1VQ9H

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
171
structure length
160
Chain Sequence
KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 39
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1vq9H00
5DM6J 1VQ7H 3CF5J 1QVGH 1YJ9H 5MLCO 3PIPJ 1VQ8H 1S72H 2ZJPJ 3CXCH 1QVFH 4WFBJ 4IOAJ 2PA2A 3I56H 1YJWH 4WFNJ 3CPWH 1VQ5H 1K9MJ 3CCQH 2QEXH 3CCSH 1VQPH 1M90J 2ZJRJ 1JJ2H 1WKIA 3CCRH 4IOCJ 1YIJH 4U67J 3CCMH 3DLLJ 3CCJH 4UY8M 3G4SH 3CD6H 1Q82J 3CC4H 1W2BH 1Q7YJ 3J7ZM 3CMEH 1NJIJ 1KD1J 1N8RJ 1YJNH 1VQMH 3CCEH 1M1KJ 1YI2H 3CMAH 4WF9J 1VQOH 5GAEN 2OTJH 1YHQH 5H1SO 3OW2H 1K8AJ 1KC8J 1Q86J 1Q81J 2ZJQJ 5AN9F 5DM7J 5GAGN 3G71H 3CCUH 1KQSH 1VQNH 4WFAJ 1VQ4H 2OTLH 3CCVH 2QA4H 3PIOJ 3CCLH 1K73J 5JVGJ 5GAHN 5HL7J 1VQLH 3CC2H 4IO9J 4WCEJ 1VQKH 3CC7H 1Y69K 1VQ6H 3I55H 1YITH 1VQ9H 5GADN 5JVHJ 3G6EH
chains in the Genus database with same CATH superfamily
4AP8A 5DM6J 1FMAE 5AYYA 4KWWA 3SR6C 1VQ7H 2OMDA 3WO0A 3CF5J 1RM6A 1QVGH 1YJ9H 2QIEA 5MLCO 5EY3A 1VLBA 3NVWC 4EADA 1FIQC 3PIPJ 1S72H 2J0FA 1VQ8H 1X1OA 3C2OA 4YEKA 2WK6A 1FFUB 2ZJPJ 3CXCH 1QVFH 4WFBJ 4IOAJ 4KWVA 3C2VA 3C2RA 2PA2A 3I56H 2W54B 1WYGA 3C2EA 1JROB 4GA4A 4XR5A 1YTDA 4I9AA 3AMZA 3VMMA 3GNNA 4WFNJ 1YJWH 3CPWH 1VQ5H 1N5XA 1NVJA 2WK5A 4US9A 1K9MJ 1OTPA 3CCQH 2QEXH 4C7YA 3CCSH 1BRWA 4X46A 1VQPH 1M90J 2ZJRJ 1JJ2H 3NVVC 1WKIA 3NS1C 1N62B 3CCRH 3NVZC 4IOCJ 1JRPB 4C80A 1YIJH 3FC4A 3L0GA 4U67J 3CCMH 4ZOHA 3DLLJ 4US8A 1V97A 2W55B 3CCJH 3RPFA 4UY8M 1FFVB 5HUOA 3TQVA 3G4SH 3CD6H 1YTKA 1AZYA 1Q82J 3BIIE 3CC4H 2TPTA 1W2BH 1Q7YJ 1SB3A 3EUB4 1FO4A 3J7ZM 1N61B 3CMEH 1QPRA 1VDVA 4GA6A 4EAFA 1NJIJ 1FM0E 1KD1J 1N63B 1YJNH 1N8RJ 2I14A 1VQMH 3CCEH 1M1KJ 2W3SB 3ETRC 3NRZC 3CMAH 1YI2H 3B9JC 4WF9J 5AYXA 4LHMA 1VQOH 5HULA 2B7QA 5GAEN 5HUPA 3WO1A 2OTJH 1YHQH 2W3RB 5H1SO 3OW2H 3WNZA 1K8AJ 1N5WB 1KC8J 1Q86J 2E3TA 3L4PA 1Q81J 2JBMA 2ZJQJ 5AN9F 5MPOC 1QAPA 2I1OA 1QPOA 5DM7J 5GAGN 3G71H 3CCUH 1KQSH 1VQNH 1ZXIB 4WFAJ 2B7NA 3NVYC 1VQ4H 2OTLH 3CCVH 5EP8A 2QA4H 3H5QA 1QPQA 3PIOJ 3CCLH 1K73J 3PAJA 5JVGJ 5GAHN 1YTEA 5HL7J 3FAHA 1VQLH 3CC2H 4IO9J 4WCEJ 1DGJA 2WP4A 1VQKH 2DSJA 5AYZA 1SIJA 1Y69K 3CC7H 1VQ6H 1N60B 1NVIE 3I55H 4C7ZA 1YITH 4YYYA 3AM9A 3C2FA 4USAA 1VQ9H 1UOUA 5GADN 5JVHJ 1O4UA 2B7PA 2Q5WE 3G6EH 1QPNA 4GA5A 3AN1A
chains in the Genus database with same CATH topology
5DM6J 1VQ7H 3CF5J 1QVGH 1YJ9H 5MLCO 3PIPJ 1VQ8H 1S72H 2ZJPJ 3CXCH 1QVFH 4WFBJ 4IOAJ 2PA2A 3I56H 1YJWH 4WFNJ 3CPWH 1VQ5H 1K9MJ 3CCQH 2QEXH 3CCSH 1VQPH 1M90J 2ZJRJ 1JJ2H 1WKIA 3CCRH 4IOCJ 1YIJH 4U67J 3CCMH 3DLLJ 3CCJH 4UY8M 3G4SH 3CD6H 1Q82J 3CC4H 1W2BH 1Q7YJ 3J7ZM 3CMEH 1NJIJ 1KD1J 1N8RJ 1YJNH 1VQMH 3CCEH 1M1KJ 1YI2H 3CMAH 4WF9J 1VQOH 5GAEN 2OTJH 1YHQH 5H1SO 3OW2H 1K8AJ 1KC8J 1Q86J 1Q81J 2ZJQJ 5AN9F 5DM7J 5GAGN 3G71H 3CCUH 1KQSH 1VQNH 4WFAJ 1VQ4H 2OTLH 3CCVH 2QA4H 3PIOJ 3CCLH 1K73J 5JVGJ 5GAHN 5HL7J 1VQLH 3CC2H 4IO9J 4WCEJ 1VQKH 3CC7H 1Y69K 1VQ6H 3I55H 1YITH 1VQ9H 5GADN 5JVHJ 3G6EH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM6 J;  1VQ7 H;  3CF5 J;  1QVG H;  1YJ9 H;  5MLC O;  3PIP J;  1VQ8 H;  1S72 H;  2ZJP J;  3CXC H;  1QVF H;  4WFB J;  4IOA J;  2PA2 A;  3I56 H;  1YJW H;  4WFN J;  3CPW H;  1VQ5 H;  1K9M J;  3CCQ H;  2QEX H;  3CCS H;  1VQP H;  1M90 J;  2ZJR J;  1JJ2 H;  1WKI A;  3CCR H;  4IOC J;  1YIJ H;  4U67 J;  3CCM H;  3DLL J;  3CCJ H;  4UY8 M;  3G4S H;  3CD6 H;  1Q82 J;  3CC4 H;  1W2B H;  1Q7Y J;  3J7Z M;  3CME H;  1NJI J;  1KD1 J;  1N8R J;  1YJN H;  1VQM H;  3CCE H;  1M1K J;  1YI2 H;  3CMA H;  4WF9 J;  1VQO H;  5GAE N;  2OTJ H;  1YHQ H;  5H1S O;  3OW2 H;  1K8A J;  1KC8 J;  1Q86 J;  1Q81 J;  2ZJQ J;  5AN9 F;  5DM7 J;  5GAG N;  3G71 H;  3CCU H;  1KQS H;  1VQN H;  4WFA J;  1VQ4 H;  2OTL H;  3CCV H;  2QA4 H;  3PIO J;  3CCL H;  1K73 J;  5JVG J;  5GAH N;  5HL7 J;  1VQL H;  3CC2 H;  4IO9 J;  4WCE J;  1VQK H;  3CC7 H;  1Y69 K;  1VQ6 H;  3I55 H;  1YIT H;  1VQ9 H;  5GAD N;  5JVH J;  3G6E H; 
#chains in the Genus database with same CATH topology
 4AP8 A;  5DM6 J;  1FMA E;  5AYY A;  4KWW A;  3SR6 C;  1VQ7 H;  2OMD A;  3WO0 A;  3CF5 J;  1RM6 A;  1QVG H;  1YJ9 H;  2QIE A;  5MLC O;  5EY3 A;  1VLB A;  3NVW C;  4EAD A;  1FIQ C;  3PIP J;  1S72 H;  2J0F A;  1VQ8 H;  1X1O A;  3C2O A;  4YEK A;  2WK6 A;  1FFU B;  2ZJP J;  3CXC H;  1QVF H;  4WFB J;  4IOA J;  4KWV A;  3C2V A;  3C2R A;  2PA2 A;  3I56 H;  2W54 B;  1WYG A;  3C2E A;  1JRO B;  4GA4 A;  4XR5 A;  1YTD A;  4I9A A;  3AMZ A;  3VMM A;  3GNN A;  4WFN J;  1YJW H;  3CPW H;  1VQ5 H;  1N5X A;  1NVJ A;  2WK5 A;  4US9 A;  1K9M J;  1OTP A;  3CCQ H;  2QEX H;  4C7Y A;  3CCS H;  1BRW A;  4X46 A;  1VQP H;  1M90 J;  2ZJR J;  1JJ2 H;  3NVV C;  1WKI A;  3NS1 C;  1N62 B;  3CCR H;  3NVZ C;  4IOC J;  1JRP B;  4C80 A;  1YIJ H;  3FC4 A;  3L0G A;  4U67 J;  3CCM H;  4ZOH A;  3DLL J;  4US8 A;  1V97 A;  2W55 B;  3CCJ H;  3RPF A;  4UY8 M;  1FFV B;  5HUO A;  3TQV A;  3G4S H;  3CD6 H;  1YTK A;  1AZY A;  1Q82 J;  3BII E;  3CC4 H;  2TPT A;  1W2B H;  1Q7Y J;  1SB3 A;  3EUB 4;  1FO4 A;  3J7Z M;  1N61 B;  3CME H;  1QPR A;  1VDV A;  4GA6 A;  4EAF A;  1NJI J;  1FM0 E;  1KD1 J;  1N63 B;  1YJN H;  1N8R J;  2I14 A;  1VQM H;  3CCE H;  1M1K J;  2W3S B;  3ETR C;  3NRZ C;  3CMA H;  1YI2 H;  3B9J C;  4WF9 J;  5AYX A;  4LHM A;  1VQO H;  5HUL A;  2B7Q A;  5GAE N;  5HUP A;  3WO1 A;  2OTJ H;  1YHQ H;  2W3R B;  5H1S O;  3OW2 H;  3WNZ A;  1K8A J;  1N5W B;  1KC8 J;  1Q86 J;  2E3T A;  3L4P A;  1Q81 J;  2JBM A;  2ZJQ J;  5AN9 F;  5MPO C;  1QAP A;  2I1O A;  1QPO A;  5DM7 J;  5GAG N;  3G71 H;  3CCU H;  1KQS H;  1VQN H;  1ZXI B;  4WFA J;  2B7N A;  3NVY C;  1VQ4 H;  2OTL H;  3CCV H;  5EP8 A;  2QA4 H;  3H5Q A;  1QPQ A;  3PIO J;  3CCL H;  1K73 J;  3PAJ A;  5JVG J;  5GAH N;  1YTE A;  5HL7 J;  3FAH A;  1VQL H;  3CC2 H;  4IO9 J;  4WCE J;  1DGJ A;  2WP4 A;  1VQK H;  2DSJ A;  5AYZ A;  1SIJ A;  1Y69 K;  3CC7 H;  1VQ6 H;  1N60 B;  1NVI E;  3I55 H;  4C7Z A;  1YIT H;  4YYY A;  3AM9 A;  3C2F A;  4USA A;  1VQ9 H;  1UOU A;  5GAD N;  5JVH J;  1O4U A;  2B7P A;  2Q5W E;  3G6E H;  1QPN A;  4GA5 A;  3AN1 A; 
#chains in the Genus database with same CATH homology
 5DM6 J;  1VQ7 H;  3CF5 J;  1QVG H;  1YJ9 H;  5MLC O;  3PIP J;  1VQ8 H;  1S72 H;  2ZJP J;  3CXC H;  1QVF H;  4WFB J;  4IOA J;  2PA2 A;  3I56 H;  1YJW H;  4WFN J;  3CPW H;  1VQ5 H;  1K9M J;  3CCQ H;  2QEX H;  3CCS H;  1VQP H;  1M90 J;  2ZJR J;  1JJ2 H;  1WKI A;  3CCR H;  4IOC J;  1YIJ H;  4U67 J;  3CCM H;  3DLL J;  3CCJ H;  4UY8 M;  3G4S H;  3CD6 H;  1Q82 J;  3CC4 H;  1W2B H;  1Q7Y J;  3J7Z M;  3CME H;  1NJI J;  1KD1 J;  1N8R J;  1YJN H;  1VQM H;  3CCE H;  1M1K J;  1YI2 H;  3CMA H;  4WF9 J;  1VQO H;  5GAE N;  2OTJ H;  1YHQ H;  5H1S O;  3OW2 H;  1K8A J;  1KC8 J;  1Q86 J;  1Q81 J;  2ZJQ J;  5AN9 F;  5DM7 J;  5GAG N;  3G71 H;  3CCU H;  1KQS H;  1VQN H;  4WFA J;  1VQ4 H;  2OTL H;  3CCV H;  2QA4 H;  3PIO J;  3CCL H;  1K73 J;  5JVG J;  5GAH N;  5HL7 J;  1VQL H;  3CC2 H;  4IO9 J;  4WCE J;  1VQK H;  3CC7 H;  1Y69 K;  1VQ6 H;  3I55 H;  1YIT H;  1VQ9 H;  5GAD N;  5JVH J;  3G6E H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...