1VQNO

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 36
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vqnO00
1K73P 1VQKL 1VQ7O 3CPWK 1K8AP 1K9MM 1YJ9L 1YJNO 2OTLO 1VQOL 1YIJL 3G4SO 3OW2K 1VQML 2QEXO 1VQNL 3CMEL 1VQPO 3G6EO 1YJWL 1Q81M 1KD1M 2QA4O 1YHQO 3CCQL 1YI2L 1VQ8O 2OTJO 3CCVL 1JJ2N 1YITL 1M1KM 1K9MP 3I56L 1S72O 3CCLO 1KQSK 1Q82M 3I55L 3CXCK 1Q7YP 3CCUL 3CC2L 1VQ5O 3CCEL 1QVGN 3CMAL 3CD6O 1Q81P 3CC7O 1VQ6O 3G71L 3CCSO 3CC4L 1M90M 1M1KP 3CCMO 3CCQO 3CCRL 1N8RM 1KC8M 1Q82P 1VQKO 1VQ4L 1VQ7L 1W2BK 1NJIM 3CCJL 1VQLL 1YJ9O 1YJNL 1M90P 2OTLL 1VQOO 1YIJO 1JJ2K 1QVFK 1N8RP 3CPWN 3G4SL 1VQMO 1KC8P 1KD1P 1VQNO 3CMEO 2QEXL 1VQPL 1YJWO 3G6EL 2QA4L 1Q86M 1YI2O 1YHQL 1NJIP 3CCVO 1VQ8L 1YITO 2OTJL 1VQ4O 1QVGK 1VQ9L 3I56O 3OW2N 1S72L 3CCLL 3I55O 1K73M 3CCJO 1VQLO 3CCUO 3CC2O 3CCEO 1VQ5L 3CMAO 1W2BN 1Q7YM 1K8AM 3CD6L 3CC7L 1Q86P 1KQSN 3G71O 3CC4O 3CXCN 1VQ6L 3CCSL 3CCRO 3CCML 1QVFN 1VQ9O
chains in the Genus database with same CATH superfamily
1K73P 1VQKL 1VQ7O 3CPWK 1K8AP 4N06A 1K9MM 1YJ9L 1YJNO 2OTLO 1VQOL 1YIJL 3G4SO 4WJ0A 3OW2K 1VQML 2QEXO 1VQNL 3CMEL 1VQPO 3G6EO 1YJWL 1Q81M 1KD1M 2QA4O 1YHQO 3CCQL 1YI2L 1VQ8O 2OTJO 3CCVL 1JJ2N 1YITL 1M1KM 1K9MP 3I56L 1S72O 3GODA 3CCLO 1KQSK 1Q82M 3I55L 3CXCK 1Q7YP 3CCUL 3CC2L 1VQ5O 3CCEL 1QVGN 3CMAL 3CD6O 1Q81P 3CC7O 1VQ6O 3G71L 3CCSO 3CC4L 5DS5A 1M90M 1M1KP 3CCMO 3CCQO 3CCRL 1N8RM 1KC8M 2YZSA 1Q82P 3NKDA 1VQKO 1VQ4L 1VQ7L 1W2BK 1NJIM 4XTKA 3CCJL 1VQLL 1YJ9O 1YJNL 1M90P 2OTLL 1VQOO 1YIJO 1JJ2K 1QVFK 1N8RP 3CPWN 3G4SL 1VQMO 1KC8P 1KD1P 4W8KA 1VQNO 3CMEO 2QEXL 1VQPL 1YJWO 3G6EL 2QA4L 1Q86M 1YI2O 1YHQL 1NJIP 3CCVO 5DQTA 1YITO 1VQ8L 2OTJL 1VQ4O 1QVGK 1VQ9L 3I56O 4P6IC 5DS4A 3OW2N 5FCLA 1S72L 3CCLL 3I55O 5DLJA 1K73M 3CCJO 1VQLO 3CCUO 4QDLA 3CC2O 3CCEO 1VQ5L 3CMAO 5DQZA 1W2BN 1Q7YM 1K8AM 3CD6L 3CC7L 5DS6A 1Q86P 1KQSN 3G71O 3CC4O 3CXCN 1VQ6L 3CCSL 3CCRO 3CCML 1QVFN 1VQ9O
chains in the Genus database with same CATH topology
1K73P 1VQKL 1VQ7O 3CPWK 1K8AP 4N06A 1K9MM 1YJ9L 1YJNO 2OTLO 1VQOL 1YIJL 3G4SO 4WJ0A 3OW2K 1VQML 2QEXO 1VQNL 3CMEL 1VQPO 3G6EO 1YJWL 1Q81M 1KD1M 2QA4O 1YHQO 3CCQL 1YI2L 1VQ8O 2OTJO 3CCVL 1JJ2N 1YITL 1M1KM 1K9MP 3I56L 1S72O 3GODA 3CCLO 1KQSK 1Q82M 3I55L 3CXCK 1Q7YP 3CCUL 3CC2L 1VQ5O 3CCEL 1QVGN 3CMAL 3CD6O 1Q81P 3CC7O 1VQ6O 3G71L 3CCSO 3CC4L 5DS5A 1M90M 1M1KP 3CCMO 3CCQO 3CCRL 1N8RM 1KC8M 2YZSA 1Q82P 3NKDA 1VQKO 1VQ4L 1VQ7L 1W2BK 1NJIM 4XTKA 3CCJL 1VQLL 1YJ9O 1YJNL 1M90P 2OTLL 1VQOO 1YIJO 1JJ2K 1QVFK 1N8RP 3CPWN 3G4SL 1VQMO 1KC8P 1KD1P 4W8KA 1VQNO 3CMEO 2QEXL 1VQPL 1YJWO 3G6EL 2QA4L 1Q86M 1YI2O 1YHQL 1NJIP 3CCVO 5DQTA 1YITO 1VQ8L 2OTJL 1VQ4O 1QVGK 1VQ9L 3I56O 4P6IC 5DS4A 3OW2N 5FCLA 1S72L 3CCLL 3I55O 5DLJA 1K73M 3CCJO 1VQLO 3CCUO 4QDLA 3CC2O 3CCEO 1VQ5L 3CMAO 5DQZA 1W2BN 1Q7YM 1K8AM 3CD6L 3CC7L 5DS6A 1Q86P 1KQSN 3G71O 3CC4O 3CXCN 1VQ6L 3CCSL 3CCRO 3CCML 1QVFN 1VQ9O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 P;  1VQK L;  1VQ7 O;  3CPW K;  1K8A P;  1K9M M;  1YJ9 L;  1YJN O;  2OTL O;  1VQO L;  1YIJ L;  3G4S O;  3OW2 K;  1VQM L;  2QEX O;  1VQN L;  3CME L;  1VQP O;  3G6E O;  1YJW L;  1Q81 M;  1KD1 M;  2QA4 O;  1YHQ O;  3CCQ L;  1YI2 L;  1VQ8 O;  2OTJ O;  3CCV L;  1JJ2 N;  1YIT L;  1M1K M;  1K9M P;  3I56 L;  1S72 O;  3CCL O;  1KQS K;  1Q82 M;  3I55 L;  3CXC K;  1Q7Y P;  3CCU L;  3CC2 L;  1VQ5 O;  3CCE L;  1QVG N;  3CMA L;  3CD6 O;  1Q81 P;  3CC7 O;  1VQ6 O;  3G71 L;  3CCS O;  3CC4 L;  1M90 M;  1M1K P;  3CCM O;  3CCQ O;  3CCR L;  1N8R M;  1KC8 M;  1Q82 P;  1VQK O;  1VQ4 L;  1VQ7 L;  1W2B K;  1NJI M;  3CCJ L;  1VQL L;  1YJ9 O;  1YJN L;  1M90 P;  2OTL L;  1VQO O;  1YIJ O;  1JJ2 K;  1QVF K;  1N8R P;  3CPW N;  3G4S L;  1VQM O;  1KC8 P;  1KD1 P;  1VQN O;  3CME O;  2QEX L;  1VQP L;  1YJW O;  3G6E L;  2QA4 L;  1Q86 M;  1YI2 O;  1YHQ L;  1NJI P;  3CCV O;  1VQ8 L;  1YIT O;  2OTJ L;  1VQ4 O;  1QVG K;  1VQ9 L;  3I56 O;  3OW2 N;  1S72 L;  3CCL L;  3I55 O;  1K73 M;  3CCJ O;  1VQL O;  3CCU O;  3CC2 O;  3CCE O;  1VQ5 L;  3CMA O;  1W2B N;  1Q7Y M;  1K8A M;  3CD6 L;  3CC7 L;  1Q86 P;  1KQS N;  3G71 O;  3CC4 O;  3CXC N;  1VQ6 L;  3CCS L;  3CCR O;  3CCM L;  1QVF N;  1VQ9 O; 
#chains in the Genus database with same CATH topology
 1K73 P;  1VQK L;  1VQ7 O;  3CPW K;  1K8A P;  4N06 A;  1K9M M;  1YJ9 L;  1YJN O;  2OTL O;  1VQO L;  1YIJ L;  3G4S O;  4WJ0 A;  3OW2 K;  1VQM L;  2QEX O;  1VQN L;  3CME L;  1VQP O;  3G6E O;  1YJW L;  1Q81 M;  1KD1 M;  2QA4 O;  1YHQ O;  3CCQ L;  1YI2 L;  1VQ8 O;  2OTJ O;  3CCV L;  1JJ2 N;  1YIT L;  1M1K M;  1K9M P;  3I56 L;  1S72 O;  3GOD A;  3CCL O;  1KQS K;  1Q82 M;  3I55 L;  3CXC K;  1Q7Y P;  3CCU L;  3CC2 L;  1VQ5 O;  3CCE L;  1QVG N;  3CMA L;  3CD6 O;  1Q81 P;  3CC7 O;  1VQ6 O;  3G71 L;  3CCS O;  3CC4 L;  5DS5 A;  1M90 M;  1M1K P;  3CCM O;  3CCQ O;  3CCR L;  1N8R M;  1KC8 M;  2YZS A;  1Q82 P;  3NKD A;  1VQK O;  1VQ4 L;  1VQ7 L;  1W2B K;  1NJI M;  4XTK A;  3CCJ L;  1VQL L;  1YJ9 O;  1YJN L;  1M90 P;  2OTL L;  1VQO O;  1YIJ O;  1JJ2 K;  1QVF K;  1N8R P;  3CPW N;  3G4S L;  1VQM O;  1KC8 P;  1KD1 P;  4W8K A;  1VQN O;  3CME O;  2QEX L;  1VQP L;  1YJW O;  3G6E L;  2QA4 L;  1Q86 M;  1YI2 O;  1YHQ L;  1NJI P;  3CCV O;  5DQT A;  1YIT O;  1VQ8 L;  2OTJ L;  1VQ4 O;  1QVG K;  1VQ9 L;  3I56 O;  4P6I C;  5DS4 A;  3OW2 N;  5FCL A;  1S72 L;  3CCL L;  3I55 O;  5DLJ A;  1K73 M;  3CCJ O;  1VQL O;  3CCU O;  4QDL A;  3CC2 O;  3CCE O;  1VQ5 L;  3CMA O;  5DQZ A;  1W2B N;  1Q7Y M;  1K8A M;  3CD6 L;  3CC7 L;  5DS6 A;  1Q86 P;  1KQS N;  3G71 O;  3CC4 O;  3CXC N;  1VQ6 L;  3CCS L;  3CCR O;  3CCM L;  1QVF N;  1VQ9 O; 
#chains in the Genus database with same CATH homology
 1K73 P;  1VQK L;  1VQ7 O;  3CPW K;  1K8A P;  4N06 A;  1K9M M;  1YJ9 L;  1YJN O;  2OTL O;  1VQO L;  1YIJ L;  3G4S O;  4WJ0 A;  3OW2 K;  1VQM L;  2QEX O;  1VQN L;  3CME L;  1VQP O;  3G6E O;  1YJW L;  1Q81 M;  1KD1 M;  2QA4 O;  1YHQ O;  3CCQ L;  1YI2 L;  1VQ8 O;  2OTJ O;  3CCV L;  1JJ2 N;  1YIT L;  1M1K M;  1K9M P;  3I56 L;  1S72 O;  3GOD A;  3CCL O;  1KQS K;  1Q82 M;  3I55 L;  3CXC K;  1Q7Y P;  3CCU L;  3CC2 L;  1VQ5 O;  3CCE L;  1QVG N;  3CMA L;  3CD6 O;  1Q81 P;  3CC7 O;  1VQ6 O;  3G71 L;  3CCS O;  3CC4 L;  5DS5 A;  1M90 M;  1M1K P;  3CCM O;  3CCQ O;  3CCR L;  1N8R M;  1KC8 M;  2YZS A;  1Q82 P;  3NKD A;  1VQK O;  1VQ4 L;  1VQ7 L;  1W2B K;  1NJI M;  4XTK A;  3CCJ L;  1VQL L;  1YJ9 O;  1YJN L;  1M90 P;  2OTL L;  1VQO O;  1YIJ O;  1JJ2 K;  1QVF K;  1N8R P;  3CPW N;  3G4S L;  1VQM O;  1KC8 P;  1KD1 P;  4W8K A;  1VQN O;  3CME O;  2QEX L;  1VQP L;  1YJW O;  3G6E L;  2QA4 L;  1Q86 M;  1YI2 O;  1YHQ L;  1NJI P;  3CCV O;  5DQT A;  1YIT O;  1VQ8 L;  2OTJ L;  1VQ4 O;  1QVG K;  1VQ9 L;  3I56 O;  4P6I C;  5DS4 A;  3OW2 N;  5FCL A;  1S72 L;  3CCL L;  3I55 O;  5DLJ A;  1K73 M;  3CCJ O;  1VQL O;  3CCU O;  4QDL A;  3CC2 O;  3CCE O;  1VQ5 L;  3CMA O;  5DQZ A;  1W2B N;  1Q7Y M;  1K8A M;  3CD6 L;  3CC7 L;  5DS6 A;  1Q86 P;  1KQS N;  3G71 O;  3CC4 O;  3CXC N;  1VQ6 L;  3CCS L;  3CCR O;  3CCM L;  1QVF N;  1VQ9 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...