1VQ8O

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 36
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vq8O00
3G4SO 1Q81P 3G4SL 3CC7L 1Q7YM 1YI2O 1YI2L 1KQSK 3CD6L 3G71O 3G71L 1NJIP 1VQ8O 2OTJO 1K9MP 1YJWO 3CCSL 3CMEO 1M1KM 1QVFK 1KD1P 3I55O 3CMEL 3CCLO 1VQ6O 1VQ6L 3CPWK 1N8RP 1W2BN 1Q82M 1VQLO 1YJ9L 1Q81M 3CCJO 1K73P 3CCJL 1JJ2N 3CCQO 3CCQL 3I56O 3CCEO 3CC2O 1NJIM 3I56L 1VQ7O 1K9MM 3CCEL 1KD1M 1VQ4O 1M90P 1Q86P 1N8RM 1K73M 1VQ9O 3CCUO 1S72O 1VQ8L 3CCUL 2OTJL 1YJWL 3I55L 3CCLL 3OW2N 1VQLL 1YHQO 3CCRO 1M90M 1YHQL 1Q86M 1VQKO 3CC4O 1W2BK 1QVGK 3CCMO 1K8AP 3CC2L 3G6EO 1VQ7L 3G6EL 1VQ4L 3CXCK 1KC8P 1VQ9L 1S72L 2QEXO 3CMAO 3CMAL 1K8AM 1VQMO 1VQ5O 1VQML 1VQ5L 1YIJO 1YIJL 1YITO 3CCRL 1YITL 1VQKL 3CC4L 3CC7O 1KQSN 1VQNO 3CCML 1KC8M 1VQNL 1JJ2K 3CD6O 1QVFN 2OTLO 3CCVO 2OTLL 3CCSO 3CCVL 3CPWN 1Q7YP 1VQOO 1VQOL 1YJ9O 1QVGN 2QEXL 1VQPO 1VQPL 1M1KP 2QA4O 3OW2K 2QA4L 1YJNO 1Q82P 1YJNL 3CXCN
chains in the Genus database with same CATH superfamily
3G4SO 4W8KA 1Q81P 3G4SL 3CC7L 1Q7YM 1YI2O 1YI2L 1KQSK 3CD6L 3G71O 3G71L 1NJIP 1VQ8O 2OTJO 1K9MP 1YJWO 3CCSL 3CMEO 1M1KM 1QVFK 1KD1P 3I55O 3CMEL 3CCLO 1VQ6O 1VQ6L 3CPWK 1N8RP 1W2BN 1Q82M 1VQLO 1YJ9L 1Q81M 3CCJO 1K73P 3CCJL 1JJ2N 3CCQO 3CCQL 3I56O 3CCEO 3CC2O 1NJIM 3I56L 1VQ7O 1K9MM 3CCEL 1KD1M 1VQ4O 1M90P 1Q86P 5DS6A 1N8RM 1K73M 1VQ9O 3CCUO 2YZSA 1S72O 1VQ8L 3CCUL 2OTJL 1YJWL 4XTKA 5DS4A 3I55L 3CCLL 3OW2N 5FCLA 1VQLL 1YHQO 3CCRO 1M90M 1YHQL 1Q86M 1VQKO 3CC4O 1W2BK 1QVGK 3CCMO 4P6IC 1K8AP 3CC2L 3G6EO 1VQ7L 3G6EL 1VQ4L 3CXCK 1KC8P 1VQ9L 1S72L 2QEXO 4WJ0A 3CMAO 3CMAL 1K8AM 5DS5A 1VQMO 1VQ5O 1VQML 1VQ5L 1YIJO 5DLJA 1YIJL 1YITO 3CCRL 1YITL 1VQKL 3CC4L 3CC7O 3NKDA 1KQSN 3CCML 1KC8M 1VQNO 1VQNL 5DQTA 4QDLA 1JJ2K 3CD6O 1QVFN 2OTLO 3CCVO 3GODA 2OTLL 3CCSO 3CCVL 3CPWN 1Q7YP 1VQOO 1VQOL 4N06A 1YJ9O 1QVGN 2QEXL 1VQPO 1VQPL 1M1KP 2QA4O 3OW2K 2QA4L 5DQZA 1YJNO 1Q82P 1YJNL 3CXCN
chains in the Genus database with same CATH topology
3G4SO 4W8KA 1Q81P 3G4SL 3CC7L 1Q7YM 1YI2O 1YI2L 1KQSK 3CD6L 3G71O 3G71L 1NJIP 1VQ8O 2OTJO 1K9MP 1YJWO 3CCSL 3CMEO 1M1KM 1QVFK 1KD1P 3I55O 3CMEL 3CCLO 1VQ6O 1VQ6L 3CPWK 1N8RP 1W2BN 1Q82M 1VQLO 1YJ9L 1Q81M 3CCJO 1K73P 3CCJL 1JJ2N 3CCQO 3CCQL 3I56O 3CCEO 3CC2O 1NJIM 3I56L 1VQ7O 1K9MM 3CCEL 1KD1M 1VQ4O 1M90P 1Q86P 5DS6A 1N8RM 1K73M 1VQ9O 3CCUO 2YZSA 1S72O 1VQ8L 3CCUL 2OTJL 1YJWL 4XTKA 5DS4A 3I55L 3CCLL 3OW2N 5FCLA 1VQLL 1YHQO 3CCRO 1M90M 1YHQL 1Q86M 1VQKO 3CC4O 1W2BK 1QVGK 3CCMO 4P6IC 1K8AP 3CC2L 3G6EO 1VQ7L 3G6EL 1VQ4L 3CXCK 1KC8P 1VQ9L 1S72L 2QEXO 4WJ0A 3CMAO 3CMAL 1K8AM 5DS5A 1VQMO 1VQ5O 1VQML 1VQ5L 1YIJO 5DLJA 1YIJL 1YITO 3CCRL 1YITL 1VQKL 3CC4L 3CC7O 3NKDA 1KQSN 3CCML 1KC8M 1VQNO 1VQNL 5DQTA 4QDLA 1JJ2K 3CD6O 1QVFN 2OTLO 3CCVO 3GODA 2OTLL 3CCSO 3CCVL 3CPWN 1Q7YP 1VQOO 1VQOL 4N06A 1YJ9O 1QVGN 2QEXL 1VQPO 1VQPL 1M1KP 2QA4O 3OW2K 2QA4L 5DQZA 1YJNO 1Q82P 1YJNL 3CXCN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S O;  1Q81 P;  3G4S L;  3CC7 L;  1Q7Y M;  1YI2 O;  1YI2 L;  1KQS K;  3CD6 L;  3G71 O;  3G71 L;  1NJI P;  1VQ8 O;  2OTJ O;  1K9M P;  1YJW O;  3CCS L;  3CME O;  1M1K M;  1QVF K;  1KD1 P;  3I55 O;  3CME L;  3CCL O;  1VQ6 O;  1VQ6 L;  3CPW K;  1N8R P;  1W2B N;  1Q82 M;  1VQL O;  1YJ9 L;  1Q81 M;  3CCJ O;  1K73 P;  3CCJ L;  1JJ2 N;  3CCQ O;  3CCQ L;  3I56 O;  3CCE O;  3CC2 O;  1NJI M;  3I56 L;  1VQ7 O;  1K9M M;  3CCE L;  1KD1 M;  1VQ4 O;  1M90 P;  1Q86 P;  1N8R M;  1K73 M;  1VQ9 O;  3CCU O;  1S72 O;  1VQ8 L;  3CCU L;  2OTJ L;  1YJW L;  3I55 L;  3CCL L;  3OW2 N;  1VQL L;  1YHQ O;  3CCR O;  1M90 M;  1YHQ L;  1Q86 M;  1VQK O;  3CC4 O;  1W2B K;  1QVG K;  3CCM O;  1K8A P;  3CC2 L;  3G6E O;  1VQ7 L;  3G6E L;  1VQ4 L;  3CXC K;  1KC8 P;  1VQ9 L;  1S72 L;  2QEX O;  3CMA O;  3CMA L;  1K8A M;  1VQM O;  1VQ5 O;  1VQM L;  1VQ5 L;  1YIJ O;  1YIJ L;  1YIT O;  3CCR L;  1YIT L;  1VQK L;  3CC4 L;  3CC7 O;  1KQS N;  1VQN O;  3CCM L;  1KC8 M;  1VQN L;  1JJ2 K;  3CD6 O;  1QVF N;  2OTL O;  3CCV O;  2OTL L;  3CCS O;  3CCV L;  3CPW N;  1Q7Y P;  1VQO O;  1VQO L;  1YJ9 O;  1QVG N;  2QEX L;  1VQP O;  1VQP L;  1M1K P;  2QA4 O;  3OW2 K;  2QA4 L;  1YJN O;  1Q82 P;  1YJN L;  3CXC N; 
#chains in the Genus database with same CATH topology
 3G4S O;  4W8K A;  1Q81 P;  3G4S L;  3CC7 L;  1Q7Y M;  1YI2 O;  1YI2 L;  1KQS K;  3CD6 L;  3G71 O;  3G71 L;  1NJI P;  1VQ8 O;  2OTJ O;  1K9M P;  1YJW O;  3CCS L;  3CME O;  1M1K M;  1QVF K;  1KD1 P;  3I55 O;  3CME L;  3CCL O;  1VQ6 O;  1VQ6 L;  3CPW K;  1N8R P;  1W2B N;  1Q82 M;  1VQL O;  1YJ9 L;  1Q81 M;  3CCJ O;  1K73 P;  3CCJ L;  1JJ2 N;  3CCQ O;  3CCQ L;  3I56 O;  3CCE O;  3CC2 O;  1NJI M;  3I56 L;  1VQ7 O;  1K9M M;  3CCE L;  1KD1 M;  1VQ4 O;  1M90 P;  1Q86 P;  5DS6 A;  1N8R M;  1K73 M;  1VQ9 O;  3CCU O;  2YZS A;  1S72 O;  1VQ8 L;  3CCU L;  2OTJ L;  1YJW L;  4XTK A;  5DS4 A;  3I55 L;  3CCL L;  3OW2 N;  5FCL A;  1VQL L;  1YHQ O;  3CCR O;  1M90 M;  1YHQ L;  1Q86 M;  1VQK O;  3CC4 O;  1W2B K;  1QVG K;  3CCM O;  4P6I C;  1K8A P;  3CC2 L;  3G6E O;  1VQ7 L;  3G6E L;  1VQ4 L;  3CXC K;  1KC8 P;  1VQ9 L;  1S72 L;  2QEX O;  4WJ0 A;  3CMA O;  3CMA L;  1K8A M;  5DS5 A;  1VQM O;  1VQ5 O;  1VQM L;  1VQ5 L;  1YIJ O;  5DLJ A;  1YIJ L;  1YIT O;  3CCR L;  1YIT L;  1VQK L;  3CC4 L;  3CC7 O;  3NKD A;  1KQS N;  3CCM L;  1KC8 M;  1VQN O;  1VQN L;  5DQT A;  4QDL A;  1JJ2 K;  3CD6 O;  1QVF N;  2OTL O;  3CCV O;  3GOD A;  2OTL L;  3CCS O;  3CCV L;  3CPW N;  1Q7Y P;  1VQO O;  1VQO L;  4N06 A;  1YJ9 O;  1QVG N;  2QEX L;  1VQP O;  1VQP L;  1M1K P;  2QA4 O;  3OW2 K;  2QA4 L;  5DQZ A;  1YJN O;  1Q82 P;  1YJN L;  3CXC N; 
#chains in the Genus database with same CATH homology
 3G4S O;  4W8K A;  1Q81 P;  3G4S L;  3CC7 L;  1Q7Y M;  1YI2 O;  1YI2 L;  1KQS K;  3CD6 L;  3G71 O;  3G71 L;  1NJI P;  1VQ8 O;  2OTJ O;  1K9M P;  1YJW O;  3CCS L;  3CME O;  1M1K M;  1QVF K;  1KD1 P;  3I55 O;  3CME L;  3CCL O;  1VQ6 O;  1VQ6 L;  3CPW K;  1N8R P;  1W2B N;  1Q82 M;  1VQL O;  1YJ9 L;  1Q81 M;  3CCJ O;  1K73 P;  3CCJ L;  1JJ2 N;  3CCQ O;  3CCQ L;  3I56 O;  3CCE O;  3CC2 O;  1NJI M;  3I56 L;  1VQ7 O;  1K9M M;  3CCE L;  1KD1 M;  1VQ4 O;  1M90 P;  1Q86 P;  5DS6 A;  1N8R M;  1K73 M;  1VQ9 O;  3CCU O;  2YZS A;  1S72 O;  1VQ8 L;  3CCU L;  2OTJ L;  1YJW L;  4XTK A;  5DS4 A;  3I55 L;  3CCL L;  3OW2 N;  5FCL A;  1VQL L;  1YHQ O;  3CCR O;  1M90 M;  1YHQ L;  1Q86 M;  1VQK O;  3CC4 O;  1W2B K;  1QVG K;  3CCM O;  4P6I C;  1K8A P;  3CC2 L;  3G6E O;  1VQ7 L;  3G6E L;  1VQ4 L;  3CXC K;  1KC8 P;  1VQ9 L;  1S72 L;  2QEX O;  4WJ0 A;  3CMA O;  3CMA L;  1K8A M;  5DS5 A;  1VQM O;  1VQ5 O;  1VQM L;  1VQ5 L;  1YIJ O;  5DLJ A;  1YIJ L;  1YIT O;  3CCR L;  1YIT L;  1VQK L;  3CC4 L;  3CC7 O;  3NKD A;  1KQS N;  3CCM L;  1KC8 M;  1VQN O;  1VQN L;  5DQT A;  4QDL A;  1JJ2 K;  3CD6 O;  1QVF N;  2OTL O;  3CCV O;  3GOD A;  2OTL L;  3CCS O;  3CCV L;  3CPW N;  1Q7Y P;  1VQO O;  1VQO L;  4N06 A;  1YJ9 O;  1QVG N;  2QEX L;  1VQP O;  1VQP L;  1M1K P;  2QA4 O;  3OW2 K;  2QA4 L;  5DQZ A;  1YJN O;  1Q82 P;  1YJN L;  3CXC N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...