;  3CCR H;  1QPN A;  4GA6 A;  4X46 A;  1K73 J;  1QVF H;  2E3T A;  4KWV A;  3VMM A;  3CCQ H;  1K8A J;  1VQO H;  1ZXI B;  5HUL A;  1FIQ C;  3CC2 H;  4YEK A;  2B7P A;  4EAD A;  2DSJ A;  1YIT H;  1V97 A;  1Q7Y J;  2W3S B;  2OTJ H;  1QAP A;  1OTP A;  3WO0 A;  2B7N A;  1SIJ A;  3AMZ A;  5JVG J;  1VQ5 H;  3NVW C;  2OMD A;  3CPW H;  3CCE H;  3L4P A;  5HUP A;  3CMA H;  1QPO A;  2WK5 A;  5GAH N;  3CCU H;  1NJI J;  1W2B H;  1FM0 E;  1YTK A;  3CCV H;  1FFU B;  1Y69 K;  1S72 H;  3CXC H;  4KWW A;  1AZY A;  1N60 B;  1M1K J;  4WF9 J;  3CD6 H;  4EAF A;  1JRP B;  2W3R B;  3B9J C;  4GA5 A;  2WP4 A;  4USA A;  4LHM A;  5HL7 J;  1M90 J;  4WFB J;  1Q82 J;  1VQL H;  2PA2 A;  4IOC J;  2JBM A;  1VQK H;  1Q81 J;  3C2O A;  1K9M J;  3CME H;  3RPF A;  3ETR C;  1VQ4 H;  4WFN J;  1YI2 H;  3NVZ C;  1VDV A;  4US9 A;  4U67 J;  3G4S H;  1NVI E;  1VQ7 H;  3CCJ H;  1YTD A;  3FAH A;  1VQN H;  1YIJ H;  4WFA J;  3G6E H;  1YHQ H;  5EP8 A; 
#chains in the Genus database with same CATH homology
 1WKI A;  2ZJR J;  3I55 H;  3DLL J;  2QEX H;  4IO9 J;  1Q86 J;  1YJW H;  2ZJQ J;  1JJ2 H;  4IOA J;  5DM7 J;  1N8R J;  5GAD N;  1KD1 J;  3PIO J;  3CC7 H;  4WCE J;  1VQ6 H;  5MLC O;  4UY8 M;  3CF5 J;  2OTL H;  3PIP J;  2ZJP J;  5JVH J;  3I56 H;  3CCL H;  2QA4 H;  5AN9 F;  1QVG H;  5GAG N;  1YJ9 H;  1YJN H;  3G71 H;  5DM6 J;  1VQ8 H;  3OW2 H;  1VQ9 H;  5H1S O;  1VQP H;  3CC4 H;  1VQM H;  3J7Z M;  5GAE N;  1KC8 J;  1KQS H;  3CCS H;  3CCM H;  3CCR H;  1K73 J;  1QVF H;  3CCQ H;  1K8A J;  1VQO H;  3CC2 H;  1YIT H;  1Q7Y J;  2OTJ H;  1VQ5 H;  5JVG J;  3CPW H;  3CCE H;  3CMA H;  5GAH N;  3CCU H;  1NJI J;  1W2B H;  3CCV H;  1Y69 K;  1S72 H;  3CXC H;  1M1K J;  4WF9 J;  3CD6 H;  5HL7 J;  1M90 J;  4WFB J;  1Q82 J;  1VQL H;  2PA2 A;  4IOC J;  1VQK H;  1Q81 J;  1K9M J;  3CME H;  1VQ4 H;  4WFN J;  1YI2 H;  4U67 J;  3G4S H;  1VQ7 H;  3CCJ H;  1VQN H;  1YIJ H;  4WFA J;  3G6E H;  1YHQ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...