1VQNH

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
171
structure length
160
Chain Sequence
KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIDSSPAGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 40
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1vqnH00
3J7ZM 3G6EH 5GAGN 4UY8M 3CC4H 3DLLJ 2ZJQJ 1QVFH 1YJ9H 1VQ8H 4IOAJ 2ZJRJ 1N8RJ 2QEXH 5GADN 4WFNJ 1NJIJ 5GAEN 5HL7J 1YITH 4IO9J 1VQPH 1K9MJ 5DM6J 1YHQH 4U67J 1VQ9H 3G4SH 1VQMH 3CCLH 3CC2H 3G71H 4WFBJ 5AN9F 1Q86J 1K73J 1Q82J 3CPWH 1Q7YJ 1S72H 1KQSH 1WKIA 1VQOH 5JVHJ 1YJNH 3CD6H 1VQ4H 3CCVH 4WF9J 2PA2A 3CXCH 3CCJH 5GAHN 4WCEJ 1KC8J 3CCMH 5H1SO 3OW2H 1YI2H 1W2BH 3CC7H 3I56H 5JVGJ 1M1KJ 3CMEH 4IOCJ 1YJWH 3PIOJ 2OTLH 1VQ7H 1JJ2H 1VQLH 3CF5J 1VQKH 1VQ6H 2QA4H 5DM7J 3I55H 3PIPJ 1M90J 1YIJH 1Q81J 4WFAJ 1VQNH 3CCSH 3CCQH 3CCUH 1Y69K 3CCEH 2OTJH 1QVGH 2ZJPJ 3CCRH 1K8AJ 1VQ5H 5MLCO 1KD1J 3CMAH
chains in the Genus database with same CATH superfamily
3J7ZM 5EY3A 3G6EH 5GAGN 4UY8M 1DGJA 4EADA 3CC4H 3DLLJ 2ZJQJ 3NS1C 1YJ9H 1QVFH 1VQ8H 4IOAJ 2ZJRJ 2WK6A 1N8RJ 2QEXH 1JRPB 1FIQC 2W3RB 5GADN 4WFNJ 1NJIJ 3AM9A 5GAEN 5HL7J 1QPNA 1VLBA 1YITH 3FAHA 4IO9J 4GA5A 1VQPH 4GA4A 4USAA 5DM6J 1V97A 2WP4A 3C2RA 4C7YA 4U67J 1YHQH 1K9MJ 4KWWA 2B7NA 3FC4A 3VMMA 5EP8A 2OMDA 3AMZA 1VQ9H 3G4SH 1N5XA 1VQMH 1YTDA 1YTEA 3NVZC 3WO0A 5AYXA 3CCLH 3GNNA 3CC2H 3L0GA 4LHMA 1FFUB 1WYGA 3BIIE 4GA6A 3G71H 1BRWA 3C2EA 1QAPA 3SR6C 4WFBJ 1RM6A 2DSJA 1ZXIB 5AN9F 1UOUA 3NVWC 5AYYA 1Q86J 1K73J 1FFVB 1Q82J 3C2OA 3ETRC 3CPWH 1Q7YJ 1S72H 1KQSH 1FMAE 1WKIA 1VQOH 5AYZA 1QPOA 1NVJA 2J0FA 2E3TA 5JVHJ 3NRZC 1N63B 2QIEA 3NVYC 1YJNH 3CD6H 3RPFA 3TQVA 1VQ4H 3CCVH 4WF9J 1AZYA 2PA2A 2TPTA 5HULA 3CXCH 3CCJH 4YYYA 3C2FA 5GAHN 3WO1A 4XR5A 4WCEJ 1KC8J 1QPQA 3AN1A 1N5WB 3CCMH 5HUOA 4C7ZA 5H1SO 3OW2H 4US9A 1N62B 4X46A 1YI2H 1W2BH 3CC7H 2Q5WE 3NVVC 3I56H 1VDVA 5JVGJ 1M1KJ 3H5QA 3CMEH 4IOCJ 1YJWH 3PIOJ 2I14A 2OTLH 5HUPA 1FM0E 1VQ7H 1JJ2H 1JROB 1VQLH 5MPOC 3CF5J 1NVIE 1VQKH 1SB3A 1YTKA 1VQ6H 2QA4H 1SIJA 5DM7J 2I1OA 3I55H 3PIPJ 1M90J 2WK5A 1O4UA 1YIJH 2W55B 1Q81J 3PAJA 2JBMA 3B9JC 1QPRA 1X1OA 2B7QA 4WFAJ 1VQNH 4C80A 4I9AA 3CCQH 3CCSH 4YEKA 1OTPA 2W3SB 4US8A 3CCUH 3C2VA 1Y69K 1N61B 4AP8A 3CCEH 3WNZA 2B7PA 2OTJH 3L4PA 1QVGH 2W54B 4KWVA 4EAFA 1N60B 2ZJPJ 3EUB4 3CCRH 1K8AJ 1VQ5H 5MLCO 1FO4A 1KD1J 4ZOHA 3CMAH
chains in the Genus database with same CATH topology
3J7ZM 3G6EH 5GAGN 4UY8M 3CC4H 3DLLJ 2ZJQJ 1QVFH 1YJ9H 1VQ8H 4IOAJ 2ZJRJ 1N8RJ 2QEXH 5GADN 4WFNJ 1NJIJ 5GAEN 5HL7J 1YITH 4IO9J 1VQPH 1K9MJ 5DM6J 1YHQH 4U67J 1VQ9H 3G4SH 1VQMH 3CCLH 3CC2H 3G71H 4WFBJ 5AN9F 1Q86J 1K73J 1Q82J 3CPWH 1Q7YJ 1S72H 1KQSH 1WKIA 1VQOH 5JVHJ 1YJNH 3CD6H 1VQ4H 3CCVH 4WF9J 2PA2A 3CXCH 3CCJH 5GAHN 4WCEJ 1KC8J 3CCMH 5H1SO 3OW2H 1YI2H 1W2BH 3CC7H 3I56H 5JVGJ 1M1KJ 3CMEH 4IOCJ 1YJWH 3PIOJ 2OTLH 1VQ7H 1JJ2H 1VQLH 3CF5J 1VQKH 1VQ6H 2QA4H 5DM7J 3I55H 3PIPJ 1M90J 1YIJH 1Q81J 4WFAJ 1VQNH 3CCSH 3CCQH 3CCUH 1Y69K 3CCEH 2OTJH 1QVGH 2ZJPJ 3CCRH 1K8AJ 1VQ5H 5MLCO 1KD1J 3CMAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Z M;  3G6E H;  5GAG N;  4UY8 M;  3CC4 H;  3DLL J;  2ZJQ J;  1QVF H;  1YJ9 H;  1VQ8 H;  4IOA J;  2ZJR J;  1N8R J;  2QEX H;  5GAD N;  4WFN J;  1NJI J;  5GAE N;  5HL7 J;  1YIT H;  4IO9 J;  1VQP H;  1K9M J;  5DM6 J;  1YHQ H;  4U67 J;  1VQ9 H;  3G4S H;  1VQM H;  3CCL H;  3CC2 H;  3G71 H;  4WFB J;  5AN9 F;  1Q86 J;  1K73 J;  1Q82 J;  3CPW H;  1Q7Y J;  1S72 H;  1KQS H;  1WKI A;  1VQO H;  5JVH J;  1YJN H;  3CD6 H;  1VQ4 H;  3CCV H;  4WF9 J;  2PA2 A;  3CXC H;  3CCJ H;  5GAH N;  4WCE J;  1KC8 J;  3CCM H;  5H1S O;  3OW2 H;  1YI2 H;  1W2B H;  3CC7 H;  3I56 H;  5JVG J;  1M1K J;  3CME H;  4IOC J;  1YJW H;  3PIO J;  2OTL H;  1VQ7 H;  1JJ2 H;  1VQL H;  3CF5 J;  1VQK H;  1VQ6 H;  2QA4 H;  5DM7 J;  3I55 H;  3PIP J;  1M90 J;  1YIJ H;  1Q81 J;  4WFA J;  1VQN H;  3CCS H;  3CCQ H;  3CCU H;  1Y69 K;  3CCE H;  2OTJ H;  1QVG H;  2ZJP J;  3CCR H;  1K8A J;  1VQ5 H;  5MLC O;  1KD1 J;  3CMA H; 
#chains in the Genus database with same CATH topology
 3J7Z M;  5EY3 A;  3G6E H;  5GAG N;  4UY8 M;  1DGJ A;  4EAD A;  3CC4 H;  3DLL J;  2ZJQ J;  3NS1 C;  1YJ9 H;  1QVF H;  1VQ8 H;  4IOA J;  2ZJR J;  2WK6 A;  1N8R J;  2QEX H;  1JRP B;  1FIQ C;  2W3R B;  5GAD N;  4WFN J;  1NJI J;  3AM9 A;  5GAE N;  5HL7 J;  1QPN A;  1VLB A;  1YIT H;  3FAH A;  4IO9 J;  4GA5 A;  1VQP H;  4GA4 A;  4USA A;  5DM6 J;  1V97 A;  2WP4 A;  3C2R A;  4C7Y A;  4U67 J;  1YHQ H;  1K9M J;  4KWW A;  2B7N A;  3FC4 A;  3VMM A;  5EP8 A;  2OMD A;  3AMZ A;  1VQ9 H;  3G4S H;  1N5X A;  1VQM H;  1YTD A;  1YTE A;  3NVZ C;  3WO0 A;  5AYX A;  3CCL H;  3GNN A;  3CC2 H;  3L0G A;  4LHM A;  1FFU B;  1WYG A;  3BII E;  4GA6 A;  3G71 H;  1BRW A;  3C2E A;  1QAP A;  3SR6 C;  4WFB J;  1RM6 A;  2DSJ A;  1ZXI B;  5AN9 F;  1UOU A;  3NVW C;  5AYY A;  1Q86 J;  1K73 J;  1FFV B;  1Q82 J;  3C2O A;  3ETR C;  3CPW H;  1Q7Y J;  1S72 H;  1KQS H;  1FMA E;  1WKI A;  1VQO H;  5AYZ A;  1QPO A;  1NVJ A;  2J0F A;  2E3T A;  5JVH J;  3NRZ C;  1N63 B;  2QIE A;  3NVY C;  1YJN H;  3CD6 H;  3RPF A;  3TQV A;  1VQ4 H;  3CCV H;  4WF9 J;  1AZY A;  2PA2 A;  2TPT A;  5HUL A;  3CXC H;  3CCJ H;  4YYY A;  3C2F A;  5GAH N;  3WO1 A;  4XR5 A;  4WCE J;  1KC8 J;  1QPQ A;  3AN1 A;  1N5W B;  3CCM H;  5HUO A;  4C7Z A;  5H1S O;  3OW2 H;  4US9 A;  1N62 B;  4X46 A;  1YI2 H;  1W2B H;  3CC7 H;  2Q5W E;  3NVV C;  3I56 H;  1VDV A;  5JVG J;  1M1K J;  3H5Q A;  3CME H;  4IOC J;  1YJW H;  3PIO J;  2I14 A;  2OTL H;  5HUP A;  1FM0 E;  1VQ7 H;  1JJ2 H;  1JRO B;  1VQL H;  5MPO C;  3CF5 J;  1NVI E;  1VQK H;  1SB3 A;  1YTK A;  1VQ6 H;  2QA4 H;  1SIJ A;  5DM7 J;  2I1O A;  3I55 H;  3PIP J;  1M90 J;  2WK5 A;  1O4U A;  1YIJ H;  2W55 B;  1Q81 J;  3PAJ A;  2JBM A;  3B9J C;  1QPR A;  1X1O A;  2B7Q A;  4WFA J;  1VQN H;  4C80 A;  4I9A A;  3CCQ H;  3CCS H;  4YEK A;  1OTP A;  2W3S B;  4US8 A;  3CCU H;  3C2V A;  1Y69 K;  1N61 B;  4AP8 A;  3CCE H;  3WNZ A;  2B7P A;  2OTJ H;  3L4P A;  1QVG H;  2W54 B;  4KWV A;  4EAF A;  1N60 B;  2ZJP J;  3EUB 4;  3CCR H;  1K8A J;  1VQ5 H;  5MLC O;  1FO4 A;  1KD1 J;  4ZOH A;  3CMA H; 
#chains in the Genus database with same CATH homology
 3J7Z M;  3G6E H;  5GAG N;  4UY8 M;  3CC4 H;  3DLL J;  2ZJQ J;  1QVF H;  1YJ9 H;  1VQ8 H;  4IOA J;  2ZJR J;  1N8R J;  2QEX H;  5GAD N;  4WFN J;  1NJI J;  5GAE N;  5HL7 J;  1YIT H;  4IO9 J;  1VQP H;  1K9M J;  5DM6 J;  1YHQ H;  4U67 J;  1VQ9 H;  3G4S H;  1VQM H;  3CCL H;  3CC2 H;  3G71 H;  4WFB J;  5AN9 F;  1Q86 J;  1K73 J;  1Q82 J;  3CPW H;  1Q7Y J;  1S72 H;  1KQS H;  1WKI A;  1VQO H;  5JVH J;  1YJN H;  3CD6 H;  1VQ4 H;  3CCV H;  4WF9 J;  2PA2 A;  3CXC H;  3CCJ H;  5GAH N;  4WCE J;  1KC8 J;  3CCM H;  5H1S O;  3OW2 H;  1YI2 H;  1W2B H;  3CC7 H;  3I56 H;  5JVG J;  1M1K J;  3CME H;  4IOC J;  1YJW H;  3PIO J;  2OTL H;  1VQ7 H;  1JJ2 H;  1VQL H;  3CF5 J;  1VQK H;  1VQ6 H;  2QA4 H;  5DM7 J;  3I55 H;  3PIP J;  1M90 J;  1YIJ H;  1Q81 J;  4WFA J;  1VQN H;  3CCS H;  3CCQ H;  3CCU H;  1Y69 K;  3CCE H;  2OTJ H;  1QVG H;  2ZJP J;  3CCR H;  1K8A J;  1VQ5 H;  5MLC O;  1KD1 J;  3CMA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...