1VQ8L

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 30
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vq8L02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1vq8L01
1Q86M 3G4SO 3CCQO 1YIJL 3CCML 1VQKO 1N8RM 1VQLO 3CCEL 3I55L 3CMEL 1VQPL 1KQSK 1M1KP 1YJWL 1VQ8L 3CCJO 3CCUL 2OTJL 1YJNL 2QEXO 1VQ6O 1VQNO 1VQ5O 1K73M 1YJ9L 1W2BN 3CC4L 1QVGN 3G6EL 1M90M 1NJIP 3CD6O 1Q81P 3CCLL 1KD1M 1YI2L 1K9MM 1YITL 1S72O 1VQ9O 1Q7YM 3CMAL 3CCVO 1KC8M 1Q82P 2QA4L 3G71L 3OW2K 2OTLO 1JJ2N 1QVFK 3CCQL 1K8AM 1VQ4L 1YHQL 1YIJO 3CXCK 1VQOL 1Q86P 1VQLL 3CCEO 1VQ7L 3CCSL 1N8RP 3CCJL 1KC8P 1VQ8O 1VQML 3CCUO 2QEXL 1VQNL 3CPWN 1VQ5L 1YJNO 3CC2L 3CCRL 1YJ9O 1K73P 3CC7L 3CD6L 1KQSN 1M90P 3I56L 3G4SL 1S72L 1W2BK 1VQ9L 1KD1P 1QVGK 1VQKL 3CCVL 1K9MP 3CMAO 3CCMO 1M1KM 1Q7YP 3I55O 2OTLL 3CMEO 1VQPO 1YJWO 1VQ4O 1VQ6L 2OTJO 3CPWK 1YHQO 1K8AP 1VQOO 3CC4O 1NJIM 1VQ7O 3CCSO 3G6EO 1Q81M 1JJ2K 1VQMO 3OW2N 1QVFN 3CCLO 3CC2O 1YI2O 3CCRO 1YITO 3CXCN 1Q82M 3CC7O 3I56O 2QA4O 3G71O
chains in the Genus database with same CATH superfamily
1Q86M 3G4SO 3CCQO 1YIJL 3CCML 1VQKO 1N8RM 1VQLO 3CCEL 3I55L 3CMEL 1VQPL 1KQSK 1M1KP 1YJWL 1VQ8L 3CCJO 3CCUL 2OTJL 1YJNL 2QEXO 1VQ6O 1VQNO 1VQ5O 1K73M 1YJ9L 1W2BN 3CC4L 1QVGN 3G6EL 1M90M 1NJIP 3CD6O 3CCLL 1Q81P 1KD1M 1YI2L 1K9MM 1YITL 1S72O 1VQ9O 1Q7YM 5DQTA 3CMAL 3CCVO 1KC8M 1Q82P 5DS4A 2QA4L 3G71L 4XTKA 3OW2K 2OTLO 1JJ2N 1QVFK 3CCQL 1K8AM 1VQ4L 5DLJA 5DS5A 4N06A 4P6IC 3CXCK 1VQOL 1YHQL 1YIJO 1Q86P 1VQLL 3CCEO 1VQ7L 3CCSL 1N8RP 3CCJL 1KC8P 1VQ8O 1VQML 3CCUO 2QEXL 1VQNL 3CPWN 1VQ5L 1YJNO 3CC2L 3CCRL 1YJ9O 1K73P 3GODA 3CC7L 3CD6L 1KQSN 1M90P 3I56L 2YZSA 3G4SL 1S72L 1W2BK 1VQ9L 1KD1P 1QVGK 1VQKL 3CCVL 1K9MP 3CMAO 3CCMO 1M1KM 1Q7YP 3I55O 5DS6A 2OTLL 3CMEO 1VQPO 1YJWO 4W8KA 1VQ4O 1VQ6L 2OTJO 3I56O 3NKDA 1YHQO 1K8AP 1VQOO 3CC4O 1NJIM 1VQ7O 3CCSO 3G6EO 1Q81M 5FCLA 4QDLA 1JJ2K 1VQMO 3OW2N 1QVFN 3CCLO 3CC2O 1YI2O 3CCRO 1YITO 3CXCN 5DQZA 4WJ0A 1Q82M 3CC7O 3CPWK 2QA4O 3G71O
chains in the Genus database with same CATH topology
1Q86M 3G4SO 3CCQO 1YIJL 3CCML 1VQKO 1N8RM 1VQLO 3CCEL 3I55L 3CMEL 1VQPL 1KQSK 1M1KP 1YJWL 1VQ8L 3CCJO 3CCUL 2OTJL 1YJNL 2QEXO 1VQ6O 1VQNO 1VQ5O 1K73M 1YJ9L 1W2BN 3CC4L 1QVGN 3G6EL 1M90M 1NJIP 3CD6O 3CCLL 1Q81P 1KD1M 1YI2L 1K9MM 1YITL 1S72O 1VQ9O 1Q7YM 5DQTA 3CMAL 3CCVO 1KC8M 1Q82P 5DS4A 2QA4L 3G71L 4XTKA 3OW2K 2OTLO 1JJ2N 1QVFK 3CCQL 1K8AM 1VQ4L 5DLJA 5DS5A 4N06A 4P6IC 3CXCK 1VQOL 1YHQL 1YIJO 1Q86P 1VQLL 3CCEO 1VQ7L 3CCSL 1N8RP 3CCJL 1KC8P 1VQ8O 1VQML 3CCUO 2QEXL 1VQNL 3CPWN 1VQ5L 1YJNO 3CC2L 3CCRL 1YJ9O 1K73P 3GODA 3CC7L 3CD6L 1KQSN 1M90P 3I56L 2YZSA 3G4SL 1S72L 1W2BK 1VQ9L 1KD1P 1QVGK 1VQKL 3CCVL 1K9MP 3CMAO 3CCMO 1M1KM 1Q7YP 3I55O 5DS6A 2OTLL 3CMEO 1VQPO 1YJWO 4W8KA 1VQ4O 1VQ6L 2OTJO 3I56O 3NKDA 1YHQO 1K8AP 1VQOO 3CC4O 1NJIM 1VQ7O 3CCSO 3G6EO 1Q81M 5FCLA 4QDLA 1JJ2K 1VQMO 3OW2N 1QVFN 3CCLO 3CC2O 1YI2O 3CCRO 1YITO 3CXCN 5DQZA 4WJ0A 1Q82M 3CC7O 3CPWK 2QA4O 3G71O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 M;  3G4S O;  3CCQ O;  1YIJ L;  3CCM L;  1VQK O;  1N8R M;  1VQL O;  3CCE L;  3I55 L;  3CME L;  1VQP L;  1KQS K;  1M1K P;  1YJW L;  1VQ8 L;  3CCJ O;  3CCU L;  2OTJ L;  1YJN L;  2QEX O;  1VQ6 O;  1VQN O;  1VQ5 O;  1K73 M;  1YJ9 L;  1W2B N;  3CC4 L;  1QVG N;  3G6E L;  1M90 M;  1NJI P;  3CD6 O;  1Q81 P;  3CCL L;  1KD1 M;  1YI2 L;  1K9M M;  1YIT L;  1S72 O;  1VQ9 O;  1Q7Y M;  3CMA L;  3CCV O;  1KC8 M;  1Q82 P;  2QA4 L;  3G71 L;  3OW2 K;  2OTL O;  1JJ2 N;  1QVF K;  3CCQ L;  1K8A M;  1VQ4 L;  1YHQ L;  1YIJ O;  3CXC K;  1VQO L;  1Q86 P;  1VQL L;  3CCE O;  1VQ7 L;  3CCS L;  1N8R P;  3CCJ L;  1KC8 P;  1VQ8 O;  1VQM L;  3CCU O;  2QEX L;  1VQN L;  3CPW N;  1VQ5 L;  1YJN O;  3CC2 L;  3CCR L;  1YJ9 O;  1K73 P;  3CC7 L;  3CD6 L;  1KQS N;  1M90 P;  3I56 L;  3G4S L;  1S72 L;  1W2B K;  1VQ9 L;  1KD1 P;  1QVG K;  1VQK L;  3CCV L;  1K9M P;  3CMA O;  3CCM O;  1M1K M;  1Q7Y P;  3I55 O;  2OTL L;  3CME O;  1VQP O;  1YJW O;  1VQ4 O;  1VQ6 L;  2OTJ O;  3CPW K;  1YHQ O;  1K8A P;  1VQO O;  3CC4 O;  1NJI M;  1VQ7 O;  3CCS O;  3G6E O;  1Q81 M;  1JJ2 K;  1VQM O;  3OW2 N;  1QVF N;  3CCL O;  3CC2 O;  1YI2 O;  3CCR O;  1YIT O;  3CXC N;  1Q82 M;  3CC7 O;  3I56 O;  2QA4 O;  3G71 O; 
#chains in the Genus database with same CATH topology
 1Q86 M;  3G4S O;  3CCQ O;  1YIJ L;  3CCM L;  1VQK O;  1N8R M;  1VQL O;  3CCE L;  3I55 L;  3CME L;  1VQP L;  1KQS K;  1M1K P;  1YJW L;  1VQ8 L;  3CCJ O;  3CCU L;  2OTJ L;  1YJN L;  2QEX O;  1VQ6 O;  1VQN O;  1VQ5 O;  1K73 M;  1YJ9 L;  1W2B N;  3CC4 L;  1QVG N;  3G6E L;  1M90 M;  1NJI P;  3CD6 O;  3CCL L;  1Q81 P;  1KD1 M;  1YI2 L;  1K9M M;  1YIT L;  1S72 O;  1VQ9 O;  1Q7Y M;  5DQT A;  3CMA L;  3CCV O;  1KC8 M;  1Q82 P;  5DS4 A;  2QA4 L;  3G71 L;  4XTK A;  3OW2 K;  2OTL O;  1JJ2 N;  1QVF K;  3CCQ L;  1K8A M;  1VQ4 L;  5DLJ A;  5DS5 A;  4N06 A;  4P6I C;  3CXC K;  1VQO L;  1YHQ L;  1YIJ O;  1Q86 P;  1VQL L;  3CCE O;  1VQ7 L;  3CCS L;  1N8R P;  3CCJ L;  1KC8 P;  1VQ8 O;  1VQM L;  3CCU O;  2QEX L;  1VQN L;  3CPW N;  1VQ5 L;  1YJN O;  3CC2 L;  3CCR L;  1YJ9 O;  1K73 P;  3GOD A;  3CC7 L;  3CD6 L;  1KQS N;  1M90 P;  3I56 L;  2YZS A;  3G4S L;  1S72 L;  1W2B K;  1VQ9 L;  1KD1 P;  1QVG K;  1VQK L;  3CCV L;  1K9M P;  3CMA O;  3CCM O;  1M1K M;  1Q7Y P;  3I55 O;  5DS6 A;  2OTL L;  3CME O;  1VQP O;  1YJW O;  4W8K A;  1VQ4 O;  1VQ6 L;  2OTJ O;  3I56 O;  3NKD A;  1YHQ O;  1K8A P;  1VQO O;  3CC4 O;  1NJI M;  1VQ7 O;  3CCS O;  3G6E O;  1Q81 M;  5FCL A;  4QDL A;  1JJ2 K;  1VQM O;  3OW2 N;  1QVF N;  3CCL O;  3CC2 O;  1YI2 O;  3CCR O;  1YIT O;  3CXC N;  5DQZ A;  4WJ0 A;  1Q82 M;  3CC7 O;  3CPW K;  2QA4 O;  3G71 O; 
#chains in the Genus database with same CATH homology
 1Q86 M;  3G4S O;  3CCQ O;  1YIJ L;  3CCM L;  1VQK O;  1N8R M;  1VQL O;  3CCE L;  3I55 L;  3CME L;  1VQP L;  1KQS K;  1M1K P;  1YJW L;  1VQ8 L;  3CCJ O;  3CCU L;  2OTJ L;  1YJN L;  2QEX O;  1VQ6 O;  1VQN O;  1VQ5 O;  1K73 M;  1YJ9 L;  1W2B N;  3CC4 L;  1QVG N;  3G6E L;  1M90 M;  1NJI P;  3CD6 O;  3CCL L;  1Q81 P;  1KD1 M;  1YI2 L;  1K9M M;  1YIT L;  1S72 O;  1VQ9 O;  1Q7Y M;  5DQT A;  3CMA L;  3CCV O;  1KC8 M;  1Q82 P;  5DS4 A;  2QA4 L;  3G71 L;  4XTK A;  3OW2 K;  2OTL O;  1JJ2 N;  1QVF K;  3CCQ L;  1K8A M;  1VQ4 L;  5DLJ A;  5DS5 A;  4N06 A;  4P6I C;  3CXC K;  1VQO L;  1YHQ L;  1YIJ O;  1Q86 P;  1VQL L;  3CCE O;  1VQ7 L;  3CCS L;  1N8R P;  3CCJ L;  1KC8 P;  1VQ8 O;  1VQM L;  3CCU O;  2QEX L;  1VQN L;  3CPW N;  1VQ5 L;  1YJN O;  3CC2 L;  3CCR L;  1YJ9 O;  1K73 P;  3GOD A;  3CC7 L;  3CD6 L;  1KQS N;  1M90 P;  3I56 L;  2YZS A;  3G4S L;  1S72 L;  1W2B K;  1VQ9 L;  1KD1 P;  1QVG K;  1VQK L;  3CCV L;  1K9M P;  3CMA O;  3CCM O;  1M1K M;  1Q7Y P;  3I55 O;  5DS6 A;  2OTL L;  3CME O;  1VQP O;  1YJW O;  4W8K A;  1VQ4 O;  1VQ6 L;  2OTJ O;  3I56 O;  3NKD A;  1YHQ O;  1K8A P;  1VQO O;  3CC4 O;  1NJI M;  1VQ7 O;  3CCS O;  3G6E O;  1Q81 M;  5FCL A;  4QDL A;  1JJ2 K;  1VQM O;  3OW2 N;  1QVF N;  3CCL O;  3CC2 O;  1YI2 O;  3CCR O;  1YIT O;  3CXC N;  5DQZ A;  4WJ0 A;  1Q82 M;  3CC7 O;  3CPW K;  2QA4 O;  3G71 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...