1VQKF

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqkF00
1GZ0A 5GIPC 1K9MH 2BO1A 1NJIH 3PAFA 2OTLF 5FJ4C 2CZWA 5GINC 1X52A 2HVYD 1H7MA 3CCMF 3CD6F 1S72F 1X7PA 3LFOA 3LWQC 3CCSF 3J81M 3ON1A 1VQOF 4BY9D 5IT9M 3HAXD 2VGNA 2QA4F 3CXCF 1YI2F 1VQMF 3CPWF 1W40A 2I6DA 1YHQF 1YIJF 1VQLF 2VGMA 1VQ8F 3WXMB 1T0KB 2ALEA 3I56F 3I55F 3SIUA 1GO1A 1M90H 3HJWC 3VI6A 1KD1H 3PLAC 1Q86H 3J80M 1M1KH 5DCVA 1VQPF 1VQ9F 3N4YA 1NMUB 2OHWA 5GIOC 2OTJF 2LBXA 1QVGF 5G4UC 1KC8H 3NK6A 3CCQF 3LWPC 1CK2A 1CN7A 1Q7YH 3CC7F 3GYQA 4C4WC 3LWRC 3G6EF 3CG6A 3G71F 1RA4A 1VQ7F 3OBYA 3CC4F 1KQSF 1SDSA 3OW2F 3NMUC 1Q81H 4NUTA 3E20B 3CCUF 1JJ2F 1XBIA 3NVKE 3G4SF 4BW0B 5G4VC 3N4ZA 1X7OA 3CCRF 5A2QM 1N8RH 3RA5A 1QVFF 2KTUA 1VQ4F 1VQNF 3E1YA 1VQKF 5EO3A 2WALA 3RA6A 2FC3A 1Q82H 1YITF 1K8AH 3O85A 1YJWF 3FFMA 3OBWA 3CCJF 3JCMM 3CPQA 1K73H 2KTVA 3CCVF 3J7AR 3NK7A 3V7QA 2QI2A 1DT9A 3SIVA 3MCAB 5FLXM 1IPAA 1VQ5F 3CMAF 1PXWA 2KG4A 1W42A 3CC2F 2LBWA 3NVIB 3AGKA 1W41A 3IR9A 1RLGA 2JNBA 5GANK 1YJ9F 2OZBA 3CCEF 5EWRA 4X3LA 4TZZA 1ZWZA 3V7EA 3CCLF 3JAMM 4LCKA 5GAPK 1E7KA 1W2BF 1W3EX 3VMFB 3CMEF 2AIFA 1YJNF 1GO0A 3LWOC 1VQ6F 2QEXF 4X3MA 3LWVC
chains in the Genus database with same CATH superfamily
1W55A 3WPWA 2I6RA 3HKBA 1K9MH 2H8CA 4R40B 3S0WA 4YJ3B 2HVYD 2ZOVA 4YJ2B 3CD6F 5CA0B 3RE3A 5JVDB 5JCOA 3LWQC 2BTQB 1VQOF 3C8LA 3K2XA 5EB1B 4X1KA 3RYHA 1GX1A 3S0YA 2HP3A 3FD6A 4ZI7A 1IV1A 5IYZA 1VQLF 1VQ8F 2MQEA 5LP6C 3WGNA 4U39A 3I55F 1JD1A 3D01A 3VO8A 4O2AA 3EORA 2CHSA 1KD1H 2HRUA 3J80M 4U3JB 1UI9A 4E6EA 5JCOC 1NMUB 2OHWA 3Q8HA 1KC8H 3LWPC 4M8IA 1CN7A 3JAWA 5MN4A 1CLIA 3LMEA 3RYIB 3CG6A 4I55B 4EI7A 1U43A 2AIZP 5CB4A 1T0AA 3FBAA 1Q81H 2KGWA 4O4IA 1OFUA 4ERHA 1FNKA 3KJJA 5EYPA 5EIBC 3MQWA 4X1YB 3ZP7A 2Z01A 1N8RH 2KTUA 4ZHWA 3S03A 3F6MA 1VQNF 5CA1B 3UT5B 5FNVB 3D54A 3N2KA 3RA6A 3MBMA 1VQVA 1KNJA 1TVKB 3FFMA 5LXTB 3JALA 3JCMM 3RYCA 3CCJF 4EB6B 1IV3A 3CCVF 4ZOLA 3F0GA 3NK7A 3GHZA 4BVTA 5LP6B 1SA0A 1U3LA 3SIVA 4EI9A 1VQ5F 1PXWA 3F0FA 2KG4A 3HKBB 2DT4A 3NVIB 1W581 4BVSA 1VK3A 1W41A 5HXUA 2OZBA 4C82A 3V7EA 4X1KB 2UYPA 3R0PA 3CYPB 3IKEA 4ZI7B 2UYKA 4I50B 4TV8A 1VH8A 2HRYA 1UFYA 1VQ6F 4BT4A 1RLUA 1IV4A 4O2AB 1GZ0A 5LYJA 5GIPC 2H6LA 2BO1A 1FFXB 5FJ4C 3QTYA 4BVRA 1H7MA 1S72F 1TUBB 1X7PA 1H48A 2BTOA 4X20A 3J81M 3HWUA 4BY9D 2YYEA 4KWEA 3JAWB 3HAXD 4F6RA 5CB4B 5LA6B 1YHQF 3GTZA 2VGMA 1PF5A 3LYBA 4O4IB 5MN5A 3WGMA 2YXZA 3ELCA 1GO1A 5J2TA 3HJWC 3VYUC 2HS0A 5HWEA 1M1KH 1VQ9F 2OTMA 4B46A 4O4JA 3N2KB 3S0HA 3NK6A 5LOVA 3CCQF 2RHHA 2AMTA 5EZYA 2LCAA 2R6R1 5AVMA 3K12A 1YQNA 2HX0A 3JALB 3RYCB 4C4WC 3LWRC 4ZHVA 3TD3A 3G6EF 2UYNB 3G71F 1QAHA 4ZOLB 2IQQA 3HTNA 5B8FA 1VQ7F 1OAPA 3OBYA 1VHAA 4O4LA 3OW2F 4NUTA 1H47A 1SA0B 3E20B 4LNUB 4NQ3A 4BW0B 3N4ZA 4ZHQB 4I4TA 3IKFA 1VQ4F 3E1YA 3OONA 3WJRA 3T80A 2R751 3M1XA 1K8AH 1YITF 3O85A 5GONA 1YJWF 3QHDA 3CPQA 3LDTA 3WJQA 3ZO8A 1K73H 2GZLA 1W5AA 2KTVA 1COMA 3IEQA 4ZHYB 3V7QA 2NMUA 3VOBA 3KHNA 3VYSC 2Z1FA 2W8BC 5LYJB 1W42A 3CC2F 2LBWA 3KJKA 1XHOA 3MCQA 5JH7A 2ZAUA 2JNBA 5EWRA 4X3LA 1ZWZA 3CCLF 3E22A 1X25A 1KNKA 3WGJA 3JASA 1RQ7A 5C8YB 5JQGB 2ZF8A 3HKCB 4XCQA 1RQ2A 3N2GA 3DDNA 3CMEF 4IIJA 4IHJA 4NWOB 2VXYA 3ZP4A 1YJNF 3IMPA 4X3MA 2B33A 4EI8A 1ONIA 3F0EA 1U3PA 2F9ZC 3D00A 1XV2A 3P4EA 5J2UB 3WPXA 3PAFA 2OTLF 3M4SA 3JATA 4O4JB 4ZK7A 1X52A 5BMVA 5ITZA 3V4DA 5JVDA 4G4VA 5KMGA 5LOVB 5EIBD 5EZYB 3ON1A 5KX5A 5IT9M 2VGNA 3RYHB 3CXCF 1YI2F 2L26A 4O4LB 1YIJF 2Q1XA 1JN1A 2GVIA 5IYZB 4FFBA 2N48A 5EAZA 3I56F 3QUWA 2PMPA 3IEWA 2CWJA 3VCZA 3JARA 2UYJA 4I4TB 1VQPF 2ZVZA 3ZOPA 3C9RA 1J7HA 2LBXA 4BVQA 3I7TA 3TD5A 1CK2A 4O2BA 1R1MA 3BYQA 1Q7YH 3CC7F 4G88A 5HY0A 3K0TA 2Z1TA 4C81A 3B6NA 1SDSA 4RQOA 3TD4A 1FNJA 4DRXA 3CCUF 5EB0A 5G4VC 5EYPB 4BT3A 1X7OA 3CCRF 5A2QM 3RA5A 3FPIA 4HNAA 4X1IA 3UT5A 4TUYA 1VQKF 3KE1A 2FC3A 3VTIC 3U0OA 3JASB 3OBWA 2LBTA 5HY4A 3N2GB 3VIUA 2GLZA 1DBFA 2QI2A 3V3TA 3JAKA 5FLXM 3CMAF 1FSZA 1QD9A 3JATB 5BMVB 5ITZB 3CYQA 3AGKA 5IJ9A 3HKDA 5KMGB 3HKEA 3F0DA 1RLGA 2RHJA 4BT2A 4BT7A 5GANK 1YJ9F 3CCEF 3ESJA 5HY1A 4TZZA 4C8EA 5KX5B 3JAMM 4B45A 4LCKA 2RHLA 5MN6A 2ZVYA 4BT6A 3WJPA 4TV9A 1XRGA 1W2BF 1W3EX 4I50A 4FFBB 4TV8B 1U40A 3VYTC 3VOAA 2QEXF 5HY2A 4O4HA 3JARB 3RYFA 2HP0A 1FFXA 1NJIH 1Z5VA 2CZWA 3C9SA 5GINC 1TUBA 3CCMF 4PWTA 4WBNA 3LFOA 3CCSF 4X20B 2Q1YA 4O2BB 3I3FA 2P6YA 4B5CA 4F6RB 1JFFA 2QA4F 5HP8A 1VQMF 3CPWF 1W40A 5LA6A 2I6DA 3S06A 1QU9A 3WXMB 4DRXB 1T0KB 2ALEA 3SIUA 3KIZA 5IJ0A 1NQ3A 1M90H 3JVHA 3VI6A 3PLAC 1W5BA 5J2TB 1Q86H 5DCVA 2RB9A 3N4YA 4YJ3A 2CW4A 1SZQA 4HNAB 4YJ2A 5GIOC 4X1IB 5CA0A 4TUYB 2OTJF 3K14A 1QVGF 5G4UC 2RHOA 3WGLA 1Q8RA 2PHNA 1Z5WA 3GYQA 1W5FA 3P10A 2HQSC 2UYNA 2V9YA 2Z1EA 1RA4A 1W59A 4BT5A 2Z1UA 1KQSF 3CC4F 3NMUC 2QTPA 4LNUA 3JAKB 1JJ2F 1XBIA 3NVKE 3G4SF 4ZHQA 1QVFF 2ZODA 1W5EA 4U3JA 5IJ9B 3HKDB 2VAPA 3HKEB 5EO3A 2WALA 3S02A 3FD5A 2HS4A 4DXDA 3M84A 1Q82H 3P0ZA 2H8EA 2HS3A 5GONB 3WGKA 2UZHA 2BTUA 2G9IA 3RYIA 4G4YA 4I55A 4TV9B 2VAWA 3J7AR 1DT9A 3MCAB 1IPAA 1IV2A 4O4HB 4G4WA 3RYFB 2HP0B 2VAMA 1ODEA 4X1YA 4C8IA 3C9UA 1YGYA 3L7QA 4C8GA 2CVLA 5CA1A 3ERNA 4WBNB 5HXZA 3IR9A 4B62A 5FNVA 5JH7B 4G4ZA 2CSLA 1JY8A 2IG8A 2FGYA 3DC2A 3CB2A 4RHAA 1TVKA 3E22B 5C8YA 2CHTA 5JQGA 5LXTA 1JFFB 3HKCA 3MDOA 1W57A 3C9TA 4EB6A 5HP7A 5GAPK 1E7KA 4G4XA 2EWCA 3VMFB 2DYYA 2AIFA 4IIJB 2IAFA 2K1SA 4IHJB 1GO0A 3LWOC 5LP6A 5IJ0B 3LWVC 5J2UA
chains in the Genus database with same CATH topology
1GZ0A 2F9ZC 3D00A 5GIPC 1K9MH 2BO1A 5HY2A 1NJIH 3PAFA 2OTLF 5FJ4C 2CZWA 5GINC 1X52A 4BVRA 1H7MA 3CCMF 2HVYD 3CD6F 1S72F 1X7PA 3LFOA 3LWQC 3CCSF 3J81M 3ON1A 1VQOF 4BY9D 5IT9M 3HAXD 2VGNA 2QA4F 3CXCF 1YI2F 1VQMF 3CPWF 1W40A 2I6DA 1YHQF 1YIJF 1VQLF 2VGMA 1VQ8F 3WXMB 1T0KB 2ALEA 3I56F 3I55F 3SIUA 1GO1A 1M90H 3HJWC 3VI6A 5HWEA 1KD1H 1Q86H 3J80M 1M1KH 3PLAC 1VQPF 5DCVA 1VQ9F 3N4YA 1NMUB 2OHWA 5GIOC 2OTJF 2LBXA 1QVGF 5G4UC 4BVQA 1KC8H 3NK6A 3CCQF 3LWPC 1CK2A 1CN7A 1Q7YH 3CC7F 3GYQA 5HY0A 4C4WC 3LWRC 3G6EF 3CG6A 4EI7A 3G71F 1RA4A 1VQ7F 3OBYA 3CC4F 1KQSF 1SDSA 3OW2F 3NMUC 1Q81H 4NUTA 3E20B 3CCUF 1JJ2F 1XBIA 4NQ3A 3NVKE 3G4SF 4BW0B 3N4ZA 5G4VC 1X7OA 3CCRF 5A2QM 1N8RH 3RA5A 1QVFF 2KTUA 1VQ4F 1VQNF 3E1YA 1VQKF 5EO3A 2WALA 3RA6A 2FC3A 1Q82H 1YITF 1K8AH 3O85A 1YJWF 3FFMA 3OBWA 3CCJF 3JCMM 3CPQA 1K73H 5HY4A 2KTVA 3CCVF 3J7AR 2GLZA 3NK7A 3V7QA 4BVTA 2QI2A 1DT9A 3V3TA 3MCAB 5FLXM 3SIVA 1IPAA 4EI9A 1VQ5F 3CMAF 1PXWA 2KG4A 1W42A 3CC2F 2LBWA 3NVIB 4BVSA 3AGKA 5HXZA 1W41A 3IR9A 1RLGA 2JNBA 5HXUA 5GANK 1YJ9F 3CCEF 5EWRA 2OZBA 4X3LA 2FGYA 5HY1A 4TZZA 1ZWZA 3V7EA 3CCLF 3JAMM 4LCKA 5GAPK 1E7KA 4XCQA 1W2BF 1W3EX 3VMFB 3CMEF 2AIFA 1YJNF 1GO0A 3LWOC 1VQ6F 2QEXF 4X3MA 3LWVC 4EI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZ0 A;  5GIP C;  1K9M H;  2BO1 A;  1NJI H;  3PAF A;  2OTL F;  5FJ4 C;  2CZW A;  5GIN C;  1X52 A;  2HVY D;  1H7M A;  3CCM F;  3CD6 F;  1S72 F;  1X7P A;  3LFO A;  3LWQ C;  3CCS F;  3J81 M;  3ON1 A;  1VQO F;  4BY9 D;  5IT9 M;  3HAX D;  2VGN A;  2QA4 F;  3CXC F;  1YI2 F;  1VQM F;  3CPW F;  1W40 A;  2I6D A;  1YHQ F;  1YIJ F;  1VQL F;  2VGM A;  1VQ8 F;  3WXM B;  1T0K B;  2ALE A;  3I56 F;  3I55 F;  3SIU A;  1GO1 A;  1M90 H;  3HJW C;  3VI6 A;  1KD1 H;  3PLA C;  1Q86 H;  3J80 M;  1M1K H;  5DCV A;  1VQP F;  1VQ9 F;  3N4Y A;  1NMU B;  2OHW A;  5GIO C;  2OTJ F;  2LBX A;  1QVG F;  5G4U C;  1KC8 H;  3NK6 A;  3CCQ F;  3LWP C;  1CK2 A;  1CN7 A;  1Q7Y H;  3CC7 F;  3GYQ A;  4C4W C;  3LWR C;  3G6E F;  3CG6 A;  3G71 F;  1RA4 A;  1VQ7 F;  3OBY A;  3CC4 F;  1KQS F;  1SDS A;  3OW2 F;  3NMU C;  1Q81 H;  4NUT A;  3E20 B;  3CCU F;  1JJ2 F;  1XBI A;  3NVK E;  3G4S F;  4BW0 B;  5G4V C;  3N4Z A;  1X7O A;  3CCR F;  5A2Q M;  1N8R H;  3RA5 A;  1QVF F;  2KTU A;  1VQ4 F;  1VQN F;  3E1Y A;  1VQK F;  5EO3 A;  2WAL A;  3RA6 A;  2FC3 A;  1Q82 H;  1YIT F;  1K8A H;  3O85 A;  1YJW F;  3FFM A;  3OBW A;  3CCJ F;  3JCM M;  3CPQ A;  1K73 H;  2KTV A;  3CCV F;  3J7A R;  3NK7 A;  3V7Q A;  2QI2 A;  1DT9 A;  3SIV A;  3MCA B;  5FLX M;  1IPA A;  1VQ5 F;  3CMA F;  1PXW A;  2KG4 A;  1W42 A;  3CC2 F;  2LBW A;  3NVI B;  3AGK A;  1W41 A;  3IR9 A;  1RLG A;  2JNB A;  5GAN K;  1YJ9 F;  2OZB A;  3CCE F;  5EWR A;  4X3L A;  4TZZ A;  1ZWZ A;  3V7E A;  3CCL F;  3JAM M;  4LCK A;  5GAP K;  1E7K A;  1W2B F;  1W3E X;  3VMF B;  3CME F;  2AIF A;  1YJN F;  1GO0 A;  3LWO C;  1VQ6 F;  2QEX F;  4X3M A;  3LWV C; 
#chains in the Genus database with same CATH topology
 1W55 A;  3WPW A;  2I6R A;  3HKB A;  1K9M H;  2H8C A;  4R40 B;  3S0W A;  4YJ3 B;  2HVY D;  2ZOV A;  4YJ2 B;  3CD6 F;  5CA0 B;  3RE3 A;  5JVD B;  5JCO A;  3LWQ C;  2BTQ B;  1VQO F;  3C8L A;  3K2X A;  5EB1 B;  4X1K A;  3RYH A;  1GX1 A;  3S0Y A;  2HP3 A;  3FD6 A;  4ZI7 A;  1IV1 A;  5IYZ A;  1VQL F;  1VQ8 F;  2MQE A;  5LP6 C;  3WGN A;  4U39 A;  3I55 F;  1JD1 A;  3D01 A;  3VO8 A;  4O2A A;  3EOR A;  2CHS A;  1KD1 H;  2HRU A;  3J80 M;  4U3J B;  1UI9 A;  4E6E A;  5JCO C;  1NMU B;  2OHW A;  3Q8H A;  1KC8 H;  3LWP C;  4M8I A;  1CN7 A;  3JAW A;  5MN4 A;  1CLI A;  3LME A;  3RYI B;  3CG6 A;  4I55 B;  4EI7 A;  1U43 A;  2AIZ P;  5CB4 A;  1T0A A;  3FBA A;  1Q81 H;  2KGW A;  4O4I A;  1OFU A;  4ERH A;  1FNK A;  3KJJ A;  5EYP A;  5EIB C;  3MQW A;  4X1Y B;  3ZP7 A;  2Z01 A;  1N8R H;  2KTU A;  4ZHW A;  3S03 A;  3F6M A;  1VQN F;  5CA1 B;  3UT5 B;  5FNV B;  3D54 A;  3N2K A;  3RA6 A;  3MBM A;  1VQV A;  1KNJ A;  1TVK B;  3FFM A;  5LXT B;  3JAL A;  3JCM M;  3RYC A;  3CCJ F;  4EB6 B;  1IV3 A;  3CCV F;  4ZOL A;  3F0G A;  3NK7 A;  3GHZ A;  4BVT A;  5LP6 B;  1SA0 A;  1U3L A;  3SIV A;  4EI9 A;  1VQ5 F;  1PXW A;  3F0F A;  2KG4 A;  3HKB B;  2DT4 A;  3NVI B;  1W58 1;  4BVS A;  1VK3 A;  1W41 A;  5HXU A;  2OZB A;  4C82 A;  3V7E A;  4X1K B;  2UYP A;  3R0P A;  3CYP B;  3IKE A;  4ZI7 B;  2UYK A;  4I50 B;  4TV8 A;  1VH8 A;  2HRY A;  1UFY A;  1VQ6 F;  4BT4 A;  1RLU A;  1IV4 A;  4O2A B;  1GZ0 A;  5LYJ A;  5GIP C;  2H6L A;  2BO1 A;  1FFX B;  5FJ4 C;  3QTY A;  4BVR A;  1H7M A;  1S72 F;  1TUB B;  1X7P A;  1H48 A;  2BTO A;  4X20 A;  3J81 M;  3HWU A;  4BY9 D;  2YYE A;  4KWE A;  3JAW B;  3HAX D;  4F6R A;  5CB4 B;  5LA6 B;  1YHQ F;  3GTZ A;  2VGM A;  1PF5 A;  3LYB A;  4O4I B;  5MN5 A;  3WGM A;  2YXZ A;  3ELC A;  1GO1 A;  5J2T A;  3HJW C;  3VYU C;  2HS0 A;  5HWE A;  1M1K H;  1VQ9 F;  2OTM A;  4B46 A;  4O4J A;  3N2K B;  3S0H A;  3NK6 A;  5LOV A;  3CCQ F;  2RHH A;  2AMT A;  5EZY A;  2LCA A;  2R6R 1;  5AVM A;  3K12 A;  1YQN A;  2HX0 A;  3JAL B;  3RYC B;  4C4W C;  3LWR C;  4ZHV A;  3TD3 A;  3G6E F;  2UYN B;  3G71 F;  1QAH A;  4ZOL B;  2IQQ A;  3HTN A;  5B8F A;  1VQ7 F;  1OAP A;  3OBY A;  1VHA A;  4O4L A;  3OW2 F;  4NUT A;  1H47 A;  1SA0 B;  3E20 B;  4LNU B;  4NQ3 A;  4BW0 B;  3N4Z A;  4ZHQ B;  4I4T A;  3IKF A;  1VQ4 F;  3E1Y A;  3OON A;  3WJR A;  3T80 A;  2R75 1;  3M1X A;  1K8A H;  1YIT F;  3O85 A;  5GON A;  1YJW F;  3QHD A;  3CPQ A;  3LDT A;  3WJQ A;  3ZO8 A;  1K73 H;  2GZL A;  1W5A A;  2KTV A;  1COM A;  3IEQ A;  4ZHY B;  3V7Q A;  2NMU A;  3VOB A;  3KHN A;  3VYS C;  2Z1F A;  2W8B C;  5LYJ B;  1W42 A;  3CC2 F;  2LBW A;  3KJK A;  1XHO A;  3MCQ A;  5JH7 A;  2ZAU A;  2JNB A;  5EWR A;  4X3L A;  1ZWZ A;  3CCL F;  3E22 A;  1X25 A;  1KNK A;  3WGJ A;  3JAS A;  1RQ7 A;  5C8Y B;  5JQG B;  2ZF8 A;  3HKC B;  4XCQ A;  1RQ2 A;  3N2G A;  3DDN A;  3CME F;  4IIJ A;  4IHJ A;  4NWO B;  2VXY A;  3ZP4 A;  1YJN F;  3IMP A;  4X3M A;  2B33 A;  4EI8 A;  1ONI A;  3F0E A;  1U3P A;  2F9Z C;  3D00 A;  1XV2 A;  3P4E A;  5J2U B;  3WPX A;  3PAF A;  2OTL F;  3M4S A;  3JAT A;  4O4J B;  4ZK7 A;  1X52 A;  5BMV A;  5ITZ A;  3V4D A;  5JVD A;  4G4V A;  5KMG A;  5LOV B;  5EIB D;  5EZY B;  3ON1 A;  5KX5 A;  5IT9 M;  2VGN A;  3RYH B;  3CXC F;  1YI2 F;  2L26 A;  4O4L B;  1YIJ F;  2Q1X A;  1JN1 A;  2GVI A;  5IYZ B;  4FFB A;  2N48 A;  5EAZ A;  3I56 F;  3QUW A;  2PMP A;  3IEW A;  2CWJ A;  3VCZ A;  3JAR A;  2UYJ A;  4I4T B;  1VQP F;  2ZVZ A;  3ZOP A;  3C9R A;  1J7H A;  2LBX A;  4BVQ A;  3I7T A;  3TD5 A;  1CK2 A;  4O2B A;  1R1M A;  3BYQ A;  1Q7Y H;  3CC7 F;  4G88 A;  5HY0 A;  3K0T A;  2Z1T A;  4C81 A;  3B6N A;  1SDS A;  4RQO A;  3TD4 A;  1FNJ A;  4DRX A;  3CCU F;  5EB0 A;  5G4V C;  5EYP B;  4BT3 A;  1X7O A;  3CCR F;  5A2Q M;  3RA5 A;  3FPI A;  4HNA A;  4X1I A;  3UT5 A;  4TUY A;  1VQK F;  3KE1 A;  2FC3 A;  3VTI C;  3U0O A;  3JAS B;  3OBW A;  2LBT A;  5HY4 A;  3N2G B;  3VIU A;  2GLZ A;  1DBF A;  2QI2 A;  3V3T A;  3JAK A;  5FLX M;  3CMA F;  1FSZ A;  1QD9 A;  3JAT B;  5BMV B;  5ITZ B;  3CYQ A;  3AGK A;  5IJ9 A;  3HKD A;  5KMG B;  3HKE A;  3F0D A;  1RLG A;  2RHJ A;  4BT2 A;  4BT7 A;  5GAN K;  1YJ9 F;  3CCE F;  3ESJ A;  5HY1 A;  4TZZ A;  4C8E A;  5KX5 B;  3JAM M;  4B45 A;  4LCK A;  2RHL A;  5MN6 A;  2ZVY A;  4BT6 A;  3WJP A;  4TV9 A;  1XRG A;  1W2B F;  1W3E X;  4I50 A;  4FFB B;  4TV8 B;  1U40 A;  3VYT C;  3VOA A;  2QEX F;  5HY2 A;  4O4H A;  3JAR B;  3RYF A;  2HP0 A;  1FFX A;  1NJI H;  1Z5V A;  2CZW A;  3C9S A;  5GIN C;  1TUB A;  3CCM F;  4PWT A;  4WBN A;  3LFO A;  3CCS F;  4X20 B;  2Q1Y A;  4O2B B;  3I3F A;  2P6Y A;  4B5C A;  4F6R B;  1JFF A;  2QA4 F;  5HP8 A;  1VQM F;  3CPW F;  1W40 A;  5LA6 A;  2I6D A;  3S06 A;  1QU9 A;  3WXM B;  4DRX B;  1T0K B;  2ALE A;  3SIU A;  3KIZ A;  5IJ0 A;  1NQ3 A;  1M90 H;  3JVH A;  3VI6 A;  3PLA C;  1W5B A;  5J2T B;  1Q86 H;  5DCV A;  2RB9 A;  3N4Y A;  4YJ3 A;  2CW4 A;  1SZQ A;  4HNA B;  4YJ2 A;  5GIO C;  4X1I B;  5CA0 A;  4TUY B;  2OTJ F;  3K14 A;  1QVG F;  5G4U C;  2RHO A;  3WGL A;  1Q8R A;  2PHN A;  1Z5W A;  3GYQ A;  1W5F A;  3P10 A;  2HQS C;  2UYN A;  2V9Y A;  2Z1E A;  1RA4 A;  1W59 A;  4BT5 A;  2Z1U A;  1KQS F;  3CC4 F;  3NMU C;  2QTP A;  4LNU A;  3JAK B;  1JJ2 F;  1XBI A;  3NVK E;  3G4S F;  4ZHQ A;  1QVF F;  2ZOD A;  1W5E A;  4U3J A;  5IJ9 B;  3HKD B;  2VAP A;  3HKE B;  5EO3 A;  2WAL A;  3S02 A;  3FD5 A;  2HS4 A;  4DXD A;  3M84 A;  1Q82 H;  3P0Z A;  2H8E A;  2HS3 A;  5GON B;  3WGK A;  2UZH A;  2BTU A;  2G9I A;  3RYI A;  4G4Y A;  4I55 A;  4TV9 B;  2VAW A;  3J7A R;  1DT9 A;  3MCA B;  1IPA A;  1IV2 A;  4O4H B;  4G4W A;  3RYF B;  2HP0 B;  2VAM A;  1ODE A;  4X1Y A;  4C8I A;  3C9U A;  1YGY A;  3L7Q A;  4C8G A;  2CVL A;  5CA1 A;  3ERN A;  4WBN B;  5HXZ A;  3IR9 A;  4B62 A;  5FNV A;  5JH7 B;  4G4Z A;  2CSL A;  1JY8 A;  2IG8 A;  2FGY A;  3DC2 A;  3CB2 A;  4RHA A;  1TVK A;  3E22 B;  5C8Y A;  2CHT A;  5JQG A;  5LXT A;  1JFF B;  3HKC A;  3MDO A;  1W57 A;  3C9T A;  4EB6 A;  5HP7 A;  5GAP K;  1E7K A;  4G4X A;  2EWC A;  3VMF B;  2DYY A;  2AIF A;  4IIJ B;  2IAF A;  2K1S A;  4IHJ B;  1GO0 A;  3LWO C;  5LP6 A;  5IJ0 B;  3LWV C;  5J2U A; 
#chains in the Genus database with same CATH homology
 1GZ0 A;  2F9Z C;  3D00 A;  5GIP C;  1K9M H;  2BO1 A;  5HY2 A;  1NJI H;  3PAF A;  2OTL F;  5FJ4 C;  2CZW A;  5GIN C;  1X52 A;  4BVR A;  1H7M A;  3CCM F;  2HVY D;  3CD6 F;  1S72 F;  1X7P A;  3LFO A;  3LWQ C;  3CCS F;  3J81 M;  3ON1 A;  1VQO F;  4BY9 D;  5IT9 M;  3HAX D;  2VGN A;  2QA4 F;  3CXC F;  1YI2 F;  1VQM F;  3CPW F;  1W40 A;  2I6D A;  1YHQ F;  1YIJ F;  1VQL F;  2VGM A;  1VQ8 F;  3WXM B;  1T0K B;  2ALE A;  3I56 F;  3I55 F;  3SIU A;  1GO1 A;  1M90 H;  3HJW C;  3VI6 A;  5HWE A;  1KD1 H;  1Q86 H;  3J80 M;  1M1K H;  3PLA C;  1VQP F;  5DCV A;  1VQ9 F;  3N4Y A;  1NMU B;  2OHW A;  5GIO C;  2OTJ F;  2LBX A;  1QVG F;  5G4U C;  4BVQ A;  1KC8 H;  3NK6 A;  3CCQ F;  3LWP C;  1CK2 A;  1CN7 A;  1Q7Y H;  3CC7 F;  3GYQ A;  5HY0 A;  4C4W C;  3LWR C;  3G6E F;  3CG6 A;  4EI7 A;  3G71 F;  1RA4 A;  1VQ7 F;  3OBY A;  3CC4 F;  1KQS F;  1SDS A;  3OW2 F;  3NMU C;  1Q81 H;  4NUT A;  3E20 B;  3CCU F;  1JJ2 F;  1XBI A;  4NQ3 A;  3NVK E;  3G4S F;  4BW0 B;  3N4Z A;  5G4V C;  1X7O A;  3CCR F;  5A2Q M;  1N8R H;  3RA5 A;  1QVF F;  2KTU A;  1VQ4 F;  1VQN F;  3E1Y A;  1VQK F;  5EO3 A;  2WAL A;  3RA6 A;  2FC3 A;  1Q82 H;  1YIT F;  1K8A H;  3O85 A;  1YJW F;  3FFM A;  3OBW A;  3CCJ F;  3JCM M;  3CPQ A;  1K73 H;  5HY4 A;  2KTV A;  3CCV F;  3J7A R;  2GLZ A;  3NK7 A;  3V7Q A;  4BVT A;  2QI2 A;  1DT9 A;  3V3T A;  3MCA B;  5FLX M;  3SIV A;  1IPA A;  4EI9 A;  1VQ5 F;  3CMA F;  1PXW A;  2KG4 A;  1W42 A;  3CC2 F;  2LBW A;  3NVI B;  4BVS A;  3AGK A;  5HXZ A;  1W41 A;  3IR9 A;  1RLG A;  2JNB A;  5HXU A;  5GAN K;  1YJ9 F;  3CCE F;  5EWR A;  2OZB A;  4X3L A;  2FGY A;  5HY1 A;  4TZZ A;  1ZWZ A;  3V7E A;  3CCL F;  3JAM M;  4LCK A;  5GAP K;  1E7K A;  4XCQ A;  1W2B F;  1W3E X;  3VMF B;  3CME F;  2AIF A;  1YJN F;  1GO0 A;  3LWO C;  1VQ6 F;  2QEX F;  4X3M A;  3LWV C;  4EI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...