1VQLF

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqlF00
5G4VC 1YIJF 1VQ8F 3G6EF 3ON1A 3V7EA 3V7QA 1NJIH 4X3MA 3JCMM 1YJNF 1W40A 2BO1A 5GINC 1Q81H 1E7KA 1N8RH 5GIOC 1PXWA 1RA4A 3LFOA 1M1KH 3SIVA 3J81M 3LWOC 3CPQA 1YITF 1JJ2F 3CCUF 3SIUA 3CMEF 3JAMM 1H7MA 2OHWA 1KD1H 3VI6A 3CC2F 3NVKE 3AGKA 3NMUC 1M90H 3CC7F 3E1YA 3J7AR 1RLGA 4X3LA 3NVIB 3E20B 3CCVF 2OZBA 1YJ9F 2HVYD 3G4SF 3IR9A 3CCRF 1YI2F 3LWPC 3CCSF 2I6DA 2VGNA 5GAPK 5FLXM 3O85A 1K9MH 1VQ7F 3LWQC 3CCEF 1KC8H 1X52A 3I55F 2VGMA 2OTLF 3LWVC 3RA6A 1W2BF 1VQOF 5DCVA 3OW2F 1ZWZA 3OBWA 1GZ0A 3J80M 1Q82H 1QVFF 3HJWC 5G4UC 3FFMA 3NK6A 2FC3A 2KTVA 5FJ4C 1VQNF 1GO0A 3LWRC 1W3EX 1S72F 3I56F 1VQMF 2WALA 2LBWA 2QA4F 1X7OA 2ALEA 3N4ZA 1VQ6F 2QI2A 3CMAF 4C4WC 3N4YA 5EO3A 1W42A 3CCMF 1CK2A 4LCKA 3CD6F 1SDSA 1YJWF 5GIPC 2OTJF 5IT9M 4BW0B 5A2QM 3HAXD 5EWRA 1GO1A 1W41A 2JNBA 1YHQF 3NK7A 1K73H 1T0KB 1XBIA 3PLAC 2KG4A 3WXMB 1QVGF 3CG6A 2KTUA 2AIFA 1VQPF 3PAFA 1IPAA 3MCAB 1KQSF 1VQ5F 3CC4F 1DT9A 2LBXA 3GYQA 3OBYA 2QEXF 1K8AH 3G71F 1NMUB 3CPWF 1CN7A 3VMFB 1Q7YH 3CXCF 1Q86H 1X7PA 4TZZA 3RA5A 4BY9D 4NUTA 2CZWA 1VQ9F 1VQKF 3CCQF 1VQLF 3CCLF 3CCJF 5GANK 1VQ4F
chains in the Genus database with same CATH superfamily
5JQGB 3HTNA 1YIJF 4E6EA 3G6EF 3WGNA 2Z1EA 1NJIH 1RQ2A 1W59A 3ELCA 3MQWA 4YJ2B 3GHZA 1VK3A 5GINC 5EAZA 2FGYA 1GX1A 3J81M 1YITF 5EYPB 4O4LA 2UYJA 4TUYB 2IQQA 1TUBB 3CC2F 4G4WA 1XRGA 3I3FA 3AGKA 3HKBB 5HWEA 5IYZB 3CC7F 3JAKB 5FNVA 2Q1XA 4TV9A 5J2UA 5LP6C 2CSLA 2AMTA 1R1MA 5CA0B 3WGMA 1YJ9F 5HP8A 4O4IB 2ZVZA 1XV2A 4X1KB 2G9IA 1W5AA 5GAPK 3LDTA 1FNJA 1K9MH 2IG8A 3CCEF 4G88A 2VGMA 3HKEA 2RHHA 2HS0A 3ERNA 3T80A 1W5EA 1ZWZA 3MBMA 1GZ0A 1Q82H 3WJQA 3DDNA 2CHSA 3V3TA 3M4SA 3FFMA 3NK6A 4BVTA 3IMPA 4NQ3A 2KTVA 5FNVB 3RYCA 4B5CA 1VQVA 4I50A 1YQNA 4I55A 4TV9B 5J2UB 3TD3A 1VQNF 1GO0A 2HRYA 5BMVA 3QUWA 2WALA 2DYYA 3P0ZA 2B33A 3R0PA 3N2GA 1COMA 2LBWA 5ITZB 5C8YB 4O2AA 5MN5A 2VAPA 1U40A 5LXTA 1TVKA 2UYPA 3WPXA 3VYTC 3CMAF 3N4YA 1FNKA 4O4JA 4LCKA 2GVIA 3WJPA 2BTQB 5J2TA 1VH8A 2EWCA 5GIPC 5LP6B 3E22A 5IT9M 4BW0B 1YHQF 1T0KB 4X20A 2KTUA 5CA1A 1IV1A 4BT6A 1U43A 1NMUB 2V9YA 3VMFB 2Q1YA 1Q7YH 4XCQA 4O2BA 1UFYA 1X7PA 2BTOA 4TZZA 5BMVB 2VXYA 3D54A 1W5FA 3N2GB 4O2AB 2BTUA 4HNAA 5G4VC 3HKDA 1QU9A 3ON1A 5KX5A 3V7EA 3JALA 2GLZA 2CVLA 4ZHQA 3CYQA 3S0HA 1T0AA 3JCMM 3JASA 4B46A 5J2TB 3C9SA 3F0FA 2R751 3N2KA 4EI8A 3F0GA 1E7KA 5GIOC 5HP7A 3LFOA 5HY0A 1NQ3A 3JAKA 3VYUC 3LWOC 1JJ2F 2ZVYA 4U3JA 4G4VA 3D01A 3WPWA 3CMEF 3SIUA 1PF5A 4X20B 3TD4A 1KD1H 5CA1B 4DXDA 3F0EA 4F6RB 4X1KA 5HXUA 3J7AR 2HRUA 4X3LA 3NVIB 1J7HA 3E20B 4O2BB 3S0WA 3G4SF 3CCRF 3FBAA 2KGWA 4M8IA 5FLXM 4HNAB 3HKDB 4ZOLB 3LWQC 1KC8H 1X52A 3CB2A 5KX5B 3JALB 2OTLF 1W5BA 1H48A 4ZHQB 3JASB 1VQOF 4ZI7B 3N2KB 3HWUA 3OBWA 3RYHA 3VTIC 1QVFF 4U39A 4U3JB 2HQSC 4PWTA 3S06A 3ZP4A 4BVQA 3LMEA 5ITZA 5C8YA 2YYEA 1UI9A 2LCAA 4C82A 1W3EX 1S72F 3I56F 3M1XA 1VQMF 3WGKA 2QA4F 4B45A 5LP6A 3N4ZA 3S02A 2QI2A 4C4WC 3F6MA 4RQOA 5JH7A 1IV2A 1CK2A 3MCQA 3VIUA 3VYSC 1SDSA 1X25A 2GZLA 2OTJF 4IIJA 1W41A 3NK7A 3OONA 1XBIA 2KG4A 3ESJA 3IEQA 3RYHB 2AIFA 3V4DA 1SZQA 1Z5WA 4G4XA 2Z1TA 3MCAB 1VQ5F 2LBXA 1K8AH 2QEXF 1SA0B 3WGJA 1CLIA 1KNJA 3BYQA 3TD5A 1QD9A 3QTYA 4BY9D 4DRXA 4NUTA 3EORA 4ERHA 3LYBA 3CCLF 1VQLF 3JATB 3FD6A 2HS3A 5GANK 1VQ4F 5JVDB 4LNUA 5JH7B 3V7QA 4EI9A 3U0OA 3K14A 4O4HB 4C8GA 1W40A 1Q81H 3HKCB 1N8RH 2ZF8A 1PXWA 1M1KH 4F6RA 4IIJB 2AIZP 5LA6A 5LYJB 4WBNA 4EB6B 3VI6A 1RQ7A 2PHNA 2K1SA 5CB4A 3NVKE 3NMUC 1M90H 5HY4A 3E1YA 2ZOVA 1FSZA 3S03A 3CCVF 2OZBA 4ZOLA 4DRXB 2P6YA 3CCSF 2W8BC 2VGNA 4I4TA 1FFXB 2DT4A 3M84A 1Q8RA 3O85A 4ZI7A 2Z1FA 1VQ7F 2ZODA 4ZHVA 1VHAA 4G4ZA 3C9RA 4LNUB 5HY1A 3RA6A 3RE3A 3JARB 4C81A 2CHTA 2UYNB 2VAWA 3OW2F 3J80M 3KIZA 3WJRA 5LA6B 2YXZA 3P10A 4WBNB 3VCZA 3HJWC 4YJ3B 1Z5VA 1W55A 5CB4B 1ODEA 1JFFA 2CW4A 3D00A 5FJ4C 4B62A 4X1YB 4IHJB 2OTMA 4C8EA 4BT2A 2R6R1 3KE1A 4I4TB 5HXZA 1VQ6F 1W42A 2RHLA 3CCMF 2N48A 1IV3A 2PMPA 1YJWF 4X1IA 3K12A 2HP3A 5EB1B 2LBTA 5A2QM 3RYIB 3VO8A 5EWRA 3Q8HA 3IKEA 1K73H 4BT7A 2UZHA 1SA0A 3PLAC 3QHDA 3CG6A 5IJ9A 2HP0B 1VQPF 1JN1A 1W57A 3CC4F 3IKFA 1DT9A 3GYQA 3OBYA 3VOAA 3S0YA 1JFFB 3DC2A 3JATA 3CXCF 3K2XA 1DBFA 2Z1UA 3IEWA 3RA5A 5IJ0B 5JVDA 3I7TA 1VQKF 4BT4A 2F9ZC 3JAWA 3FD5A 5AVMA 4RHAA 2RB9A 4O4HA 3C9UA 1YGYA 2RHOA 5B8FA 1VQ8F 3HKCA 5JCOC 5LYJA 4BT3A 4EB6A 4X3MA 1YJNF 5GONA 3UT5B 1JY8A 2BO1A 4X1IB 2QTPA 3ZP7A 1RA4A 3SIVA 3CPQA 4ZK7A 3CCUF 4KWEA 3FPIA 3JAMM 1H7MA 2OHWA 5IJ9B 5JCOA 3WGLA 1ONIA 2H8EA 5KMGA 4ZHYB 4O4LB 1FFXA 1RLGA 3RYFA 3VOBA 2L26A 2ZAUA 1KNKA 2HVYD 3IR9A 1YI2F 3MDOA 3LWPC 2I6DA 3JAWB 2HX0A 2NMUA 3JARA 2UYNA 4EI7A 2UYKA 4C8IA 4TV8A 3I55F 5LOVA 2VAMA 3LWVC 4YJ3A 1W2BF 4BT5A 5GONB 5DCVA 2I6RA 3CYPB 2RHJA 1JD1A 4R40B 2IAFA 3HKEB 2CWJA 2H8CA 5G4UC 5MN4A 3B6NA 4X1YA 4IHJA 5EZYA 5EB0A 2FC3A 5KMGB 4G4YA 4NWOB 1U3PA 1XHOA 1QAHA 3KJJA 3LWRC 3KJKA 3RYFB 2Z01A 1OFUA 4FFBA 3ZO8A 3RYCB 1X7OA 4I50B 4I55B 5JQGA 2ALEA 3RYIA 5EO3A 5EIBC 4TV8B 3F0DA 3CD6F 4YJ2A 5LXTB 5LOVB 1TVKB 2HP0A 3KHNA 1W581 2HS4A 3HAXD 1H47A 1OAPA 1GO1A 2JNBA 4O4JB 5EYPA 3C9TA 3WXMB 1QVGF 4BVRA 3GTZA 3L7QA 3P4EA 4TUYA 3ZOPA 1IV4A 1TUBA 3C8LA 3E22B 4BVSA 3PAFA 3HKBA 1U3LA 1IPAA 2H6LA 5IJ0A 5IYZA 1KQSF 5EZYB 3G71F 3CPWF 1CN7A 2MQEA 5CA0A 1Q86H 4O4IA 1RLUA 5HY2A 2CZWA 5MN6A 1VQ9F 4FFBB 3JVHA 3CCQF 5EIBD 4ZHWA 3CCJF 3K0TA 3UT5A
chains in the Genus database with same CATH topology
5G4VC 1YIJF 1VQ8F 3G6EF 3ON1A 3V7EA 2GLZA 3V7QA 1NJIH 4EI9A 4X3MA 3JCMM 1YJNF 4EI8A 1W40A 2BO1A 5GINC 1Q81H 1E7KA 1N8RH 2FGYA 1PXWA 1RA4A 3LFOA 5GIOC 1M1KH 3SIVA 3J81M 5HY0A 3CPQA 3LWOC 1YITF 1JJ2F 3CCUF 3SIUA 3CMEF 3JAMM 1H7MA 2OHWA 1KD1H 3VI6A 3CC2F 3NVKE 3AGKA 5HWEA 3NMUC 1M90H 5HXUA 5HY4A 3CC7F 3E1YA 3J7AR 1RLGA 4X3LA 3NVIB 3E20B 3CCVF 2OZBA 1YJ9F 2HVYD 3G4SF 3IR9A 3CCRF 1YI2F 3LWPC 3CCSF 2I6DA 2VGNA 5GAPK 5FLXM 3O85A 4EI7A 1K9MH 1VQ7F 3LWQC 3CCEF 1KC8H 1X52A 3I55F 2VGMA 2OTLF 3LWVC 5HY1A 3RA6A 1W2BF 1VQOF 5DCVA 3OW2F 1ZWZA 3OBWA 1GZ0A 3J80M 1Q82H 3V3TA 1QVFF 3HJWC 5G4UC 3FFMA 3NK6A 4BVTA 2FC3A 4BVQA 4NQ3A 2KTVA 3D00A 5FJ4C 1VQNF 1GO0A 3LWRC 1W3EX 1S72F 3I56F 1VQMF 2WALA 2LBWA 2QA4F 1X7OA 2ALEA 3N4ZA 5HXZA 1VQ6F 2QI2A 3CMAF 4C4WC 5EO3A 3N4YA 1W42A 3CCMF 1CK2A 4LCKA 3CD6F 1SDSA 1YJWF 5GIPC 2OTJF 5IT9M 4BW0B 5A2QM 3HAXD 5EWRA 1GO1A 1W41A 2JNBA 1YHQF 3NK7A 1K73H 1T0KB 1XBIA 3PLAC 2KG4A 3WXMB 1QVGF 4BVRA 3CG6A 2KTUA 2AIFA 4BVSA 1VQPF 3PAFA 1IPAA 3MCAB 1KQSF 1VQ5F 3CC4F 1DT9A 2LBXA 3GYQA 3OBYA 2QEXF 1K8AH 3G71F 1NMUB 3CPWF 1CN7A 3VMFB 1Q7YH 3CXCF 1Q86H 4XCQA 1X7PA 4TZZA 3RA5A 4BY9D 5HY2A 4NUTA 2CZWA 1VQ9F 2F9ZC 1VQKF 3CCQF 1VQLF 3CCLF 3CCJF 5GANK 1VQ4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4V C;  1YIJ F;  1VQ8 F;  3G6E F;  3ON1 A;  3V7E A;  3V7Q A;  1NJI H;  4X3M A;  3JCM M;  1YJN F;  1W40 A;  2BO1 A;  5GIN C;  1Q81 H;  1E7K A;  1N8R H;  5GIO C;  1PXW A;  1RA4 A;  3LFO A;  1M1K H;  3SIV A;  3J81 M;  3LWO C;  3CPQ A;  1YIT F;  1JJ2 F;  3CCU F;  3SIU A;  3CME F;  3JAM M;  1H7M A;  2OHW A;  1KD1 H;  3VI6 A;  3CC2 F;  3NVK E;  3AGK A;  3NMU C;  1M90 H;  3CC7 F;  3E1Y A;  3J7A R;  1RLG A;  4X3L A;  3NVI B;  3E20 B;  3CCV F;  2OZB A;  1YJ9 F;  2HVY D;  3G4S F;  3IR9 A;  3CCR F;  1YI2 F;  3LWP C;  3CCS F;  2I6D A;  2VGN A;  5GAP K;  5FLX M;  3O85 A;  1K9M H;  1VQ7 F;  3LWQ C;  3CCE F;  1KC8 H;  1X52 A;  3I55 F;  2VGM A;  2OTL F;  3LWV C;  3RA6 A;  1W2B F;  1VQO F;  5DCV A;  3OW2 F;  1ZWZ A;  3OBW A;  1GZ0 A;  3J80 M;  1Q82 H;  1QVF F;  3HJW C;  5G4U C;  3FFM A;  3NK6 A;  2FC3 A;  2KTV A;  5FJ4 C;  1VQN F;  1GO0 A;  3LWR C;  1W3E X;  1S72 F;  3I56 F;  1VQM F;  2WAL A;  2LBW A;  2QA4 F;  1X7O A;  2ALE A;  3N4Z A;  1VQ6 F;  2QI2 A;  3CMA F;  4C4W C;  3N4Y A;  5EO3 A;  1W42 A;  3CCM F;  1CK2 A;  4LCK A;  3CD6 F;  1SDS A;  1YJW F;  5GIP C;  2OTJ F;  5IT9 M;  4BW0 B;  5A2Q M;  3HAX D;  5EWR A;  1GO1 A;  1W41 A;  2JNB A;  1YHQ F;  3NK7 A;  1K73 H;  1T0K B;  1XBI A;  3PLA C;  2KG4 A;  3WXM B;  1QVG F;  3CG6 A;  2KTU A;  2AIF A;  1VQP F;  3PAF A;  1IPA A;  3MCA B;  1KQS F;  1VQ5 F;  3CC4 F;  1DT9 A;  2LBX A;  3GYQ A;  3OBY A;  2QEX F;  1K8A H;  3G71 F;  1NMU B;  3CPW F;  1CN7 A;  3VMF B;  1Q7Y H;  3CXC F;  1Q86 H;  1X7P A;  4TZZ A;  3RA5 A;  4BY9 D;  4NUT A;  2CZW A;  1VQ9 F;  1VQK F;  3CCQ F;  1VQL F;  3CCL F;  3CCJ F;  5GAN K;  1VQ4 F; 
#chains in the Genus database with same CATH topology
 5JQG B;  3HTN A;  1YIJ F;  4E6E A;  3G6E F;  3WGN A;  2Z1E A;  1NJI H;  1RQ2 A;  1W59 A;  3ELC A;  3MQW A;  4YJ2 B;  3GHZ A;  1VK3 A;  5GIN C;  5EAZ A;  2FGY A;  1GX1 A;  3J81 M;  1YIT F;  5EYP B;  4O4L A;  2UYJ A;  4TUY B;  2IQQ A;  1TUB B;  3CC2 F;  4G4W A;  1XRG A;  3I3F A;  3AGK A;  3HKB B;  5HWE A;  5IYZ B;  3CC7 F;  3JAK B;  5FNV A;  2Q1X A;  4TV9 A;  5J2U A;  5LP6 C;  2CSL A;  2AMT A;  1R1M A;  5CA0 B;  3WGM A;  1YJ9 F;  5HP8 A;  4O4I B;  2ZVZ A;  1XV2 A;  4X1K B;  2G9I A;  1W5A A;  5GAP K;  3LDT A;  1FNJ A;  1K9M H;  2IG8 A;  3CCE F;  4G88 A;  2VGM A;  3HKE A;  2RHH A;  2HS0 A;  3ERN A;  3T80 A;  1W5E A;  1ZWZ A;  3MBM A;  1GZ0 A;  1Q82 H;  3WJQ A;  3DDN A;  2CHS A;  3V3T A;  3M4S A;  3FFM A;  3NK6 A;  4BVT A;  3IMP A;  4NQ3 A;  2KTV A;  5FNV B;  3RYC A;  4B5C A;  1VQV A;  4I50 A;  1YQN A;  4I55 A;  4TV9 B;  5J2U B;  3TD3 A;  1VQN F;  1GO0 A;  2HRY A;  5BMV A;  3QUW A;  2WAL A;  2DYY A;  3P0Z A;  2B33 A;  3R0P A;  3N2G A;  1COM A;  2LBW A;  5ITZ B;  5C8Y B;  4O2A A;  5MN5 A;  2VAP A;  1U40 A;  5LXT A;  1TVK A;  2UYP A;  3WPX A;  3VYT C;  3CMA F;  3N4Y A;  1FNK A;  4O4J A;  4LCK A;  2GVI A;  3WJP A;  2BTQ B;  5J2T A;  1VH8 A;  2EWC A;  5GIP C;  5LP6 B;  3E22 A;  5IT9 M;  4BW0 B;  1YHQ F;  1T0K B;  4X20 A;  2KTU A;  5CA1 A;  1IV1 A;  4BT6 A;  1U43 A;  1NMU B;  2V9Y A;  3VMF B;  2Q1Y A;  1Q7Y H;  4XCQ A;  4O2B A;  1UFY A;  1X7P A;  2BTO A;  4TZZ A;  5BMV B;  2VXY A;  3D54 A;  1W5F A;  3N2G B;  4O2A B;  2BTU A;  4HNA A;  5G4V C;  3HKD A;  1QU9 A;  3ON1 A;  5KX5 A;  3V7E A;  3JAL A;  2GLZ A;  2CVL A;  4ZHQ A;  3CYQ A;  3S0H A;  1T0A A;  3JCM M;  3JAS A;  4B46 A;  5J2T B;  3C9S A;  3F0F A;  2R75 1;  3N2K A;  4EI8 A;  3F0G A;  1E7K A;  5GIO C;  5HP7 A;  3LFO A;  5HY0 A;  1NQ3 A;  3JAK A;  3VYU C;  3LWO C;  1JJ2 F;  2ZVY A;  4U3J A;  4G4V A;  3D01 A;  3WPW A;  3CME F;  3SIU A;  1PF5 A;  4X20 B;  3TD4 A;  1KD1 H;  5CA1 B;  4DXD A;  3F0E A;  4F6R B;  4X1K A;  5HXU A;  3J7A R;  2HRU A;  4X3L A;  3NVI B;  1J7H A;  3E20 B;  4O2B B;  3S0W A;  3G4S F;  3CCR F;  3FBA A;  2KGW A;  4M8I A;  5FLX M;  4HNA B;  3HKD B;  4ZOL B;  3LWQ C;  1KC8 H;  1X52 A;  3CB2 A;  5KX5 B;  3JAL B;  2OTL F;  1W5B A;  1H48 A;  4ZHQ B;  3JAS B;  1VQO F;  4ZI7 B;  3N2K B;  3HWU A;  3OBW A;  3RYH A;  3VTI C;  1QVF F;  4U39 A;  4U3J B;  2HQS C;  4PWT A;  3S06 A;  3ZP4 A;  4BVQ A;  3LME A;  5ITZ A;  5C8Y A;  2YYE A;  1UI9 A;  2LCA A;  4C82 A;  1W3E X;  1S72 F;  3I56 F;  3M1X A;  1VQM F;  3WGK A;  2QA4 F;  4B45 A;  5LP6 A;  3N4Z A;  3S02 A;  2QI2 A;  4C4W C;  3F6M A;  4RQO A;  5JH7 A;  1IV2 A;  1CK2 A;  3MCQ A;  3VIU A;  3VYS C;  1SDS A;  1X25 A;  2GZL A;  2OTJ F;  4IIJ A;  1W41 A;  3NK7 A;  3OON A;  1XBI A;  2KG4 A;  3ESJ A;  3IEQ A;  3RYH B;  2AIF A;  3V4D A;  1SZQ A;  1Z5W A;  4G4X A;  2Z1T A;  3MCA B;  1VQ5 F;  2LBX A;  1K8A H;  2QEX F;  1SA0 B;  3WGJ A;  1CLI A;  1KNJ A;  3BYQ A;  3TD5 A;  1QD9 A;  3QTY A;  4BY9 D;  4DRX A;  4NUT A;  3EOR A;  4ERH A;  3LYB A;  3CCL F;  1VQL F;  3JAT B;  3FD6 A;  2HS3 A;  5GAN K;  1VQ4 F;  5JVD B;  4LNU A;  5JH7 B;  3V7Q A;  4EI9 A;  3U0O A;  3K14 A;  4O4H B;  4C8G A;  1W40 A;  1Q81 H;  3HKC B;  1N8R H;  2ZF8 A;  1PXW A;  1M1K H;  4F6R A;  4IIJ B;  2AIZ P;  5LA6 A;  5LYJ B;  4WBN A;  4EB6 B;  3VI6 A;  1RQ7 A;  2PHN A;  2K1S A;  5CB4 A;  3NVK E;  3NMU C;  1M90 H;  5HY4 A;  3E1Y A;  2ZOV A;  1FSZ A;  3S03 A;  3CCV F;  2OZB A;  4ZOL A;  4DRX B;  2P6Y A;  3CCS F;  2W8B C;  2VGN A;  4I4T A;  1FFX B;  2DT4 A;  3M84 A;  1Q8R A;  3O85 A;  4ZI7 A;  2Z1F A;  1VQ7 F;  2ZOD A;  4ZHV A;  1VHA A;  4G4Z A;  3C9R A;  4LNU B;  5HY1 A;  3RA6 A;  3RE3 A;  3JAR B;  4C81 A;  2CHT A;  2UYN B;  2VAW A;  3OW2 F;  3J80 M;  3KIZ A;  3WJR A;  5LA6 B;  2YXZ A;  3P10 A;  4WBN B;  3VCZ A;  3HJW C;  4YJ3 B;  1Z5V A;  1W55 A;  5CB4 B;  1ODE A;  1JFF A;  2CW4 A;  3D00 A;  5FJ4 C;  4B62 A;  4X1Y B;  4IHJ B;  2OTM A;  4C8E A;  4BT2 A;  2R6R 1;  3KE1 A;  4I4T B;  5HXZ A;  1VQ6 F;  1W42 A;  2RHL A;  3CCM F;  2N48 A;  1IV3 A;  2PMP A;  1YJW F;  4X1I A;  3K12 A;  2HP3 A;  5EB1 B;  2LBT A;  5A2Q M;  3RYI B;  3VO8 A;  5EWR A;  3Q8H A;  3IKE A;  1K73 H;  4BT7 A;  2UZH A;  1SA0 A;  3PLA C;  3QHD A;  3CG6 A;  5IJ9 A;  2HP0 B;  1VQP F;  1JN1 A;  1W57 A;  3CC4 F;  3IKF A;  1DT9 A;  3GYQ A;  3OBY A;  3VOA A;  3S0Y A;  1JFF B;  3DC2 A;  3JAT A;  3CXC F;  3K2X A;  1DBF A;  2Z1U A;  3IEW A;  3RA5 A;  5IJ0 B;  5JVD A;  3I7T A;  1VQK F;  4BT4 A;  2F9Z C;  3JAW A;  3FD5 A;  5AVM A;  4RHA A;  2RB9 A;  4O4H A;  3C9U A;  1YGY A;  2RHO A;  5B8F A;  1VQ8 F;  3HKC A;  5JCO C;  5LYJ A;  4BT3 A;  4EB6 A;  4X3M A;  1YJN F;  5GON A;  3UT5 B;  1JY8 A;  2BO1 A;  4X1I B;  2QTP A;  3ZP7 A;  1RA4 A;  3SIV A;  3CPQ A;  4ZK7 A;  3CCU F;  4KWE A;  3FPI A;  3JAM M;  1H7M A;  2OHW A;  5IJ9 B;  5JCO A;  3WGL A;  1ONI A;  2H8E A;  5KMG A;  4ZHY B;  4O4L B;  1FFX A;  1RLG A;  3RYF A;  3VOB A;  2L26 A;  2ZAU A;  1KNK A;  2HVY D;  3IR9 A;  1YI2 F;  3MDO A;  3LWP C;  2I6D A;  3JAW B;  2HX0 A;  2NMU A;  3JAR A;  2UYN A;  4EI7 A;  2UYK A;  4C8I A;  4TV8 A;  3I55 F;  5LOV A;  2VAM A;  3LWV C;  4YJ3 A;  1W2B F;  4BT5 A;  5GON B;  5DCV A;  2I6R A;  3CYP B;  2RHJ A;  1JD1 A;  4R40 B;  2IAF A;  3HKE B;  2CWJ A;  2H8C A;  5G4U C;  5MN4 A;  3B6N A;  4X1Y A;  4IHJ A;  5EZY A;  5EB0 A;  2FC3 A;  5KMG B;  4G4Y A;  4NWO B;  1U3P A;  1XHO A;  1QAH A;  3KJJ A;  3LWR C;  3KJK A;  3RYF B;  2Z01 A;  1OFU A;  4FFB A;  3ZO8 A;  3RYC B;  1X7O A;  4I50 B;  4I55 B;  5JQG A;  2ALE A;  3RYI A;  5EO3 A;  5EIB C;  4TV8 B;  3F0D A;  3CD6 F;  4YJ2 A;  5LXT B;  5LOV B;  1TVK B;  2HP0 A;  3KHN A;  1W58 1;  2HS4 A;  3HAX D;  1H47 A;  1OAP A;  1GO1 A;  2JNB A;  4O4J B;  5EYP A;  3C9T A;  3WXM B;  1QVG F;  4BVR A;  3GTZ A;  3L7Q A;  3P4E A;  4TUY A;  3ZOP A;  1IV4 A;  1TUB A;  3C8L A;  3E22 B;  4BVS A;  3PAF A;  3HKB A;  1U3L A;  1IPA A;  2H6L A;  5IJ0 A;  5IYZ A;  1KQS F;  5EZY B;  3G71 F;  3CPW F;  1CN7 A;  2MQE A;  5CA0 A;  1Q86 H;  4O4I A;  1RLU A;  5HY2 A;  2CZW A;  5MN6 A;  1VQ9 F;  4FFB B;  3JVH A;  3CCQ F;  5EIB D;  4ZHW A;  3CCJ F;  3K0T A;  3UT5 A; 
#chains in the Genus database with same CATH homology
 5G4V C;  1YIJ F;  1VQ8 F;  3G6E F;  3ON1 A;  3V7E A;  2GLZ A;  3V7Q A;  1NJI H;  4EI9 A;  4X3M A;  3JCM M;  1YJN F;  4EI8 A;  1W40 A;  2BO1 A;  5GIN C;  1Q81 H;  1E7K A;  1N8R H;  2FGY A;  1PXW A;  1RA4 A;  3LFO A;  5GIO C;  1M1K H;  3SIV A;  3J81 M;  5HY0 A;  3CPQ A;  3LWO C;  1YIT F;  1JJ2 F;  3CCU F;  3SIU A;  3CME F;  3JAM M;  1H7M A;  2OHW A;  1KD1 H;  3VI6 A;  3CC2 F;  3NVK E;  3AGK A;  5HWE A;  3NMU C;  1M90 H;  5HXU A;  5HY4 A;  3CC7 F;  3E1Y A;  3J7A R;  1RLG A;  4X3L A;  3NVI B;  3E20 B;  3CCV F;  2OZB A;  1YJ9 F;  2HVY D;  3G4S F;  3IR9 A;  3CCR F;  1YI2 F;  3LWP C;  3CCS F;  2I6D A;  2VGN A;  5GAP K;  5FLX M;  3O85 A;  4EI7 A;  1K9M H;  1VQ7 F;  3LWQ C;  3CCE F;  1KC8 H;  1X52 A;  3I55 F;  2VGM A;  2OTL F;  3LWV C;  5HY1 A;  3RA6 A;  1W2B F;  1VQO F;  5DCV A;  3OW2 F;  1ZWZ A;  3OBW A;  1GZ0 A;  3J80 M;  1Q82 H;  3V3T A;  1QVF F;  3HJW C;  5G4U C;  3FFM A;  3NK6 A;  4BVT A;  2FC3 A;  4BVQ A;  4NQ3 A;  2KTV A;  3D00 A;  5FJ4 C;  1VQN F;  1GO0 A;  3LWR C;  1W3E X;  1S72 F;  3I56 F;  1VQM F;  2WAL A;  2LBW A;  2QA4 F;  1X7O A;  2ALE A;  3N4Z A;  5HXZ A;  1VQ6 F;  2QI2 A;  3CMA F;  4C4W C;  5EO3 A;  3N4Y A;  1W42 A;  3CCM F;  1CK2 A;  4LCK A;  3CD6 F;  1SDS A;  1YJW F;  5GIP C;  2OTJ F;  5IT9 M;  4BW0 B;  5A2Q M;  3HAX D;  5EWR A;  1GO1 A;  1W41 A;  2JNB A;  1YHQ F;  3NK7 A;  1K73 H;  1T0K B;  1XBI A;  3PLA C;  2KG4 A;  3WXM B;  1QVG F;  4BVR A;  3CG6 A;  2KTU A;  2AIF A;  4BVS A;  1VQP F;  3PAF A;  1IPA A;  3MCA B;  1KQS F;  1VQ5 F;  3CC4 F;  1DT9 A;  2LBX A;  3GYQ A;  3OBY A;  2QEX F;  1K8A H;  3G71 F;  1NMU B;  3CPW F;  1CN7 A;  3VMF B;  1Q7Y H;  3CXC F;  1Q86 H;  4XCQ A;  1X7P A;  4TZZ A;  3RA5 A;  4BY9 D;  5HY2 A;  4NUT A;  2CZW A;  1VQ9 F;  2F9Z C;  1VQK F;  3CCQ F;  1VQL F;  3CCL F;  3CCJ F;  5GAN K;  1VQ4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...