1VQNL

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 28
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vqnL02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1vqnL01
3CCVO 1YITL 2OTLL 3G6EL 1W2BK 3CCJO 1QVGN 3OW2N 1VQOO 1YJNO 1N8RP 2OTLO 3G6EO 3CCUL 2QA4L 1VQ5L 3CCQL 1K8AM 1KQSK 3CCRL 1W2BN 3G71L 1KD1P 3CCUO 2QA4O 1VQ5O 1VQNL 1VQML 3CCRO 1M1KP 3G71O 1YI2L 1VQNO 1VQMO 2QEXL 3CC7L 1K73M 1KQSN 1YI2O 1M90M 1VQLL 2QEXO 3CC7O 3I56L 1VQPL 1VQLO 3I56O 1YJ9L 1YITO 1VQPO 1VQ4L 1YJ9O 1Q82M 3CCLL 1YIJL 3CCEL 1VQ4O 1K9MP 3CCQO 3CCLO 1YIJO 3CCEO 1NJIP 1N8RM 3G4SL 1Q81P 1VQ8L 1KC8P 3CXCK 1QVFK 3CMAL 3G4SO 1Q7YP 1VQ8O 3CMAO 1JJ2K 1KD1M 1Q86P 1M1KM 3CXCN 1YHQL 1QVFN 1YJWL 3I55L 1K8AP 3CCSL 3OW2K 1JJ2N 1YJWO 3I55O 1VQ9L 3CPWK 1VQOL 1VQ9O 3CCML 1K73P 1M90P 3CCMO 1Q86M 3CMEL 3CPWN 1S72L 1VQKL 3CC4L 3CD6L 1K9MM 3CMEO 2OTJL 3CC4O 1S72O 1VQKO 3CD6O 1NJIM 1VQ7L 2OTJO 1Q82P 1QVGK 3CC2L 1YHQO 1VQ6L 1VQ7O 1Q81M 1KC8M 3CCVL 3CC2O 3CCSO 1VQ6O 3CCJL 1Q7YM 1YJNL
chains in the Genus database with same CATH superfamily
3CCVO 1YITL 2OTLL 3G6EL 1W2BK 3CCJO 1QVGN 3OW2N 1VQOO 1YJNO 5DS4A 1N8RP 2OTLO 3G6EO 3CCUL 2QA4L 1VQ5L 3CCQL 1K8AM 1KQSK 3CCRL 1W2BN 3G71L 1KD1P 3CCUO 2QA4O 1VQ5O 1VQNL 1VQML 3CCRO 1M1KP 3G71O 4P6IC 1YI2L 1VQNO 1VQMO 2QEXL 3CC7L 1K73M 1KQSN 5DS5A 1YI2O 1M90M 5DLJA 1VQLL 2QEXO 3CC7O 3I56L 1VQPL 1VQLO 5FCLA 3I56O 1YJ9L 1YITO 1VQPO 4WJ0A 5DS6A 1VQ4L 1YJ9O 1Q82M 3CCLL 1YIJL 3CCEL 1VQ4O 1K9MP 2YZSA 3CCQO 3CCLO 1YIJO 3CCEO 1NJIP 3GODA 1N8RM 3G4SL 1Q81P 1VQ8L 1KC8P 3CXCK 1QVFK 3CMAL 4N06A 3G4SO 1Q7YP 1VQ8O 3CMAO 1JJ2K 1KD1M 1Q86P 1M1KM 3CXCN 1YHQL 1QVFN 1YJWL 3I55L 5DQZA 1K8AP 3CCSL 3OW2K 1JJ2N 1YJWO 3I55O 3NKDA 1VQ9L 3CPWK 1VQOL 1VQ9O 3CCML 5DQTA 1K73P 1M90P 3CCMO 1Q86M 3CMEL 3CPWN 1S72L 1VQKL 3CC4L 3CD6L 4QDLA 3CMEO 1K9MM 2OTJL 3CC4O 4W8KA 1S72O 1VQKO 3CD6O 1NJIM 1VQ7L 2OTJO 1Q82P 1QVGK 3CC2L 4XTKA 1YHQO 1VQ6L 1VQ7O 1Q81M 1KC8M 3CCVL 3CC2O 3CCSO 1VQ6O 3CCJL 1Q7YM 1YJNL
chains in the Genus database with same CATH topology
3CCVO 1YITL 2OTLL 3G6EL 1W2BK 3CCJO 1QVGN 3OW2N 1VQOO 1YJNO 5DS4A 1N8RP 2OTLO 3G6EO 3CCUL 2QA4L 1VQ5L 3CCQL 1K8AM 1KQSK 3CCRL 1W2BN 3G71L 1KD1P 3CCUO 2QA4O 1VQ5O 1VQNL 1VQML 3CCRO 1M1KP 3G71O 4P6IC 1YI2L 1VQNO 1VQMO 2QEXL 3CC7L 1K73M 1KQSN 5DS5A 1YI2O 1M90M 5DLJA 1VQLL 2QEXO 3CC7O 3I56L 1VQPL 1VQLO 5FCLA 3I56O 1YJ9L 1YITO 1VQPO 4WJ0A 5DS6A 1VQ4L 1YJ9O 1Q82M 3CCLL 1YIJL 3CCEL 1VQ4O 1K9MP 2YZSA 3CCQO 3CCLO 1YIJO 3CCEO 1NJIP 3GODA 1N8RM 3G4SL 1Q81P 1VQ8L 1KC8P 3CXCK 1QVFK 3CMAL 4N06A 3G4SO 1Q7YP 1VQ8O 3CMAO 1JJ2K 1KD1M 1Q86P 1M1KM 3CXCN 1YHQL 1QVFN 1YJWL 3I55L 5DQZA 1K8AP 3CCSL 3OW2K 1JJ2N 1YJWO 3I55O 3NKDA 1VQ9L 3CPWK 1VQOL 1VQ9O 3CCML 5DQTA 1K73P 1M90P 3CCMO 1Q86M 3CMEL 3CPWN 1S72L 1VQKL 3CC4L 3CD6L 4QDLA 3CMEO 1K9MM 2OTJL 3CC4O 4W8KA 1S72O 1VQKO 3CD6O 1NJIM 1VQ7L 2OTJO 1Q82P 1QVGK 3CC2L 4XTKA 1YHQO 1VQ6L 1VQ7O 1Q81M 1KC8M 3CCVL 3CC2O 3CCSO 1VQ6O 3CCJL 1Q7YM 1YJNL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV O;  1YIT L;  2OTL L;  3G6E L;  1W2B K;  3CCJ O;  1QVG N;  3OW2 N;  1VQO O;  1YJN O;  1N8R P;  2OTL O;  3G6E O;  3CCU L;  2QA4 L;  1VQ5 L;  3CCQ L;  1K8A M;  1KQS K;  3CCR L;  1W2B N;  3G71 L;  1KD1 P;  3CCU O;  2QA4 O;  1VQ5 O;  1VQN L;  1VQM L;  3CCR O;  1M1K P;  3G71 O;  1YI2 L;  1VQN O;  1VQM O;  2QEX L;  3CC7 L;  1K73 M;  1KQS N;  1YI2 O;  1M90 M;  1VQL L;  2QEX O;  3CC7 O;  3I56 L;  1VQP L;  1VQL O;  3I56 O;  1YJ9 L;  1YIT O;  1VQP O;  1VQ4 L;  1YJ9 O;  1Q82 M;  3CCL L;  1YIJ L;  3CCE L;  1VQ4 O;  1K9M P;  3CCQ O;  3CCL O;  1YIJ O;  3CCE O;  1NJI P;  1N8R M;  3G4S L;  1Q81 P;  1VQ8 L;  1KC8 P;  3CXC K;  1QVF K;  3CMA L;  3G4S O;  1Q7Y P;  1VQ8 O;  3CMA O;  1JJ2 K;  1KD1 M;  1Q86 P;  1M1K M;  3CXC N;  1YHQ L;  1QVF N;  1YJW L;  3I55 L;  1K8A P;  3CCS L;  3OW2 K;  1JJ2 N;  1YJW O;  3I55 O;  1VQ9 L;  3CPW K;  1VQO L;  1VQ9 O;  3CCM L;  1K73 P;  1M90 P;  3CCM O;  1Q86 M;  3CME L;  3CPW N;  1S72 L;  1VQK L;  3CC4 L;  3CD6 L;  1K9M M;  3CME O;  2OTJ L;  3CC4 O;  1S72 O;  1VQK O;  3CD6 O;  1NJI M;  1VQ7 L;  2OTJ O;  1Q82 P;  1QVG K;  3CC2 L;  1YHQ O;  1VQ6 L;  1VQ7 O;  1Q81 M;  1KC8 M;  3CCV L;  3CC2 O;  3CCS O;  1VQ6 O;  3CCJ L;  1Q7Y M;  1YJN L; 
#chains in the Genus database with same CATH topology
 3CCV O;  1YIT L;  2OTL L;  3G6E L;  1W2B K;  3CCJ O;  1QVG N;  3OW2 N;  1VQO O;  1YJN O;  5DS4 A;  1N8R P;  2OTL O;  3G6E O;  3CCU L;  2QA4 L;  1VQ5 L;  3CCQ L;  1K8A M;  1KQS K;  3CCR L;  1W2B N;  3G71 L;  1KD1 P;  3CCU O;  2QA4 O;  1VQ5 O;  1VQN L;  1VQM L;  3CCR O;  1M1K P;  3G71 O;  4P6I C;  1YI2 L;  1VQN O;  1VQM O;  2QEX L;  3CC7 L;  1K73 M;  1KQS N;  5DS5 A;  1YI2 O;  1M90 M;  5DLJ A;  1VQL L;  2QEX O;  3CC7 O;  3I56 L;  1VQP L;  1VQL O;  5FCL A;  3I56 O;  1YJ9 L;  1YIT O;  1VQP O;  4WJ0 A;  5DS6 A;  1VQ4 L;  1YJ9 O;  1Q82 M;  3CCL L;  1YIJ L;  3CCE L;  1VQ4 O;  1K9M P;  2YZS A;  3CCQ O;  3CCL O;  1YIJ O;  3CCE O;  1NJI P;  3GOD A;  1N8R M;  3G4S L;  1Q81 P;  1VQ8 L;  1KC8 P;  3CXC K;  1QVF K;  3CMA L;  4N06 A;  3G4S O;  1Q7Y P;  1VQ8 O;  3CMA O;  1JJ2 K;  1KD1 M;  1Q86 P;  1M1K M;  3CXC N;  1YHQ L;  1QVF N;  1YJW L;  3I55 L;  5DQZ A;  1K8A P;  3CCS L;  3OW2 K;  1JJ2 N;  1YJW O;  3I55 O;  3NKD A;  1VQ9 L;  3CPW K;  1VQO L;  1VQ9 O;  3CCM L;  5DQT A;  1K73 P;  1M90 P;  3CCM O;  1Q86 M;  3CME L;  3CPW N;  1S72 L;  1VQK L;  3CC4 L;  3CD6 L;  4QDL A;  3CME O;  1K9M M;  2OTJ L;  3CC4 O;  4W8K A;  1S72 O;  1VQK O;  3CD6 O;  1NJI M;  1VQ7 L;  2OTJ O;  1Q82 P;  1QVG K;  3CC2 L;  4XTK A;  1YHQ O;  1VQ6 L;  1VQ7 O;  1Q81 M;  1KC8 M;  3CCV L;  3CC2 O;  3CCS O;  1VQ6 O;  3CCJ L;  1Q7Y M;  1YJN L; 
#chains in the Genus database with same CATH homology
 3CCV O;  1YIT L;  2OTL L;  3G6E L;  1W2B K;  3CCJ O;  1QVG N;  3OW2 N;  1VQO O;  1YJN O;  5DS4 A;  1N8R P;  2OTL O;  3G6E O;  3CCU L;  2QA4 L;  1VQ5 L;  3CCQ L;  1K8A M;  1KQS K;  3CCR L;  1W2B N;  3G71 L;  1KD1 P;  3CCU O;  2QA4 O;  1VQ5 O;  1VQN L;  1VQM L;  3CCR O;  1M1K P;  3G71 O;  4P6I C;  1YI2 L;  1VQN O;  1VQM O;  2QEX L;  3CC7 L;  1K73 M;  1KQS N;  5DS5 A;  1YI2 O;  1M90 M;  5DLJ A;  1VQL L;  2QEX O;  3CC7 O;  3I56 L;  1VQP L;  1VQL O;  5FCL A;  3I56 O;  1YJ9 L;  1YIT O;  1VQP O;  4WJ0 A;  5DS6 A;  1VQ4 L;  1YJ9 O;  1Q82 M;  3CCL L;  1YIJ L;  3CCE L;  1VQ4 O;  1K9M P;  2YZS A;  3CCQ O;  3CCL O;  1YIJ O;  3CCE O;  1NJI P;  3GOD A;  1N8R M;  3G4S L;  1Q81 P;  1VQ8 L;  1KC8 P;  3CXC K;  1QVF K;  3CMA L;  4N06 A;  3G4S O;  1Q7Y P;  1VQ8 O;  3CMA O;  1JJ2 K;  1KD1 M;  1Q86 P;  1M1K M;  3CXC N;  1YHQ L;  1QVF N;  1YJW L;  3I55 L;  5DQZ A;  1K8A P;  3CCS L;  3OW2 K;  1JJ2 N;  1YJW O;  3I55 O;  3NKD A;  1VQ9 L;  3CPW K;  1VQO L;  1VQ9 O;  3CCM L;  5DQT A;  1K73 P;  1M90 P;  3CCM O;  1Q86 M;  3CME L;  3CPW N;  1S72 L;  1VQK L;  3CC4 L;  3CD6 L;  4QDL A;  3CME O;  1K9M M;  2OTJ L;  3CC4 O;  4W8K A;  1S72 O;  1VQK O;  3CD6 O;  1NJI M;  1VQ7 L;  2OTJ O;  1Q82 P;  1QVG K;  3CC2 L;  4XTK A;  1YHQ O;  1VQ6 L;  1VQ7 O;  1Q81 M;  1KC8 M;  3CCV L;  3CC2 O;  3CCS O;  1VQ6 O;  3CCJ L;  1Q7Y M;  1YJN L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...