1XRBA

S-adenosylmethionine synthetase (mat, atp: l-methionine s-adenosyltransferase, e.c.2.5.1.6) in which met residues are replaced with selenomethionine residues (mse)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of S-adenosylmethionine synthetase.
pubmed doi rcsb
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
molecule tags Transferase
total genus 119
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1995-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrbA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrbA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrbA02
1XRCA 1O92A 1RG9A 4K0BA 2YWCA 1O9TA 1O90A 2DPLA 1QM4A 1O93A 3SO4A 5A1IA 1P7LA 2OBVA 3IMLA 4KTTA 3UOWA 5A1GA 4L2ZA 3S82A 4L7IA 1XRAA 4HPVA 1GPMA 4KTVA 3TDEA 3A4IA 4LE5A 4WS9A 4ODJA 1MXAA 5T8TA 2YWBA 1MXBA 3RV2A 4NDNA 1MXCA 2P02A 4L4QA 5T8SA 5H9UA 5A19A 1FUGA 1XRBA 3TQIA
chains in the Genus database with same CATH superfamily
3LGXA 4G37A 2D28C 2MM9A 5GTDA 2VZEA 4DR4C 4DR6C 4LF6C 4L2ZA 4RVNA 1XRAA 4IR7A 2QVXX 2Z51A 3KXWA 5LCIA 4WV3A 2QVYX 2KZ0A 1J5EC 5KYTA 1PG3A 5T8TA 4TPSB 4OYCA 2CY1A 3FCCA 2E7GA 1LCIA 4LFBC 1K0RA 2OO4A 1O9TA 2VQEC 1QM4A 1T5HX 4ZLPA 5BUQA 4AQYC 4MH4A 5AE2A 1XMQC 3A4IA 3IPLA 4FUTA 3R44A 4FUQA 4L4QA 2EGTA 3UX3A 2PN2A 2HJGA 4BCAA 3PESA 1PG4A 2ZZMA 3T1YC 4OXIA 2F4VC 3PBKA 2P2JA 2DYJA 3ETCA 4LE5A 1USPB 4WS9A 4LF5C 4LF4C 3CW8X 2YWBA 4YHHC 2M5HA 3LUSA 4DCTA 5LMNC 5A19A 4ZJZA 1N33C 4LFCC 1I94C 1NY8A 4PZPA 3IEVA 4JI1C 3PROC 1MD9A 1JOSA 3R9XA 4JI8C 2ZZNA 1MKYA 3S82A 4IZ6A 3UEBA 4DR5C 4BC7A 2D1SA 5JRHA 1HR0C 1V60A 1XHJA 3G7SA 1N2FA 3UX2A 5T8SA 4JI4C 3GPCA 2CU6A 3OTOC 1ZB8A 4OX9C 1UWDA 4K0BA 5AE1A 2OPLB 2OBVA 3IMLA 2HHHC 5BSMA 4GKKC 2E8CA 2WD9A 3DAYA 2D7VA 2V7BA 4EATA 2KDNA 2UU9C 1PU1A 4R1LA 1MDFA 1QWIA 1V25A 4L7IA 3TQIA 2P2FA 2YCBA 2JNVA 1T5DX 2Y4OA 1O93A 2QL8A 1RY2A 5IWAC 3H2TA 3NI2A 4RM3A 5BSVA 3AF5A 5LMUC 4DV4C 2UXCC 3T1HC 3B7WA 3VNSA 3DHVA 2D1QA 4NOZA 1N36C 2DPLA 4D4GA 3UOWA 2P2BA 4BC9A 5AE3A 3LAXA 1LQLA 4DG9A 4GXQA 4ODJA 1P4EC 5K8FA 4LF7C 4PUHA 1N34C 4R0MA 1NYEA 2MMAB 4XX2A 4DUZC 2E8FA 3VNRA 1HNXC 1XNQC 1AMUA 3C5EA 3CQ2A 5CZVA 3GR1A 5A1IA 1WCJA 4X66C 4HPVA 4KHPC 1FJGC 5BUSA 1UKKA 4DV0C 4DUYC 3O2EA 1MXBA 2Y4NA 4G36A 5K85A 1ZB9A 1IBLC 3A9VA 3CJEA 4JM1A 4JV5C 4B3SC 1HNWC 4X64C 4BBYA 4D57A 4DR2C 5E7QA 2P2QA 3RG2A 3A9UA 1XNRC 1M6XC 2UUBC 3EQ6A 5IFIA 3JAMD 4RMNA 4JI2C 5A2QD 3RV2A 2AYAA 5H9UA 4JI6C 1FUGA 5BSRA 4D56A 4K0KC 2YWCA 3AY0A 3LNVA 1P7LA 1MDBA 4FTFA 2DHMA 2UXDC 5BR8C 4G1IA 2ATWA 4U5YD 4DV6C 4PUIA 4JI0C 2P02A 3FCEA 2KZFA 1WF3A 1XRBA 4LF8C 1VLAA 1EGAA 5KYVA 4RLFA 2MCQA 3AF6A 5BSTA 3SO4A 2P20A 4B3TC 1USPA 1PA4A 4KTVA 5IT9D 1VEHA 4JI7C 2XR1A 5CZXA 2E5LC 3J80D 5KEIA 2VQFC 4DR3C 4JYAC 1IBMC 1HNZC 4X65C 1O92A 3GR0A 3I07A 1RG9A 4MTNA 4B3MC 4BSZA 1IB8A 4DV1C 2PT7G 3DLPX 1KKGA 1GPMA 3ETOA 4GXRA 3TDEA 2D1TA 4DCUA 2QW0X 4PROC 4GKJC 2E8EA 3K6RA 4DR1C 4NDNA 3A26A 1XS3A 2D27A 4DV7C 4X62C 1XRCA 1HH2P 2OPLA 4DCVA 4JI5C 5FLXD 3CW9A 2Y27A 5A1GA 2PROA 4NXMC 2UXBC 3J81D 3NYQA 2QVZX 1IBKC 3TUFA 1WH9A 3VNQA 3A25A 1ULTA 2YX1A 2ASBA 1YJ7A 3NPDA 5BSUA 2ONFA 1P4EA 1XMOC 1FLOA 2ZM6C 2CXCA 4DG8A 1MXAA 3L8CA 4DCSA 2NCLA 1TH5A 3N54B 1V26A 3UZ0A 1BA3A 2D1RA 2JMPA 4LF9C 5ADZA 4GS5A 3E7XA 4I9FA 4LFAC 3R9WA 3TR3A 3IEUA 4DV2C 4R1MA 4PUGA 4D4IA 3I08A 2BH1X 5BSWA 3NYRA 4DV5C 4JI3C 4DV3C 3N2QA 3CQ3A 3L95X 4YY3C 4B3RC 1ML8A 3GKUA 2WP0C 2UUAC 3EERA 2P2MA 3LNOA 2UUCC 4DR7C 2VSQA 1O90A 1M6XA 3E7WA 4RM2A 1N32C 3CQ1A 4ISBA 2E0GA 5BURA 4PHTA 4NXNC 4RVOA 2BJOA 4RLQA 1MXCA 5DV9A 4I9GA 1L2FA 2M5OA 4KTTA
chains in the Genus database with same CATH topology
3LGXA 4G37A 2D28C 5GTDA 2VZEA 4DR4C 4DR6C 4LF6C 4L2ZA 4RVNA 1XRAA 4IR7A 2QVXX 3KXWA 4WV3A 2QVYX 1J5EC 5KYTA 1PG3A 5T8TA 4TPSB 4OYCA 2CY1A 3FCCA 2E7GA 1LCIA 4LFBC 1K0RA 2OO4A 1O9TA 2VQEC 1QM4A 1T5HX 4ZLPA 5BUQA 4AQYC 4MH4A 5AE2A 1XMQC 3A4IA 3IPLA 4FUTA 3R44A 4FUQA 4L4QA 2EGTA 2PN2A 2HJGA 4BCAA 3PESA 1PG4A 3T1YC 4OXIA 2F4VC 3PBKA 2P2JA 2DYJA 3ETCA 4LE5A 1USPB 4WS9A 4LF5C 4LF4C 3CW8X 2YWBA 4YHHC 4DCTA 3LUSA 5LMNC 5A19A 4ZJZA 1N33C 4LFCC 1I94C 4PZPA 3IEVA 4JI1C 3PROC 1MD9A 1JOSA 3R9XA 4JI8C 1MKYA 3S82A 4IZ6A 4DR5C 4BC7A 2D1SA 5JRHA 1HR0C 3G7SA 1N2FA 5T8SA 4JI4C 3GPCA 3OTOC 1ZB8A 4OX9C 4K0BA 5AE1A 2OPLB 2OBVA 3IMLA 2HHHC 5BSMA 4GKKC 2E8CA 2WD9A 3DAYA 2D7VA 2V7BA 4EATA 2UU9C 4R1LA 1MDFA 1QWIA 1V25A 4L7IA 3TQIA 2P2FA 2YCBA 1T5DX 2Y4OA 1O93A 2QL8A 1RY2A 5IWAC 3H2TA 3NI2A 4RM3A 5BSVA 3AF5A 5LMUC 4DV4C 2UXCC 3T1HC 3B7WA 3VNSA 3DHVA 2D1QA 4NOZA 1N36C 2DPLA 4D4GA 3UOWA 2P2BA 4BC9A 5AE3A 3LAXA 1LQLA 4DG9A 4GXQA 4ODJA 5K8FA 4LF7C 1N34C 4R0MA 1NYEA 4XX2A 4DUZC 2E8FA 3VNRA 1HNXC 1XNQC 1AMUA 3C5EA 5CZVA 3GR1A 5A1IA 4X66C 4HPVA 4KHPC 1FJGC 5BUSA 1UKKA 4DV0C 4DUYC 1MXBA 2Y4NA 4G36A 5K85A 1ZB9A 1IBLC 3A9VA 3CJEA 4JM1A 4JV5C 4B3SC 1HNWC 4X64C 4BBYA 4D57A 4DR2C 5E7QA 2P2QA 3RG2A 3A9UA 1XNRC 2UUBC 4JI2C 3EQ6A 5IFIA 3JAMD 4RMNA 5A2QD 3RV2A 2AYAA 5H9UA 4JI6C 1FUGA 5BSRA 4D56A 4K0KC 2YWCA 3LNVA 1P7LA 1MDBA 4FTFA 2UXDC 5BR8C 4G1IA 2ATWA 4U5YD 4DV6C 4JI0C 2P02A 3FCEA 2KZFA 1WF3A 1XRBA 4LF8C 1VLAA 1EGAA 5KYVA 4RLFA 3AF6A 5BSTA 3SO4A 2P20A 4B3TC 1USPA 1PA4A 4KTVA 5IT9D 4JI7C 2XR1A 5CZXA 2E5LC 3J80D 5KEIA 2VQFC 4DR3C 4JYAC 1IBMC 1HNZC 4X65C 1O92A 3GR0A 3I07A 1RG9A 4MTNA 4B3MC 4BSZA 4DV1C 2PT7G 3DLPX 1KKGA 1GPMA 3ETOA 4GXRA 3TDEA 2D1TA 4DCUA 2QW0X 4PROC 4GKJC 2E8EA 4DR1C 4NDNA 2D27A 4DV7C 4X62C 1XRCA 1HH2P 2OPLA 4DCVA 4JI5C 5FLXD 3CW9A 2Y27A 5A1GA 2PROA 4NXMC 2UXBC 3J81D 3NYQA 2QVZX 1IBKC 3TUFA 1WH9A 3VNQA 1ULTA 2ASBA 1YJ7A 3NPDA 5BSUA 2ONFA 1XMOC 2ZM6C 2CXCA 4DG8A 1MXAA 3L8CA 4DCSA 3N54B 1V26A 3UZ0A 1BA3A 2D1RA 2JMPA 4LF9C 5ADZA 4GS5A 3E7XA 4I9FA 4LFAC 3R9WA 3IEUA 4DV2C 4R1MA 4D4IA 3I08A 2BH1X 5BSWA 3NYRA 4DV5C 4JI3C 4DV3C 3N2QA 3L95X 4YY3C 4B3RC 1ML8A 3GKUA 2WP0C 2UUAC 3EERA 2P2MA 2UUCC 4DR7C 2VSQA 1O90A 3E7WA 4RM2A 1N32C 4ISBA 2E0GA 5BURA 4PHTA 4NXNC 4RVOA 2BJOA 4RLQA 1MXCA 5DV9A 4I9GA 1L2FA 4KTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRC A;  1O92 A;  1RG9 A;  4K0B A;  2YWC A;  1O9T A;  1O90 A;  2DPL A;  1QM4 A;  1O93 A;  3SO4 A;  5A1I A;  1P7L A;  2OBV A;  3IML A;  4KTT A;  3UOW A;  5A1G A;  4L2Z A;  3S82 A;  4L7I A;  1XRA A;  4HPV A;  1GPM A;  4KTV A;  3TDE A;  3A4I A;  4LE5 A;  4WS9 A;  4ODJ A;  1MXA A;  5T8T A;  2YWB A;  1MXB A;  3RV2 A;  4NDN A;  1MXC A;  2P02 A;  4L4Q A;  5T8S A;  5H9U A;  5A19 A;  1FUG A;  1XRB A;  3TQI A; 
#chains in the Genus database with same CATH topology
 3LGX A;  4G37 A;  2D28 C;  2MM9 A;  5GTD A;  2VZE A;  4DR4 C;  4DR6 C;  4LF6 C;  4L2Z A;  4RVN A;  1XRA A;  4IR7 A;  2QVX X;  2Z51 A;  3KXW A;  5LCI A;  4WV3 A;  2QVY X;  2KZ0 A;  1J5E C;  5KYT A;  1PG3 A;  5T8T A;  4TPS B;  4OYC A;  2CY1 A;  3FCC A;  2E7G A;  1LCI A;  4LFB C;  1K0R A;  2OO4 A;  1O9T A;  2VQE C;  1QM4 A;  1T5H X;  4ZLP A;  5BUQ A;  4AQY C;  4MH4 A;  5AE2 A;  1XMQ C;  3A4I A;  3IPL A;  4FUT A;  3R44 A;  4FUQ A;  4L4Q A;  2EGT A;  3UX3 A;  2PN2 A;  2HJG A;  4BCA A;  3PES A;  1PG4 A;  2ZZM A;  3T1Y C;  4OXI A;  2F4V C;  3PBK A;  2P2J A;  2DYJ A;  3ETC A;  4LE5 A;  1USP B;  4WS9 A;  4LF5 C;  4LF4 C;  3CW8 X;  2YWB A;  4YHH C;  2M5H A;  3LUS A;  4DCT A;  5LMN C;  5A19 A;  4ZJZ A;  1N33 C;  4LFC C;  1I94 C;  1NY8 A;  4PZP A;  3IEV A;  4JI1 C;  3PRO C;  1MD9 A;  1JOS A;  3R9X A;  4JI8 C;  2ZZN A;  1MKY A;  3S82 A;  4IZ6 A;  3UEB A;  4DR5 C;  4BC7 A;  2D1S A;  5JRH A;  1HR0 C;  1V60 A;  1XHJ A;  3G7S A;  1N2F A;  3UX2 A;  5T8S A;  4JI4 C;  3GPC A;  2CU6 A;  3OTO C;  1ZB8 A;  4OX9 C;  1UWD A;  4K0B A;  5AE1 A;  2OPL B;  2OBV A;  3IML A;  2HHH C;  5BSM A;  4GKK C;  2E8C A;  2WD9 A;  3DAY A;  2D7V A;  2V7B A;  4EAT A;  2KDN A;  2UU9 C;  1PU1 A;  4R1L A;  1MDF A;  1QWI A;  1V25 A;  4L7I A;  3TQI A;  2P2F A;  2YCB A;  2JNV A;  1T5D X;  2Y4O A;  1O93 A;  2QL8 A;  1RY2 A;  5IWA C;  3H2T A;  3NI2 A;  4RM3 A;  5BSV A;  3AF5 A;  5LMU C;  4DV4 C;  2UXC C;  3T1H C;  3B7W A;  3VNS A;  3DHV A;  2D1Q A;  4NOZ A;  1N36 C;  2DPL A;  4D4G A;  3UOW A;  2P2B A;  4BC9 A;  5AE3 A;  3LAX A;  1LQL A;  4DG9 A;  4GXQ A;  4ODJ A;  1P4E C;  5K8F A;  4LF7 C;  4PUH A;  1N34 C;  4R0M A;  1NYE A;  2MMA B;  4XX2 A;  4DUZ C;  2E8F A;  3VNR A;  1HNX C;  1XNQ C;  1AMU A;  3C5E A;  3CQ2 A;  5CZV A;  3GR1 A;  5A1I A;  1WCJ A;  4X66 C;  4HPV A;  4KHP C;  1FJG C;  5BUS A;  1UKK A;  4DV0 C;  4DUY C;  3O2E A;  1MXB A;  2Y4N A;  4G36 A;  5K85 A;  1ZB9 A;  1IBL C;  3A9V A;  3CJE A;  4JM1 A;  4JV5 C;  4B3S C;  1HNW C;  4X64 C;  4BBY A;  4D57 A;  4DR2 C;  5E7Q A;  2P2Q A;  3RG2 A;  3A9U A;  1XNR C;  1M6X C;  2UUB C;  3EQ6 A;  5IFI A;  3JAM D;  4RMN A;  4JI2 C;  5A2Q D;  3RV2 A;  2AYA A;  5H9U A;  4JI6 C;  1FUG A;  5BSR A;  4D56 A;  4K0K C;  2YWC A;  3AY0 A;  3LNV A;  1P7L A;  1MDB A;  4FTF A;  2DHM A;  2UXD C;  5BR8 C;  4G1I A;  2ATW A;  4U5Y D;  4DV6 C;  4PUI A;  4JI0 C;  2P02 A;  3FCE A;  2KZF A;  1WF3 A;  1XRB A;  4LF8 C;  1VLA A;  1EGA A;  5KYV A;  4RLF A;  2MCQ A;  3AF6 A;  5BST A;  3SO4 A;  2P20 A;  4B3T C;  1USP A;  1PA4 A;  4KTV A;  5IT9 D;  1VEH A;  4JI7 C;  2XR1 A;  5CZX A;  2E5L C;  3J80 D;  5KEI A;  2VQF C;  4DR3 C;  4JYA C;  1IBM C;  1HNZ C;  4X65 C;  1O92 A;  3GR0 A;  3I07 A;  1RG9 A;  4MTN A;  4B3M C;  4BSZ A;  1IB8 A;  4DV1 C;  2PT7 G;  3DLP X;  1KKG A;  1GPM A;  3ETO A;  4GXR A;  3TDE A;  2D1T A;  4DCU A;  2QW0 X;  4PRO C;  4GKJ C;  2E8E A;  3K6R A;  4DR1 C;  4NDN A;  3A26 A;  1XS3 A;  2D27 A;  4DV7 C;  4X62 C;  1XRC A;  1HH2 P;  2OPL A;  4DCV A;  4JI5 C;  5FLX D;  3CW9 A;  2Y27 A;  5A1G A;  2PRO A;  4NXM C;  2UXB C;  3J81 D;  3NYQ A;  2QVZ X;  1IBK C;  3TUF A;  1WH9 A;  3VNQ A;  3A25 A;  1ULT A;  2YX1 A;  2ASB A;  1YJ7 A;  3NPD A;  5BSU A;  2ONF A;  1P4E A;  1XMO C;  1FLO A;  2ZM6 C;  2CXC A;  4DG8 A;  1MXA A;  3L8C A;  4DCS A;  2NCL A;  1TH5 A;  3N54 B;  1V26 A;  3UZ0 A;  1BA3 A;  2D1R A;  2JMP A;  4LF9 C;  5ADZ A;  4GS5 A;  3E7X A;  4I9F A;  4LFA C;  3R9W A;  3TR3 A;  3IEU A;  4DV2 C;  4R1M A;  4PUG A;  4D4I A;  3I08 A;  2BH1 X;  5BSW A;  3NYR A;  4DV5 C;  4JI3 C;  4DV3 C;  3N2Q A;  3CQ3 A;  3L95 X;  4YY3 C;  4B3R C;  1ML8 A;  3GKU A;  2WP0 C;  2UUA C;  3EER A;  2P2M A;  3LNO A;  2UUC C;  4DR7 C;  2VSQ A;  1O90 A;  1M6X A;  3E7W A;  4RM2 A;  1N32 C;  3CQ1 A;  4ISB A;  2E0G A;  5BUR A;  4PHT A;  4NXN C;  4RVO A;  2BJO A;  4RLQ A;  1MXC A;  5DV9 A;  4I9G A;  1L2F A;  2M5O A;  4KTT A; 
#chains in the Genus database with same CATH homology
 3LGX A;  4G37 A;  2D28 C;  5GTD A;  2VZE A;  4DR4 C;  4DR6 C;  4LF6 C;  4L2Z A;  4RVN A;  1XRA A;  4IR7 A;  2QVX X;  3KXW A;  4WV3 A;  2QVY X;  1J5E C;  5KYT A;  1PG3 A;  5T8T A;  4TPS B;  4OYC A;  2CY1 A;  3FCC A;  2E7G A;  1LCI A;  4LFB C;  1K0R A;  2OO4 A;  1O9T A;  2VQE C;  1QM4 A;  1T5H X;  4ZLP A;  5BUQ A;  4AQY C;  4MH4 A;  5AE2 A;  1XMQ C;  3A4I A;  3IPL A;  4FUT A;  3R44 A;  4FUQ A;  4L4Q A;  2EGT A;  2PN2 A;  2HJG A;  4BCA A;  3PES A;  1PG4 A;  3T1Y C;  4OXI A;  2F4V C;  3PBK A;  2P2J A;  2DYJ A;  3ETC A;  4LE5 A;  1USP B;  4WS9 A;  4LF5 C;  4LF4 C;  3CW8 X;  2YWB A;  4YHH C;  4DCT A;  3LUS A;  5LMN C;  5A19 A;  4ZJZ A;  1N33 C;  4LFC C;  1I94 C;  4PZP A;  3IEV A;  4JI1 C;  3PRO C;  1MD9 A;  1JOS A;  3R9X A;  4JI8 C;  1MKY A;  3S82 A;  4IZ6 A;  4DR5 C;  4BC7 A;  2D1S A;  5JRH A;  1HR0 C;  3G7S A;  1N2F A;  5T8S A;  4JI4 C;  3GPC A;  3OTO C;  1ZB8 A;  4OX9 C;  4K0B A;  5AE1 A;  2OPL B;  2OBV A;  3IML A;  2HHH C;  5BSM A;  4GKK C;  2E8C A;  2WD9 A;  3DAY A;  2D7V A;  2V7B A;  4EAT A;  2UU9 C;  4R1L A;  1MDF A;  1QWI A;  1V25 A;  4L7I A;  3TQI A;  2P2F A;  2YCB A;  1T5D X;  2Y4O A;  1O93 A;  2QL8 A;  1RY2 A;  5IWA C;  3H2T A;  3NI2 A;  4RM3 A;  5BSV A;  3AF5 A;  5LMU C;  4DV4 C;  2UXC C;  3T1H C;  3B7W A;  3VNS A;  3DHV A;  2D1Q A;  4NOZ A;  1N36 C;  2DPL A;  4D4G A;  3UOW A;  2P2B A;  4BC9 A;  5AE3 A;  3LAX A;  1LQL A;  4DG9 A;  4GXQ A;  4ODJ A;  5K8F A;  4LF7 C;  1N34 C;  4R0M A;  1NYE A;  4XX2 A;  4DUZ C;  2E8F A;  3VNR A;  1HNX C;  1XNQ C;  1AMU A;  3C5E A;  5CZV A;  3GR1 A;  5A1I A;  4X66 C;  4HPV A;  4KHP C;  1FJG C;  5BUS A;  1UKK A;  4DV0 C;  4DUY C;  1MXB A;  2Y4N A;  4G36 A;  5K85 A;  1ZB9 A;  1IBL C;  3A9V A;  3CJE A;  4JM1 A;  4JV5 C;  4B3S C;  1HNW C;  4X64 C;  4BBY A;  4D57 A;  4DR2 C;  5E7Q A;  2P2Q A;  3RG2 A;  3A9U A;  1XNR C;  2UUB C;  4JI2 C;  3EQ6 A;  5IFI A;  3JAM D;  4RMN A;  5A2Q D;  3RV2 A;  2AYA A;  5H9U A;  4JI6 C;  1FUG A;  5BSR A;  4D56 A;  4K0K C;  2YWC A;  3LNV A;  1P7L A;  1MDB A;  4FTF A;  2UXD C;  5BR8 C;  4G1I A;  2ATW A;  4U5Y D;  4DV6 C;  4JI0 C;  2P02 A;  3FCE A;  2KZF A;  1WF3 A;  1XRB A;  4LF8 C;  1VLA A;  1EGA A;  5KYV A;  4RLF A;  3AF6 A;  5BST A;  3SO4 A;  2P20 A;  4B3T C;  1USP A;  1PA4 A;  4KTV A;  5IT9 D;  4JI7 C;  2XR1 A;  5CZX A;  2E5L C;  3J80 D;  5KEI A;  2VQF C;  4DR3 C;  4JYA C;  1IBM C;  1HNZ C;  4X65 C;  1O92 A;  3GR0 A;  3I07 A;  1RG9 A;  4MTN A;  4B3M C;  4BSZ A;  4DV1 C;  2PT7 G;  3DLP X;  1KKG A;  1GPM A;  3ETO A;  4GXR A;  3TDE A;  2D1T A;  4DCU A;  2QW0 X;  4PRO C;  4GKJ C;  2E8E A;  4DR1 C;  4NDN A;  2D27 A;  4DV7 C;  4X62 C;  1XRC A;  1HH2 P;  2OPL A;  4DCV A;  4JI5 C;  5FLX D;  3CW9 A;  2Y27 A;  5A1G A;  2PRO A;  4NXM C;  2UXB C;  3J81 D;  3NYQ A;  2QVZ X;  1IBK C;  3TUF A;  1WH9 A;  3VNQ A;  1ULT A;  2ASB A;  1YJ7 A;  3NPD A;  5BSU A;  2ONF A;  1XMO C;  2ZM6 C;  2CXC A;  4DG8 A;  1MXA A;  3L8C A;  4DCS A;  3N54 B;  1V26 A;  3UZ0 A;  1BA3 A;  2D1R A;  2JMP A;  4LF9 C;  5ADZ A;  4GS5 A;  3E7X A;  4I9F A;  4LFA C;  3R9W A;  3IEU A;  4DV2 C;  4R1M A;  4D4I A;  3I08 A;  2BH1 X;  5BSW A;  3NYR A;  4DV5 C;  4JI3 C;  4DV3 C;  3N2Q A;  3L95 X;  4YY3 C;  4B3R C;  1ML8 A;  3GKU A;  2WP0 C;  2UUA C;  3EER A;  2P2M A;  2UUC C;  4DR7 C;  2VSQ A;  1O90 A;  3E7W A;  4RM2 A;  1N32 C;  4ISB A;  2E0G A;  5BUR A;  4PHT A;  4NXN C;  4RVO A;  2BJO A;  4RLQ A;  1MXC A;  5DV9 A;  4I9G A;  1L2F A;  4KTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...