1Y56B

Crystal structure of l-proline dehydrogenase from p.horikoshii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
374
structure length
374
Chain Sequence
b'LPEKSEIVVIGGGIVGVTIAHELAKRGEEVTVIEKRFIGSGSTFRCGTGIRQQFNDEANVRVMKRSVELWKKYSEEYGFSFKQTGYLFLLYDDEEVKTFKRNIEIQNKFGVPTKLITPEEAKEIVPLLDISEVIAASWNPTDGKADPFEATTAFAVKAKEYGAKLLEYTEVKGFLIENNEIKGVKTNKGIIKTGIVVNATNAWANLINAMAGIKTKIPIEPYKHQAVITQPIKRGTINPMVISFKYGHAYLTQTFHGGIIGGIGYEIGPTYDLTPTYEFLREVSYYFTKIIPALKNLLILRTWAGYYAKTPDSNPAIGRIEELNDYYIAAGFSGHGFMMAPAVGEMVAELITKGKTKLPVEWYDPYRFERGELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1363
publication title Crystal structure of a novel FAD-, FMN-, and ATP-containing L-proline dehydrogenase complex from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Oxidoreductase
total genus 126
structure length 374
sequence length 374
ec nomenclature ec 1.5.99.8: Transferred entry: 1.5.5.2.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 1y56B02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1y56B01
4BURA 2QAEA 1E6EA 4H2RA 2IVEA 3F8PA 5C2TA 3P4QA 2XFPA 2AQJA 4YTNA 1N4VA 1FCDA 2JBVA 2GMJA 3KLJA 3CN8A 3QFAA 4GRTA 3UTEA 3DJJA 4YJFA 2CVJA 1K0LA 3I6DA 4H4UA 4BV6A 3ALMA 4DNAA 1DOBA 1DOEA 4H4RA 3ICSA 4J2WA 3DJEA 4YJHB 2C70A 4GDEA 3AYIA 2XLRA 2C73A 3K7TA 3SM8A 3BNUA 4JQ9A 4PAAA 3AD7B 2B7RA 4C74A 1LPFA 1XPQA 1AN9A 3K30A 3SGLA 4CNJA 1PS9A 3GSIA 4Z26A 3AD9B 1M6IA 3QVRA 1H84A 2R45A 1XHCA 2V3AA 5J7XA 1BGNA 1FL2A 4NTEA 1VE9A 1GTHA 1TYTA 3H8IA 3NRNA 4AOSA 1CJ4A 1FOHA 4B66A 5JCIA 2C66A 3AD8B 2RABA 2BYBA 4P9SA 3G3EA 1DOCA 1KDGA 3F8DA 3FMWA 1ZMDA 1ZP0A 2QA2A 4KX6A 2R0PA 3ISHA 4APNA 2C7GA 3D8XA 1CF3A 2TMDA 4DGKA 2YLSA 4CCQA 2E48A 1S3EA 1DJNA 2NPXA 3DGHA 4BJYA 3URHA 1IUXA 4A7AA 2BK5A 2WOVA 2GR2A 1LTXR 4H4WA 3NHOX 1GALA 2FJDA 1K0IA 4BK2A 3AE3A 2WESA 4YTPA 1D4CA 3AE2A 4H2QA 1TDNA 1Z6LA 4IA6A 1IUTA 2B9WA 4LA1A 2R0GA 4LIIA 4U8JA 1NHSA 4D03A 5KVHA 3NYCA 3G5SA 3UOYA 1D7LA 1CC2A 3CGEA 2AR8A 1D4DA 2R4EA 1JEHA 4YT0A 1AOGA 2YAUA 1GXFA 1PXBA 1B5QA 3KD9A 1YKJA 3CUKA 1IUUA 1CC4A 2OLOA 2GQFA 3AYJA 3UTFA 3DK8A 2OLNA 4QFDA 3FIMB 4K5RA 3CNTA 2C75A 4CNKA 2J3NA 1DNCA 4YXDA 2H88A 1JOAA 2WQYA 2GAGB 1KSSA 2ZBWA 4M52A 3VRBA 5FS7A 4YSZA 3PO7A 3B6DA 2YG3A 2WS3A 2DKIA 4C3YA 1S3BA 3ZNOA 4B67A 1S2YA 4CY8A 1F8RA 2YG4A 3II4A 3RNMA 1H7WA 1GETA 1GEUA 3WGTA 4OPLA 3DH9A 4UDPA 4IA5A 2RGJA 3UCLA 1BKWA 2VZ2A 2EQ6A 4EM3A 2GR1A 3REDA 3DJDA 1TDKA 1IUSA 3D1CA 3GYJA 1MOKA 1D4EA 2PYXA 3DA1A 4DSGA 3GD3A 1GREA 2QCUA 1GERA 5FS8A 4B63A 3ATQA 2B9XA 4WCTA 2JK6A 4BK1A 2BC0A 3Q6JA 1YQ4A 2YLXA 1LV0A 4NTCA 2YM2A 4H4VA 3COXA 3S61A 1ZKQA 5EBKA 2GB0A 2CFYA 2H89A 3W4IA 2OA1A 2Z5XA 3AE1A 3H8LA 4H50A 2RGOA 3UP4A 1VQWA 1CJ3A 2WEUA 4QFCA 1GT8A 1Q9IA 2VVMA 1CJ2A 3FPZA 2BA9A 3NTAA 1NHQA 3CPHG 4C3XA 1JRZA 2Y6RA 4EQRA 1PBBA 1PJ6A 1CJCA 3W4KA 1GRHA 1MXTA 1FEAA 2WP9A 2YG5A 3IC9A 4JY2A 4H4PA 4BJZA 4U8PA 3K7MX 1KF6A 4YKFA 4EQXA 2E1MA 3LZWA 1K0JA 2VVLG 4TM3A 2A8XA 4U2SA 5U1OA 3NNEA 4ECHA 3R9UA 4AP3A 1GTEA 3G5QA 1GPEA 2F5ZA 2ZZ0A 2BS4A 1ZX9A 2A87A 3UOVA 3P4PA 5C3JA 5FS6A 2XVEA 1KNRA 4K5SA 3AEEA 3CNSA 2WDQA 3NYFA 2WHDA 4CBQA 3F8RA 2XLSA 1F8WA 2YR6A 4A99A 5EB4A 1MO9A 1N1PA 3P4RA 1GRGA 2C65A 5CQFA 2WPEA 2YLRA 1PBEA 5JCLA 1KFYA 1EL8A 1NHPA 1KIFA 2WP5A 3IWAA 5U25A 4EMWA 3CGCA 4GCMA 1IJHA 2XLTA 4A9WA 5TR3A 3VRDB 3OZ2A 4ZN0A 2TPRA 3AEGA 1BF3A 1L9EA 1PBDA 3ICRA 4A6NA 2R9ZA 1M64A 1BWCA 2OAMA 3HZLA 1H6VA 3SFEA 1PBFA 2X99A 2YLZA 5DBJA 1V59A 1PXCA 1BGJA 1GRFA 3ZYXA 4H4QA 2V3BA 2GF3A 3AE9A 3BI5A 1Y56B 3V76A 4RSLA 4YTMA 1IUVA 4XWZA 2ACZA 4YJHA 5ER0A 2R0CA 2YVFA 3I3LA 3UTHA 4NEWA 2NVKX 2XLPA 3QSEA 3GDNA 3NG7X 1NG4A 3KPFA 3JSKA 2C67A 2WETA 4J36A 2GV8A 3NTDA 2BXSA 2XVIA 4EM4A 3RP7A 2FBWA 4OCGA 4FK1A 4Z2UA 5HXIA 2V5ZA 1E7PA 1JNRA 4H4ZA 3M12A 4AOXA 1ZOYA 2BS3A 2XVJA 5HHFA 3UKLA 4CY6A 1E39A 2BK3A 2XFUA 3ALLA 5JCMA 4Y4NA 1COYA 3LZXA 3PS9A 5IPYA 3AXBA 1GRTA 1OJTA 2WP6A 2JB2A 4H4XA 1O5WA 2EQ8A 2VRMA 2BS2A 1OJCA 1NHRA 3S5WA 4A65A 3QSSA 1B8SA 2GR0A 2XDOA 1H86A 1Y0PA 2EQ7A 2WU2A 5BRTA 2WDRA 5HY5A 3PVCA 1DJQA 2V6OA 5KOXA 5KXJA 2Q0KA 1L9DA 1C0LA 1L0VA 3ZNQA 3AE6A 1XANA 2VQBA 3V3OA 1PDHA 3UOXA 4ZCCA 5IQ4A 2ARDA 2WPCA 3AEDA 5BULA 5GRTA 2APGA 2V61A 3V3NA 1D7YA 1FECA 4GR1A 2WPFA 1PHHA 3EAOA 1H82A 4J34A 4KPRA 4N9XA 3AEFA 3NN6X 4REKA 2WDVA 4K8DA 2GAHB 1SEZA 4U8IA 4B69A 1QLBA 3CNDA 4RG3A 4TM1A 2GQWA 3ITJA 3BNMA 1B4VA 3SFDA 3UKHA 4AT2A 2XYOA 2B76A 5JCNA 1GV4A 3EF6A 1RYIA 3NK0X 3M13A 2Z5YA 1TDOA 2ZZCA 5IQ1A 5BUKA 3BHKA 3AEAA 1EVIA 4H2PA 1CHUA 4YJGB 2IIDA 3VRAA 3C96A 1ZK7A 4CCRA 1TRBA 5FMHA 4OVIA 3ZNPA 1QO8A 1CBOA 3IHGA 5EB5A 2E82A 2BC1A 2C72A 1H7XA 2JKCA 3KVEA 4K22A 4PABA 2GRTA 4U8OA 1ONFA 4YKGA 3LXDA 4OPDA 3EANA 2YLTA 1FEBA 4H7UA 4XXGA 2WOIA 3UKAA 1EL9A 4B68A 3M0OA 3AYLA 4ZCDA 1CL0A 4YWOA 3CGBA 5CKUA 3BI4A 1NPXA 4GDPA 2RGHA 4GF7A 3LOVA 3QVPA 4TLZA 1PXAA 2XFNA 5GSNA 1CC6A 1DODA 3FBSA 5JCKA 4USRA 1F8SA 1VG9A 5KOWA 1VDCA 5L46A 2YM1A 1PJ7A 1PN0A 3QSMA 4U8LA 1ZMCA 1GESA 4YJFB 2B7SA 3ICTA 2Y6QA 1VRQB 2WOWA 2QA1A 4HA6A 4BK3A 1N4WA 3C4NA 3Q9TA 3RHAA 4J57A 3BHFA 4B64A 5BVAA 3LB8A 4Z25A 1P2HA 2V60A 4UP3A 2EQ9A 5U63A 2R4JA 1DXLA 4ADWA 2YG6A 3C4AA 3NK2X 4FK1C 1OJDA 3L1RA 3UKKA 1EL7A 4AP1A 4YSHA 1BZLA 3GWFA 5EOWA 4ICYA 2C3DA 3LADA 3CIRA 5KWFA 1IUWA 2DU8A 3ADAB 4Z24A 4JN9A 2YWLA 4Z44A 1PBCA 1O94A 4U8MA 1O95A 5J60A 3ZNNA 2XFQA 4AT0A 4Y4MA 4OPTA 3KKJA 1LQTA 5KRQA 1TDFA 4RG4A 4XWRA 1GNDA 1S2QA 3QFBA 4J33A 1TDEA 4H4YA 3UKPA 3LJPA 1C0IA 2ZZBA 4EIPA 1E1NA 3CTYA 5M10A 2C76A 4A79A 2YVGA 3P9UA 1XDIA 4A5LA 4X4JA 3VR9A 2DKHA 1YQ3A 4YSXA 2PHHA 3DK9A 3RP8A 2UZZA 4TM4A 4USQA 3W4JA 3GWDA 3T37A 1C0KA 4FX9A 2E49A 2GVCA 2YVJA 4E0VA 3GDPA 2Q0LA 3GMBA 2I0ZA 4MJWA 2XVHA 2AAQA 3ZDNA 1L9CA 4YJDA 3DMEA 2GEWA 3CGDA 4LU6A 3NK1X 4FDCB 4IVOB 1RSGA 2X8CA 4HB9A 4OPGA 1NAAA 1JU2A 4U2TA 3AE4A 4CRTA 1DAOA 2E5VA 3NKSA 4OPUA 1Q1RA 3WE0A 1NG3A 4H4SA 2GH5A 4Z43A 1H81A 2X3NA 4Z2TA 3AB1A 1E1MA 1W4XA 3CPIG 3P1WA 4GUVA 1JRYA 4TM0A 2JAEA 2GR3A 1JNZA 3GMCA 4JNQA 2XCGA 2XVFA 3ABVA 2BACA 3RP6A 4EQSA 1GOSA 2FJAA 1E1LA 2O9ZA 4Y4LA 1D5TA 1LJ1A 2JB1A 3GD4A 1Y56A 2WU5A 3K7QX 1ZDLA 1DDOA 3G5RA 4J31A 4NEVA 4O5QA 4WX1A 2Q6UA 2YQUA 3ALJA 1ELIA 1EBDA 1RP0A 2YLWA 4U8KA 3EPTA 3UKFA 1REOA 3NH3X 4Z2RA 3GRTA 1ZOVA 1JRXA 3NN0X 3VQRA 4I58A 1Q1WA 1LQUA 3O0HA 1NENA 1EL5A 4H4TA 2Q7VA 4I59A 2CDUA 2XFOA 2CULA 5KVIA 1YQZA 2W0HA 4C77A 1N4UA 3NT6A 2VOUA 3GYIA 2WBAA 4B1BA 2BCGG 3AEBA 2X50A 3NGCX 3SQPA 4K2XA 3UP5A 5LV9A 1F3PA 3L8KA 3KA7A 4J56A 2C64A 3P4SA 4H2NA 4X9NA 3FG2P 3DJGX 3VR8A 4X9MA 2BK4A 4IVMB 4NTDA 4UDRA 1PJ5A 4EIQA 3NIXA 3IHMA 1GRAA 4C5OA 2XLUA 3OC4A 1E1KA 3CNPA 4UDQA 1GSNA 3DK4A 1KSUA 4YSYA 1F6MA 2BXRA 2VRLA 1ZY8A 2VVLA 2E4GA 1UKVG 4U8NA 2OALA 1C0PA 2FJEA 3E1TA 3H4KA 2A89A 3AWIA 3AE8A 1QJDA 2R46A 2IVDA 1X31B 2JB3A 1NDAA 4D04A 1VG0A 2HQMA 2X8GA 4NZHA 2BABA 1KNPA 4EMJA 2B9YA 1P2EA 4DSHA 4YJGA 2YG7A 4OPIA 3CNJA 1HYUA 4TLXA 1NEKA 3AECA 4K7ZA 2X8HA 3UTGA 2YR4A 4JY3A 2GMHA 3GRSA 4O5UA 3UKQA 2VQ7A 4B65A 4EMIA 3NYEA 3CPJG 5HYMA 1GRBA 2BCPA 2FJBA 3DGZA 4JDRA 3KU9A 3QJ4A 4IV9A 3BI2A 1H83A 3UOZA 1B37A 5M0ZA 3NLCA 2E4AA 3B3RA 3IF9A 4OPCA 2YR5A 4A6NB 3AE5A 1LVLA 1OJAA 4EQWA 3AE7A 3ATRA 5FS9A 2C3CA 1OJ9A 1K4QA 1TYPA 4U2LA 4JNAA 1YY5A
chains in the Genus database with same CATH superfamily
4BURA 2QAEA 1E6EA 4H2RA 2IVEA 3F8PA 5C2TA 3P4QA 2XFPA 2AQJA 4YTNA 1N4VA 1FCDA 2JBVA 2GMJA 3KLJA 3CN8A 3QFAA 4GRTA 3UTEA 3KPKA 3DJJA 4YJFA 2CVJA 1K0LA 3I6DA 4H4UA 4BV6A 3ALMA 4DNAA 1DOBA 1DOEA 4H4RA 3ICSA 4J2WA 3DJEA 4YJHB 2C70A 4GDEA 3AYIA 2XLRA 2C73A 3K7TA 3SM8A 3BNUA 4JQ9A 4PAAA 3AD7B 2B7RA 4C74A 1LPFA 1XPQA 1AN9A 3K30A 3SXIA 3SGLA 4CNJA 1PS9A 3GSIA 4Z26A 3AD9B 1M6IA 3QVRA 1H84A 2R45A 1XHCA 2V3AA 5J7XA 1BGNA 1FL2A 4NTEA 1VE9A 1GTHA 1TYTA 3H8IA 3NRNA 4AOSA 1CJ4A 1FOHA 4B66A 5JCIA 2C66A 3AD8B 2RABA 2BYBA 4P9SA 3G3EA 1DOCA 1KDGA 3F8DA 3FMWA 1ZMDA 1ZP0A 2QA2A 4GAPA 2R0PA 3ISHA 4KX6A 2C7GA 3D8XA 4APNA 1CF3A 2TMDA 4DGKA 2YLSA 4CCQA 2E48A 1S3EA 1DJNA 2NPXA 4BJYA 3DGHA 2C4CA 1IUXA 3URHA 2BK5A 4A7AA 3SZFA 2WOVA 2GR2A 1LTXR 4H4WA 3NHOX 1GALA 2FJDA 1K0IA 4BK2A 3AE3A 2WESA 4YTPA 4H2QA 1D4CA 3AE2A 1TDNA 4IA6A 1Z6LA 1IUTA 2B9WA 4LA1A 2R0GA 4LIIA 4U8JA 1NHSA 4D03A 5KVHA 3NYCA 3G5SA 3UOYA 1D7LA 1CC2A 3GYXA 3CGEA 2AR8A 1D4DA 2R4EA 1JEHA 4YT0A 1AOGA 2YAUA 1GXFA 1PXBA 1B5QA 3SX6A 4II2A 3KD9A 1YKJA 3CUKA 1IUUA 1CC4A 2OLOA 2GQFA 3AYJA 3UTFA 3DK8A 2OLNA 4QFDA 3FIMB 4K5RA 3CNTA 2C75A 4CNKA 2J3NA 1DNCA 4YXDA 2H88A 1JOAA 2WQYA 2GAGB 2BRYA 1KSSA 2ZBWA 4M52A 3VRBA 5FS7A 4YSZA 3PO7A 3B6DA 2YG3A 2WS3A 2DKIA 4C3YA 1S3BA 3ZNOA 4B67A 1S2YA 4CY8A 1F8RA 2YG4A 3II4A 3RNMA 3SZCA 1H7WA 1GETA 1GEUA 3WGTA 4OPLA 3DH9A 4UDPA 4IA5A 2RGJA 3UCLA 1BKWA 2VZ2A 2EQ6A 4EM3A 2GR1A 3REDA 3DJDA 1TDKA 1IUSA 3D1CA 3GYJA 1MOKA 1D4EA 2PYXA 3DA1A 4DSGA 3GD3A 1GREA 2QCUA 1GERA 5FS8A 4B63A 3ATQA 2B9XA 4G74A 4BK1A 4WCTA 2JK6A 2BC0A 3Q6JA 1YQ4A 2YLXA 1LV0A 4NTCA 2YM2A 4H4VA 3COXA 3S61A 1ZKQA 5EBKA 2GB0A 3HYVA 2CFYA 2H89A 3W4IA 2OA1A 2Z5XA 3AE1A 3H8LA 4H50A 2RGOA 3UP4A 5KMPA 1VQWA 1CJ3A 2WEUA 4QFCA 1GT8A 1Q9IA 2VVMA 1CJ2A 3FPZA 2BA9A 3NTAA 1NHQA 3CPHG 3SZ0A 1JRZA 2Y6RA 4C3XA 4EQRA 1PBBA 1PJ6A 1CJCA 3W4KA 1GRHA 1MXTA 1FEAA 2WP9A 2YG5A 3IC9A 4JY2A 4H4PA 4BJZA 4U8PA 3K7MX 1KF6A 4YKFA 5KMQA 4EQXA 2E1MA 3LZWA 1K0JA 2VVLG 3HYXA 4TM3A 2A8XA 4U2SA 5U1OA 3NNEA 4ECHA 3R9UA 4AP3A 1GTEA 3G5QA 1GPEA 2F5ZA 2ZZ0A 2BS4A 1ZX9A 2A87A 3UOVA 3P4PA 5C3JA 5FS6A 2XVEA 1KNRA 4K5SA 3AEEA 3CNSA 2WDQA 3NYFA 2WHDA 4CBQA 3F8RA 2XLSA 1F8WA 2YR6A 4A99A 5EB4A 1MO9A 1N1PA 3P4RA 1GRGA 2C65A 5CQFA 2WPEA 2YLRA 1PBEA 5JCLA 1KFYA 1EL8A 1NHPA 1KIFA 2WP5A 3IWAA 5U25A 4EMWA 3CGCA 4GCMA 1IJHA 2XLTA 4A9WA 5TR3A 3VRDB 3OZ2A 4ZN0A 2TPRA 3AEGA 1BF3A 1L9EA 1PBDA 3ICRA 4A6NA 2R9ZA 1M64A 1BWCA 2OAMA 3HZLA 1H6VA 3SFEA 1PBFA 2X99A 2YLZA 5DBJA 1V59A 1PXCA 1BGJA 4II3A 1GRFA 3ZYXA 4H4QA 2V3BA 2GF3A 3AE9A 3BI5A 1Y56B 3V76A 4RSLA 4YTMA 1IUVA 4XWZA 2ACZA 4YJHA 5ER0A 3T14A 2R0CA 2YVFA 3I3LA 3UTHA 4NEWA 2NVKX 2XLPA 3QSEA 3GDNA 3NG7X 3KPFA 3JSKA 2C67A 2WETA 4J36A 2GV8A 3NTDA 2BXSA 4NWZA 2XVIA 4EM4A 3RP7A 2FBWA 4OCGA 4FK1A 4Z2UA 5HXIA 2V5ZA 1E7PA 1JNRA 4H4ZA 3M12A 4AOXA 1ZOYA 2BS3A 2XVJA 5HHFA 3UKLA 4CY6A 1E39A 2BK3A 2XFUA 3ALLA 3T0KA 5JCMA 4G6HA 1COYA 3LZXA 4Y4NA 3PS9A 5IPYA 3AXBA 1GRTA 1OJTA 2WP6A 2JB2A 4H4XA 1O5WA 2EQ8A 2VRMA 2BS2A 1OJCA 1NHRA 3S5WA 4A65A 3QSSA 1B8SA 2GR0A 2XDOA 1H86A 1Y0PA 2EQ7A 2WU2A 5BRTA 2WDRA 5HY5A 3PVCA 1DJQA 2V6OA 5KOXA 5KXJA 2Q0KA 1L9DA 1C0LA 1L0VA 3T31A 3ZNQA 3AE6A 1XANA 2VQBA 3V3OA 3SYIA 1PDHA 3UOXA 4ZCCA 5IQ4A 2ARDA 2WPCA 3AEDA 5BULA 5GRTA 2APGA 2V61A 3V3NA 1D7YA 1FECA 4GR1A 2WPFA 1PHHA 3EAOA 1H82A 4J34A 4KPRA 4N9XA 3AEFA 3NN6X 4REKA 2WDVA 4K8DA 2GAHB 1SEZA 4U8IA 4B69A 1QLBA 3CNDA 4RG3A 4TM1A 2GQWA 3ITJA 3BNMA 1B4VA 3SFDA 3UKHA 4AT2A 2XYOA 2B76A 5JCNA 1GV4A 3EF6A 1RYIA 3NK0X 3M13A 2Z5YA 1TDOA 2ZZCA 5IQ1A 5BUKA 3BHKA 3AEAA 1EVIA 4H2PA 1CHUA 4YJGB 2IIDA 3VRAA 3C96A 1ZK7A 4CCRA 1TRBA 5FMHA 4OVIA 3ZNPA 1QO8A 1CBOA 3IHGA 5EB5A 2E82A 2BC1A 2C72A 1H7XA 4G9KA 2JKCA 3KVEA 4K22A 4PABA 2GRTA 4U8OA 1ONFA 4YKGA 3LXDA 4OPDA 2BRAA 3EANA 2YLTA 1FEBA 4H7UA 3SZWA 4XXGA 2WOIA 3UKAA 1EL9A 4B68A 3M0OA 3AYLA 4ZCDA 1CL0A 5KNLA 4YWOA 3CGBA 5CKUA 3BI4A 1NPXA 4EIPA 2RGHA 4GF7A 3LOVA 3QVPA 4GDPA 1PXAA 2XFNA 4TLZA 1CC6A 1DODA 3FBSA 5GSNA 5JCKA 4USRA 1F8SA 1VG9A 5KOWA 1VDCA 5L46A 2YM1A 1PJ7A 1PN0A 3QSMA 1YY5A 1ZMCA 1GESA 4YJFB 4U8LA 2B7SA 3ICTA 3T2YA 2Y6QA 1VRQB 2WOWA 2QA1A 4BK3A 4HA6A 1N4WA 3C4NA 3Q9TA 3RHAA 4J57A 3BHFA 4B64A 5BVAA 3LB8A 4Z25A 1P2HA 2V60A 5KMRA 4UP3A 2EQ9A 5U63A 2R4JA 1DXLA 4ADWA 2YG6A 3C4AA 3NK2X 4FK1C 1OJDA 3L1RA 3UKKA 1EL7A 4AP1A 4YSHA 1BZLA 3GWFA 5EOWA 4ICYA 2C3DA 3SY4A 3LADA 5KMSA 3CIRA 5KWFA 1IUWA 2DU8A 3ADAB 4Z24A 4JN9A 2YWLA 4Z44A 1PBCA 1O94A 4U8MA 1O95A 5J60A 3ZNNA 2XFQA 4AT0A 4Y4MA 4OPTA 3KKJA 1LQTA 5KRQA 1TDFA 4RG4A 4XWRA 1GNDA 4NNJA 1S2QA 3QFBA 4J33A 1TDEA 4H4YA 3UKPA 3LJPA 1C0IA 2ZZBA 5M10A 1E1NA 3CTYA 2C76A 4A79A 2YVGA 3P9UA 1XDIA 4A5LA 4X4JA 3VR9A 2DKHA 1YQ3A 4YSXA 2PHHA 3DK9A 3RP8A 2UZZA 4TM4A 4USQA 3W4JA 3GWDA 3T37A 1C0KA 4FX9A 2E49A 2GVCA 2YVJA 4E0VA 3GDPA 2Q0LA 3GMBA 2I0ZA 4MJWA 2XVHA 2AAQA 3ZDNA 1L9CA 4YJDA 3DMEA 2GEWA 3CGDA 4LU6A 3NK1X 4FDCB 4IVOB 1RSGA 2X8CA 4HB9A 4OPGA 1NAAA 1JU2A 4U2TA 3AE4A 4CRTA 1DAOA 2E5VA 3NKSA 4OPUA 1Q1RA 3WE0A 1NG3A 4H4SA 3T2ZA 3T2KA 2GH5A 4Z43A 1H81A 2X3NA 4Z2TA 3AB1A 1E1MA 1W4XA 3CPIG 3P1WA 4GUVA 1JRYA 4TM0A 2JAEA 2GR3A 3GMCA 1JNZA 4JNQA 2XCGA 2XVFA 3ABVA 3RP6A 2BACA 4EQSA 1GOSA 2FJAA 3HYWA 1E1LA 2O9ZA 4Y4LA 1D5TA 1LJ1A 2JB1A 3GD4A 1Y56A 2WU5A 3K7QX 1ZDLA 1DDOA 3G5RA 4J31A 4NEVA 4O5QA 4WX1A 2Q6UA 3ALJA 2YQUA 1ELIA 1EBDA 1RP0A 2YLWA 4U8KA 3EPTA 3UKFA 1REOA 3NH3X 4Z2RA 3GRTA 1ZOVA 1JRXA 3NN0X 3VQRA 4I58A 1Q1WA 1LQUA 3O0HA 1NENA 1EL5A 4H4TA 2Q7VA 4I59A 2CDUA 2XFOA 2CULA 5KVIA 1YQZA 2W0HA 4C77A 1N4UA 3NT6A 2VOUA 3GYIA 4GAVA 2WBAA 4B1BA 2BCGG 3AEBA 2X50A 3NGCX 3SQPA 4K2XA 3UP5A 5LV9A 1F3PA 3L8KA 3KA7A 4J56A 2C64A 3P4SA 4H2NA 4X9NA 3FG2P 3DJGX 3VR8A 4X9MA 2BK4A 4EIQA 4IVMB 4NTDA 1PJ5A 4UDRA 3NIXA 3IHMA 1GRAA 4C5OA 2XLUA 3OC4A 1E1KA 3CNPA 4UDQA 1GSNA 3DK4A 1KSUA 4YSYA 1F6MA 2BXRA 2VRLA 1ZY8A 2VVLA 2E4GA 1UKVG 4U8NA 2OALA 1C0PA 2FJEA 3E1TA 3H4KA 2A89A 3AWIA 3AE8A 1QJDA 2R46A 2IVDA 1X31B 2JB3A 1NDAA 4D04A 1VG0A 2HQMA 2X8GA 4NZHA 2BABA 1KNPA 4EMJA 2B9YA 1P2EA 4DSHA 4YJGA 2YG7A 4OPIA 3CNJA 1HYUA 4TLXA 1NEKA 3AECA 4K7ZA 2X8HA 3UTGA 4JY3A 2YR4A 2GMHA 3GRSA 4O5UA 3UKQA 4G73A 2VQ7A 4B65A 4EMIA 3NYEA 3CPJG 5HYMA 1GRBA 2BCPA 2FJBA 3DGZA 4JDRA 3KU9A 3QJ4A 4IV9A 3BI2A 1H83A 3UOZA 1B37A 5M0ZA 3NLCA 4G6GA 2E4AA 3B3RA 3IF9A 4OPCA 2YR5A 4A6NB 3AE5A 1LVLA 1OJAA 4EQWA 3AE7A 3ATRA 3CMMA 2C3CA 5FS9A 1OJ9A 1K4QA 1TYPA 4U2LA 4JNAA 1NG4A
chains in the Genus database with same CATH topology
4BURA 2QAEA 1E6EA 4H2RA 2IVEA 3F8PA 5C2TA 3P4QA 2XFPA 2AQJA 4YTNA 1N4VA 1FCDA 2JBVA 2GMJA 3KLJA 3CN8A 3QFAA 4GRTA 3UTEA 3KPKA 3DJJA 4YJFA 2CVJA 1K0LA 3I6DA 4H4UA 4BV6A 3ALMA 4DNAA 1DOBA 1DOEA 4H4RA 3ICSA 4J2WA 3DJEA 4YJHB 2C70A 4GDEA 3AYIA 2XLRA 2C73A 3K7TA 3SM8A 3BNUA 4JQ9A 4PAAA 3AD7B 2B7RA 4C74A 1LPFA 1XPQA 1AN9A 3K30A 3SXIA 3SGLA 4CNJA 1PS9A 3GSIA 4Z26A 3AD9B 1M6IA 3QVRA 1H84A 2R45A 1XHCA 2V3AA 5J7XA 1BGNA 1FL2A 4NTEA 1VE9A 1GTHA 1TYTA 3H8IA 3NRNA 4AOSA 1CJ4A 1FOHA 4B66A 5JCIA 2C66A 3AD8B 2RABA 2BYBA 4P9SA 3G3EA 1DOCA 1KDGA 3F8DA 3FMWA 1ZMDA 1ZP0A 2QA2A 4GAPA 2R0PA 3ISHA 4KX6A 2C7GA 3D8XA 4APNA 1CF3A 2TMDA 4DGKA 2YLSA 4CCQA 2E48A 1S3EA 1DJNA 2NPXA 3DGHA 4BJYA 2C4CA 1IUXA 3URHA 2BK5A 4A7AA 3SZFA 2WOVA 2GR2A 1LTXR 4H4WA 3NHOX 1GALA 2FJDA 1K0IA 4BK2A 3AE3A 2WESA 4YTPA 1D4CA 3AE2A 4H2QA 1TDNA 1Z6LA 4IA6A 1IUTA 2B9WA 4LA1A 2R0GA 4LIIA 4U8JA 1NHSA 4D03A 5KVHA 3NYCA 3G5SA 3UOYA 1D7LA 1CC2A 3GYXA 3CGEA 2AR8A 1D4DA 2R4EA 1JEHA 4YT0A 1AOGA 2YAUA 1GXFA 1PXBA 1B5QA 3SX6A 4II2A 3KD9A 1YKJA 3CUKA 1IUUA 1CC4A 2OLOA 2GQFA 3AYJA 3UTFA 3DK8A 2OLNA 4QFDA 3FIMB 4K5RA 3CNTA 2C75A 4CNKA 2J3NA 1DNCA 4YXDA 2H88A 1JOAA 2WQYA 2GAGB 2BRYA 1KSSA 2ZBWA 4M52A 3VRBA 5FS7A 4YSZA 3PO7A 3B6DA 2YG3A 2WS3A 2DKIA 4C3YA 1S3BA 3ZNOA 4B67A 1S2YA 4CY8A 1F8RA 2YG4A 3II4A 3RNMA 3SZCA 1H7WA 1GETA 1GEUA 3WGTA 4OPLA 3DH9A 4UDPA 4IA5A 2RGJA 3UCLA 1BKWA 2VZ2A 2EQ6A 4EM3A 2GR1A 3REDA 3DJDA 1TDKA 1IUSA 3D1CA 3GYJA 1MOKA 1D4EA 2PYXA 3DA1A 4DSGA 3GD3A 1GREA 2QCUA 1GERA 5FS8A 4B63A 3ATQA 2B9XA 4G74A 4WCTA 2JK6A 4BK1A 2BC0A 3Q6JA 1YQ4A 2YLXA 1LV0A 4NTCA 2YM2A 4H4VA 3COXA 3S61A 1ZKQA 5EBKA 2GB0A 3HYVA 2CFYA 2H89A 3W4IA 2OA1A 2Z5XA 3AE1A 3H8LA 4H50A 2RGOA 3UP4A 5KMPA 1VQWA 1CJ3A 2WEUA 4QFCA 1GT8A 1Q9IA 2VVMA 1CJ2A 3FPZA 2BA9A 3NTAA 1NHQA 3CPHG 3SZ0A 1JRZA 2Y6RA 4C3XA 4EQRA 1PBBA 1PJ6A 1CJCA 3W4KA 1GRHA 1MXTA 1FEAA 2WP9A 2YG5A 3IC9A 4JY2A 4H4PA 4BJZA 4U8PA 3K7MX 1KF6A 4YKFA 5KMQA 4EQXA 2E1MA 3LZWA 1K0JA 2VVLG 3HYXA 4TM3A 2A8XA 4U2SA 5U1OA 3NNEA 4ECHA 3R9UA 4AP3A 1GTEA 3G5QA 1GPEA 2F5ZA 2ZZ0A 2BS4A 1ZX9A 2A87A 3UOVA 3P4PA 5C3JA 5FS6A 2XVEA 1KNRA 4K5SA 3AEEA 3CNSA 2WDQA 3NYFA 2WHDA 4CBQA 3F8RA 2XLSA 1F8WA 2YR6A 4A99A 5EB4A 1MO9A 1N1PA 3P4RA 1GRGA 2C65A 5CQFA 2WPEA 2YLRA 1PBEA 5JCLA 1KFYA 1EL8A 1NHPA 1KIFA 2WP5A 3IWAA 5U25A 4EMWA 3CGCA 4GCMA 1IJHA 2XLTA 4A9WA 5TR3A 3VRDB 3OZ2A 4ZN0A 2TPRA 3AEGA 1BF3A 1L9EA 1PBDA 3ICRA 4A6NA 2R9ZA 1M64A 1BWCA 2OAMA 3HZLA 1H6VA 3SFEA 1PBFA 2X99A 2YLZA 5DBJA 1V59A 1PXCA 1BGJA 4II3A 1GRFA 3ZYXA 4H4QA 2V3BA 2GF3A 3AE9A 3BI5A 1Y56B 3V76A 4RSLA 4YTMA 1IUVA 4XWZA 2ACZA 4YJHA 5ER0A 3T14A 2R0CA 2YVFA 3I3LA 3UTHA 4NEWA 2NVKX 2XLPA 3QSEA 3GDNA 3NG7X 1NG4A 3KPFA 3JSKA 2C67A 2WETA 4J36A 2GV8A 3NTDA 2BXSA 4NWZA 2XVIA 4EM4A 3RP7A 2FBWA 4OCGA 4FK1A 4Z2UA 5HXIA 2V5ZA 1E7PA 1JNRA 4H4ZA 3M12A 4AOXA 1ZOYA 2BS3A 2XVJA 5HHFA 3UKLA 4CY6A 1E39A 2BK3A 2XFUA 3ALLA 3T0KA 5JCMA 4G6HA 1COYA 3LZXA 4Y4NA 3PS9A 5IPYA 3AXBA 1GRTA 1OJTA 2WP6A 2JB2A 4H4XA 1O5WA 2EQ8A 2VRMA 2BS2A 1OJCA 1NHRA 3S5WA 4A65A 3QSSA 1B8SA 2GR0A 2XDOA 1H86A 1Y0PA 2EQ7A 2WU2A 5BRTA 2WDRA 5HY5A 3PVCA 1DJQA 2V6OA 5KOXA 5KXJA 2Q0KA 1L9DA 1C0LA 1L0VA 3T31A 3ZNQA 3AE6A 1XANA 2VQBA 3V3OA 3SYIA 1PDHA 3UOXA 4ZCCA 5IQ4A 2ARDA 2WPCA 3AEDA 5BULA 5GRTA 2APGA 2V61A 3V3NA 1D7YA 1FECA 4GR1A 2WPFA 1PHHA 3EAOA 1H82A 4J34A 4KPRA 4N9XA 3AEFA 3NN6X 4REKA 2WDVA 4K8DA 2GAHB 1SEZA 4U8IA 4B69A 1QLBA 3CNDA 4RG3A 4TM1A 2GQWA 3ITJA 3BNMA 1B4VA 3SFDA 3UKHA 4AT2A 2XYOA 2B76A 5JCNA 1GV4A 3EF6A 1RYIA 3NK0X 3M13A 2Z5YA 1TDOA 2ZZCA 5IQ1A 5BUKA 3BHKA 3AEAA 1EVIA 4H2PA 1CHUA 4YJGB 2IIDA 3VRAA 3C96A 1ZK7A 4CCRA 1TRBA 5FMHA 4OVIA 3ZNPA 1QO8A 1CBOA 3IHGA 5EB5A 2E82A 2BC1A 2C72A 1H7XA 4G9KA 2JKCA 3KVEA 4K22A 4PABA 2GRTA 4U8OA 1ONFA 4YKGA 3LXDA 4OPDA 2BRAA 3EANA 2YLTA 1FEBA 4H7UA 3SZWA 4XXGA 2WOIA 3UKAA 1EL9A 4B68A 3M0OA 3AYLA 4ZCDA 1CL0A 5KNLA 4YWOA 3CGBA 5CKUA 3BI4A 1NPXA 4GDPA 2RGHA 4GF7A 3LOVA 3QVPA 4TLZA 1PXAA 2XFNA 5GSNA 1CC6A 1DODA 3FBSA 5JCKA 4USRA 1F8SA 1VG9A 5KOWA 1VDCA 5L46A 2YM1A 1PJ7A 1PN0A 3QSMA 4U8LA 1ZMCA 1GESA 4YJFB 2B7SA 3ICTA 3T2YA 2Y6QA 1VRQB 2WOWA 2QA1A 4HA6A 4BK3A 1N4WA 3C4NA 3Q9TA 3RHAA 4J57A 3BHFA 4B64A 5BVAA 3LB8A 4Z25A 1P2HA 2V60A 5KMRA 4UP3A 2EQ9A 5U63A 2R4JA 1DXLA 4ADWA 2YG6A 3C4AA 3NK2X 4FK1C 1OJDA 3L1RA 3UKKA 1EL7A 4AP1A 4YSHA 1BZLA 3GWFA 5EOWA 4ICYA 2C3DA 3SY4A 3LADA 5KMSA 3CIRA 5KWFA 1IUWA 2DU8A 3ADAB 4Z24A 4JN9A 2YWLA 4Z44A 1PBCA 1O94A 4U8MA 1O95A 5J60A 3ZNNA 2XFQA 4AT0A 4Y4MA 4OPTA 3KKJA 1LQTA 5KRQA 1TDFA 4RG4A 4XWRA 1GNDA 4NNJA 1S2QA 3QFBA 4J33A 1TDEA 4H4YA 3UKPA 3LJPA 1C0IA 2ZZBA 4EIPA 1E1NA 3CTYA 5M10A 2C76A 4A79A 2YVGA 3P9UA 1XDIA 4A5LA 4X4JA 3VR9A 2DKHA 1YQ3A 4YSXA 2PHHA 3DK9A 3RP8A 2UZZA 4TM4A 4USQA 3W4JA 3GWDA 3T37A 1C0KA 4FX9A 2E49A 2GVCA 2YVJA 4E0VA 3GDPA 2Q0LA 3GMBA 2I0ZA 4MJWA 2XVHA 2AAQA 3ZDNA 1L9CA 4YJDA 3DMEA 2GEWA 3CGDA 4LU6A 3NK1X 4FDCB 4IVOB 1RSGA 2X8CA 4HB9A 4OPGA 1NAAA 1JU2A 4U2TA 3AE4A 4CRTA 1DAOA 2E5VA 3NKSA 4OPUA 1Q1RA 3WE0A 1NG3A 4H4SA 3T2ZA 3T2KA 2GH5A 4Z43A 1H81A 2X3NA 4Z2TA 3AB1A 1E1MA 1W4XA 3CPIG 3P1WA 4GUVA 1JRYA 4TM0A 2JAEA 2GR3A 1JNZA 3GMCA 4JNQA 2XCGA 2XVFA 3ABVA 2BACA 3RP6A 4EQSA 1GOSA 2FJAA 3HYWA 1E1LA 2O9ZA 4Y4LA 1D5TA 1LJ1A 2JB1A 3GD4A 1Y56A 2WU5A 3K7QX 1ZDLA 1DDOA 3G5RA 4J31A 4NEVA 4O5QA 4WX1A 2Q6UA 2YQUA 3ALJA 1ELIA 1EBDA 1RP0A 2YLWA 4U8KA 3EPTA 3UKFA 1REOA 3NH3X 4Z2RA 3GRTA 1ZOVA 1JRXA 3NN0X 3VQRA 4I58A 1Q1WA 1LQUA 3O0HA 1NENA 1EL5A 4H4TA 2Q7VA 4I59A 2CDUA 2XFOA 2CULA 5KVIA 1YQZA 2W0HA 4C77A 1N4UA 3NT6A 2VOUA 3GYIA 4GAVA 2WBAA 4B1BA 2BCGG 3AEBA 2X50A 3NGCX 3SQPA 4K2XA 3UP5A 5LV9A 1F3PA 3L8KA 3KA7A 4J56A 2C64A 3P4SA 4H2NA 4X9NA 3FG2P 3DJGX 3VR8A 4X9MA 2BK4A 4IVMB 4NTDA 4UDRA 1PJ5A 4EIQA 3NIXA 3IHMA 1GRAA 4C5OA 2XLUA 3OC4A 1E1KA 3CNPA 4UDQA 1GSNA 3DK4A 1KSUA 4YSYA 1F6MA 2BXRA 2VRLA 1ZY8A 2VVLA 2E4GA 1UKVG 4U8NA 2OALA 1C0PA 2FJEA 3E1TA 3H4KA 2A89A 3AWIA 3AE8A 1QJDA 2R46A 2IVDA 1X31B 2JB3A 1NDAA 4D04A 1VG0A 2HQMA 2X8GA 4NZHA 2BABA 1KNPA 4EMJA 2B9YA 1P2EA 4DSHA 4YJGA 2YG7A 4OPIA 3CNJA 1HYUA 4TLXA 1NEKA 3AECA 4K7ZA 2X8HA 3UTGA 2YR4A 4JY3A 2GMHA 3GRSA 4O5UA 3UKQA 4G73A 2VQ7A 4B65A 4EMIA 3NYEA 3CPJG 5HYMA 1GRBA 2BCPA 2FJBA 3DGZA 4JDRA 3KU9A 3QJ4A 4IV9A 3BI2A 1H83A 3UOZA 1B37A 5M0ZA 3NLCA 4G6GA 2E4AA 3B3RA 3IF9A 4OPCA 2YR5A 4A6NB 3AE5A 1LVLA 1OJAA 4EQWA 3AE7A 3ATRA 3CMMA 2C3CA 5FS9A 1OJ9A 1K4QA 1TYPA 4U2LA 4JNAA 1YY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUR A;  2QAE A;  1E6E A;  4H2R A;  2IVE A;  3F8P A;  5C2T A;  3P4Q A;  2XFP A;  2AQJ A;  4YTN A;  1N4V A;  1FCD A;  2JBV A;  2GMJ A;  3KLJ A;  3CN8 A;  3QFA A;  4GRT A;  3UTE A;  3DJJ A;  4YJF A;  2CVJ A;  1K0L A;  3I6D A;  4H4U A;  4BV6 A;  3ALM A;  4DNA A;  1DOB A;  1DOE A;  4H4R A;  3ICS A;  4J2W A;  3DJE A;  4YJH B;  2C70 A;  4GDE A;  3AYI A;  2XLR A;  2C73 A;  3K7T A;  3SM8 A;  3BNU A;  4JQ9 A;  4PAA A;  3AD7 B;  2B7R A;  4C74 A;  1LPF A;  1XPQ A;  1AN9 A;  3K30 A;  3SGL A;  4CNJ A;  1PS9 A;  3GSI A;  4Z26 A;  3AD9 B;  1M6I A;  3QVR A;  1H84 A;  2R45 A;  1XHC A;  2V3A A;  5J7X A;  1BGN A;  1FL2 A;  4NTE A;  1VE9 A;  1GTH A;  1TYT A;  3H8I A;  3NRN A;  4AOS A;  1CJ4 A;  1FOH A;  4B66 A;  5JCI A;  2C66 A;  3AD8 B;  2RAB A;  2BYB A;  4P9S A;  3G3E A;  1DOC A;  1KDG A;  3F8D A;  3FMW A;  1ZMD A;  1ZP0 A;  2QA2 A;  4KX6 A;  2R0P A;  3ISH A;  4APN A;  2C7G A;  3D8X A;  1CF3 A;  2TMD A;  4DGK A;  2YLS A;  4CCQ A;  2E48 A;  1S3E A;  1DJN A;  2NPX A;  3DGH A;  4BJY A;  3URH A;  1IUX A;  4A7A A;  2BK5 A;  2WOV A;  2GR2 A;  1LTX R;  4H4W A;  3NHO X;  1GAL A;  2FJD A;  1K0I A;  4BK2 A;  3AE3 A;  2WES A;  4YTP A;  1D4C A;  3AE2 A;  4H2Q A;  1TDN A;  1Z6L A;  4IA6 A;  1IUT A;  2B9W A;  4LA1 A;  2R0G A;  4LII A;  4U8J A;  1NHS A;  4D03 A;  5KVH A;  3NYC A;  3G5S A;  3UOY A;  1D7L A;  1CC2 A;  3CGE A;  2AR8 A;  1D4D A;  2R4E A;  1JEH A;  4YT0 A;  1AOG A;  2YAU A;  1GXF A;  1PXB A;  1B5Q A;  3KD9 A;  1YKJ A;  3CUK A;  1IUU A;  1CC4 A;  2OLO A;  2GQF A;  3AYJ A;  3UTF A;  3DK8 A;  2OLN A;  4QFD A;  3FIM B;  4K5R A;  3CNT A;  2C75 A;  4CNK A;  2J3N A;  1DNC A;  4YXD A;  2H88 A;  1JOA A;  2WQY A;  2GAG B;  1KSS A;  2ZBW A;  4M52 A;  3VRB A;  5FS7 A;  4YSZ A;  3PO7 A;  3B6D A;  2YG3 A;  2WS3 A;  2DKI A;  4C3Y A;  1S3B A;  3ZNO A;  4B67 A;  1S2Y A;  4CY8 A;  1F8R A;  2YG4 A;  3II4 A;  3RNM A;  1H7W A;  1GET A;  1GEU A;  3WGT A;  4OPL A;  3DH9 A;  4UDP A;  4IA5 A;  2RGJ A;  3UCL A;  1BKW A;  2VZ2 A;  2EQ6 A;  4EM3 A;  2GR1 A;  3RED A;  3DJD A;  1TDK A;  1IUS A;  3D1C A;  3GYJ A;  1MOK A;  1D4E A;  2PYX A;  3DA1 A;  4DSG A;  3GD3 A;  1GRE A;  2QCU A;  1GER A;  5FS8 A;  4B63 A;  3ATQ A;  2B9X A;  4WCT A;  2JK6 A;  4BK1 A;  2BC0 A;  3Q6J A;  1YQ4 A;  2YLX A;  1LV0 A;  4NTC A;  2YM2 A;  4H4V A;  3COX A;  3S61 A;  1ZKQ A;  5EBK A;  2GB0 A;  2CFY A;  2H89 A;  3W4I A;  2OA1 A;  2Z5X A;  3AE1 A;  3H8L A;  4H50 A;  2RGO A;  3UP4 A;  1VQW A;  1CJ3 A;  2WEU A;  4QFC A;  1GT8 A;  1Q9I A;  2VVM A;  1CJ2 A;  3FPZ A;  2BA9 A;  3NTA A;  1NHQ A;  3CPH G;  4C3X A;  1JRZ A;  2Y6R A;  4EQR A;  1PBB A;  1PJ6 A;  1CJC A;  3W4K A;  1GRH A;  1MXT A;  1FEA A;  2WP9 A;  2YG5 A;  3IC9 A;  4JY2 A;  4H4P A;  4BJZ A;  4U8P A;  3K7M X;  1KF6 A;  4YKF A;  4EQX A;  2E1M A;  3LZW A;  1K0J A;  2VVL G;  4TM3 A;  2A8X A;  4U2S A;  5U1O A;  3NNE A;  4ECH A;  3R9U A;  4AP3 A;  1GTE A;  3G5Q A;  1GPE A;  2F5Z A;  2ZZ0 A;  2BS4 A;  1ZX9 A;  2A87 A;  3UOV A;  3P4P A;  5C3J A;  5FS6 A;  2XVE A;  1KNR A;  4K5S A;  3AEE A;  3CNS A;  2WDQ A;  3NYF A;  2WHD A;  4CBQ A;  3F8R A;  2XLS A;  1F8W A;  2YR6 A;  4A99 A;  5EB4 A;  1MO9 A;  1N1P A;  3P4R A;  1GRG A;  2C65 A;  5CQF A;  2WPE A;  2YLR A;  1PBE A;  5JCL A;  1KFY A;  1EL8 A;  1NHP A;  1KIF A;  2WP5 A;  3IWA A;  5U25 A;  4EMW A;  3CGC A;  4GCM A;  1IJH A;  2XLT A;  4A9W A;  5TR3 A;  3VRD B;  3OZ2 A;  4ZN0 A;  2TPR A;  3AEG A;  1BF3 A;  1L9E A;  1PBD A;  3ICR A;  4A6N A;  2R9Z A;  1M64 A;  1BWC A;  2OAM A;  3HZL A;  1H6V A;  3SFE A;  1PBF A;  2X99 A;  2YLZ A;  5DBJ A;  1V59 A;  1PXC A;  1BGJ A;  1GRF A;  3ZYX A;  4H4Q A;  2V3B A;  2GF3 A;  3AE9 A;  3BI5 A;  1Y56 B;  3V76 A;  4RSL A;  4YTM A;  1IUV A;  4XWZ A;  2ACZ A;  4YJH A;  5ER0 A;  2R0C A;  2YVF A;  3I3L A;  3UTH A;  4NEW A;  2NVK X;  2XLP A;  3QSE A;  3GDN A;  3NG7 X;  1NG4 A;  3KPF A;  3JSK A;  2C67 A;  2WET A;  4J36 A;  2GV8 A;  3NTD A;  2BXS A;  2XVI A;  4EM4 A;  3RP7 A;  2FBW A;  4OCG A;  4FK1 A;  4Z2U A;  5HXI A;  2V5Z A;  1E7P A;  1JNR A;  4H4Z A;  3M12 A;  4AOX A;  1ZOY A;  2BS3 A;  2XVJ A;  5HHF A;  3UKL A;  4CY6 A;  1E39 A;  2BK3 A;  2XFU A;  3ALL A;  5JCM A;  4Y4N A;  1COY A;  3LZX A;  3PS9 A;  5IPY A;  3AXB A;  1GRT A;  1OJT A;  2WP6 A;  2JB2 A;  4H4X A;  1O5W A;  2EQ8 A;  2VRM A;  2BS2 A;  1OJC A;  1NHR A;  3S5W A;  4A65 A;  3QSS A;  1B8S A;  2GR0 A;  2XDO A;  1H86 A;  1Y0P A;  2EQ7 A;  2WU2 A;  5BRT A;  2WDR A;  5HY5 A;  3PVC A;  1DJQ A;  2V6O A;  5KOX A;  5KXJ A;  2Q0K A;  1L9D A;  1C0L A;  1L0V A;  3ZNQ A;  3AE6 A;  1XAN A;  2VQB A;  3V3O A;  1PDH A;  3UOX A;  4ZCC A;  5IQ4 A;  2ARD A;  2WPC A;  3AED A;  5BUL A;  5GRT A;  2APG A;  2V61 A;  3V3N A;  1D7Y A;  1FEC A;  4GR1 A;  2WPF A;  1PHH A;  3EAO A;  1H82 A;  4J34 A;  4KPR A;  4N9X A;  3AEF A;  3NN6 X;  4REK A;  2WDV A;  4K8D A;  2GAH B;  1SEZ A;  4U8I A;  4B69 A;  1QLB A;  3CND A;  4RG3 A;  4TM1 A;  2GQW A;  3ITJ A;  3BNM A;  1B4V A;  3SFD A;  3UKH A;  4AT2 A;  2XYO A;  2B76 A;  5JCN A;  1GV4 A;  3EF6 A;  1RYI A;  3NK0 X;  3M13 A;  2Z5Y A;  1TDO A;  2ZZC A;  5IQ1 A;  5BUK A;  3BHK A;  3AEA A;  1EVI A;  4H2P A;  1CHU A;  4YJG B;  2IID A;  3VRA A;  3C96 A;  1ZK7 A;  4CCR A;  1TRB A;  5FMH A;  4OVI A;  3ZNP A;  1QO8 A;  1CBO A;  3IHG A;  5EB5 A;  2E82 A;  2BC1 A;  2C72 A;  1H7X A;  2JKC A;  3KVE A;  4K22 A;  4PAB A;  2GRT A;  4U8O A;  1ONF A;  4YKG A;  3LXD A;  4OPD A;  3EAN A;  2YLT A;  1FEB A;  4H7U A;  4XXG A;  2WOI A;  3UKA A;  1EL9 A;  4B68 A;  3M0O A;  3AYL A;  4ZCD A;  1CL0 A;  4YWO A;  3CGB A;  5CKU A;  3BI4 A;  1NPX A;  4GDP A;  2RGH A;  4GF7 A;  3LOV A;  3QVP A;  4TLZ A;  1PXA A;  2XFN A;  5GSN A;  1CC6 A;  1DOD A;  3FBS A;  5JCK A;  4USR A;  1F8S A;  1VG9 A;  5KOW A;  1VDC A;  5L46 A;  2YM1 A;  1PJ7 A;  1PN0 A;  3QSM A;  4U8L A;  1ZMC A;  1GES A;  4YJF B;  2B7S A;  3ICT A;  2Y6Q A;  1VRQ B;  2WOW A;  2QA1 A;  4HA6 A;  4BK3 A;  1N4W A;  3C4N A;  3Q9T A;  3RHA A;  4J57 A;  3BHF A;  4B64 A;  5BVA A;  3LB8 A;  4Z25 A;  1P2H A;  2V60 A;  4UP3 A;  2EQ9 A;  5U63 A;  2R4J A;  1DXL A;  4ADW A;  2YG6 A;  3C4A A;  3NK2 X;  4FK1 C;  1OJD A;  3L1R A;  3UKK A;  1EL7 A;  4AP1 A;  4YSH A;  1BZL A;  3GWF A;  5EOW A;  4ICY A;  2C3D A;  3LAD A;  3CIR A;  5KWF A;  1IUW A;  2DU8 A;  3ADA B;  4Z24 A;  4JN9 A;  2YWL A;  4Z44 A;  1PBC A;  1O94 A;  4U8M A;  1O95 A;  5J60 A;  3ZNN A;  2XFQ A;  4AT0 A;  4Y4M A;  4OPT A;  3KKJ A;  1LQT A;  5KRQ A;  1TDF A;  4RG4 A;  4XWR A;  1GND A;  1S2Q A;  3QFB A;  4J33 A;  1TDE A;  4H4Y A;  3UKP A;  3LJP A;  1C0I A;  2ZZB A;  4EIP A;  1E1N A;  3CTY A;  5M10 A;  2C76 A;  4A79 A;  2YVG A;  3P9U A;  1XDI A;  4A5L A;  4X4J A;  3VR9 A;  2DKH A;  1YQ3 A;  4YSX A;  2PHH A;  3DK9 A;  3RP8 A;  2UZZ A;  4TM4 A;  4USQ A;  3W4J A;  3GWD A;  3T37 A;  1C0K A;  4FX9 A;  2E49 A;  2GVC A;  2YVJ A;  4E0V A;  3GDP A;  2Q0L A;  3GMB A;  2I0Z A;  4MJW A;  2XVH A;  2AAQ A;  3ZDN A;  1L9C A;  4YJD A;  3DME A;  2GEW A;  3CGD A;  4LU6 A;  3NK1 X;  4FDC B;  4IVO B;  1RSG A;  2X8C A;  4HB9 A;  4OPG A;  1NAA A;  1JU2 A;  4U2T A;  3AE4 A;  4CRT A;  1DAO A;  2E5V A;  3NKS A;  4OPU A;  1Q1R A;  3WE0 A;  1NG3 A;  4H4S A;  2GH5 A;  4Z43 A;  1H81 A;  2X3N A;  4Z2T A;  3AB1 A;  1E1M A;  1W4X A;  3CPI G;  3P1W A;  4GUV A;  1JRY A;  4TM0 A;  2JAE A;  2GR3 A;  1JNZ A;  3GMC A;  4JNQ A;  2XCG A;  2XVF A;  3ABV A;  2BAC A;  3RP6 A;  4EQS A;  1GOS A;  2FJA A;  1E1L A;  2O9Z A;  4Y4L A;  1D5T A;  1LJ1 A;  2JB1 A;  3GD4 A;  1Y56 A;  2WU5 A;  3K7Q X;  1ZDL A;  1DDO A;  3G5R A;  4J31 A;  4NEV A;  4O5Q A;  4WX1 A;  2Q6U A;  2YQU A;  3ALJ A;  1ELI A;  1EBD A;  1RP0 A;  2YLW A;  4U8K A;  3EPT A;  3UKF A;  1REO A;  3NH3 X;  4Z2R A;  3GRT A;  1ZOV A;  1JRX A;  3NN0 X;  3VQR A;  4I58 A;  1Q1W A;  1LQU A;  3O0H A;  1NEN A;  1EL5 A;  4H4T A;  2Q7V A;  4I59 A;  2CDU A;  2XFO A;  2CUL A;  5KVI A;  1YQZ A;  2W0H A;  4C77 A;  1N4U A;  3NT6 A;  2VOU A;  3GYI A;  2WBA A;  4B1B A;  2BCG G;  3AEB A;  2X50 A;  3NGC X;  3SQP A;  4K2X A;  3UP5 A;  5LV9 A;  1F3P A;  3L8K A;  3KA7 A;  4J56 A;  2C64 A;  3P4S A;  4H2N A;  4X9N A;  3FG2 P;  3DJG X;  3VR8 A;  4X9M A;  2BK4 A;  4IVM B;  4NTD A;  4UDR A;  1PJ5 A;  4EIQ A;  3NIX A;  3IHM A;  1GRA A;  4C5O A;  2XLU A;  3OC4 A;  1E1K A;  3CNP A;  4UDQ A;  1GSN A;  3DK4 A;  1KSU A;  4YSY A;  1F6M A;  2BXR A;  2VRL A;  1ZY8 A;  2VVL A;  2E4G A;  1UKV G;  4U8N A;  2OAL A;  1C0P A;  2FJE A;  3E1T A;  3H4K A;  2A89 A;  3AWI A;  3AE8 A;  1QJD A;  2R46 A;  2IVD A;  1X31 B;  2JB3 A;  1NDA A;  4D04 A;  1VG0 A;  2HQM A;  2X8G A;  4NZH A;  2BAB A;  1KNP A;  4EMJ A;  2B9Y A;  1P2E A;  4DSH A;  4YJG A;  2YG7 A;  4OPI A;  3CNJ A;  1HYU A;  4TLX A;  1NEK A;  3AEC A;  4K7Z A;  2X8H A;  3UTG A;  2YR4 A;  4JY3 A;  2GMH A;  3GRS A;  4O5U A;  3UKQ A;  2VQ7 A;  4B65 A;  4EMI A;  3NYE A;  3CPJ G;  5HYM A;  1GRB A;  2BCP A;  2FJB A;  3DGZ A;  4JDR A;  3KU9 A;  3QJ4 A;  4IV9 A;  3BI2 A;  1H83 A;  3UOZ A;  1B37 A;  5M0Z A;  3NLC A;  2E4A A;  3B3R A;  3IF9 A;  4OPC A;  2YR5 A;  4A6N B;  3AE5 A;  1LVL A;  1OJA A;  4EQW A;  3AE7 A;  3ATR A;  5FS9 A;  2C3C A;  1OJ9 A;  1K4Q A;  1TYP A;  4U2L A;  4JNA A;  1YY5 A; 
#chains in the Genus database with same CATH topology
 4BUR A;  2QAE A;  1E6E A;  4H2R A;  2IVE A;  3F8P A;  5C2T A;  3P4Q A;  2XFP A;  2AQJ A;  4YTN A;  1N4V A;  1FCD A;  2JBV A;  2GMJ A;  3KLJ A;  3CN8 A;  3QFA A;  4GRT A;  3UTE A;  3KPK A;  3DJJ A;  4YJF A;  2CVJ A;  1K0L A;  3I6D A;  4H4U A;  4BV6 A;  3ALM A;  4DNA A;  1DOB A;  1DOE A;  4H4R A;  3ICS A;  4J2W A;  3DJE A;  4YJH B;  2C70 A;  4GDE A;  3AYI A;  2XLR A;  2C73 A;  3K7T A;  3SM8 A;  3BNU A;  4JQ9 A;  4PAA A;  3AD7 B;  2B7R A;  4C74 A;  1LPF A;  1XPQ A;  1AN9 A;  3K30 A;  3SXI A;  3SGL A;  4CNJ A;  1PS9 A;  3GSI A;  4Z26 A;  3AD9 B;  1M6I A;  3QVR A;  1H84 A;  2R45 A;  1XHC A;  2V3A A;  5J7X A;  1BGN A;  1FL2 A;  4NTE A;  1VE9 A;  1GTH A;  1TYT A;  3H8I A;  3NRN A;  4AOS A;  1CJ4 A;  1FOH A;  4B66 A;  5JCI A;  2C66 A;  3AD8 B;  2RAB A;  2BYB A;  4P9S A;  3G3E A;  1DOC A;  1KDG A;  3F8D A;  3FMW A;  1ZMD A;  1ZP0 A;  2QA2 A;  4GAP A;  2R0P A;  3ISH A;  4KX6 A;  2C7G A;  3D8X A;  4APN A;  1CF3 A;  2TMD A;  4DGK A;  2YLS A;  4CCQ A;  2E48 A;  1S3E A;  1DJN A;  2NPX A;  4BJY A;  3DGH A;  2C4C A;  1IUX A;  3URH A;  2BK5 A;  4A7A A;  3SZF A;  2WOV A;  2GR2 A;  1LTX R;  4H4W A;  3NHO X;  1GAL A;  2FJD A;  1K0I A;  4BK2 A;  3AE3 A;  2WES A;  4YTP A;  4H2Q A;  1D4C A;  3AE2 A;  1TDN A;  4IA6 A;  1Z6L A;  1IUT A;  2B9W A;  4LA1 A;  2R0G A;  4LII A;  4U8J A;  1NHS A;  4D03 A;  5KVH A;  3NYC A;  3G5S A;  3UOY A;  1D7L A;  1CC2 A;  3GYX A;  3CGE A;  2AR8 A;  1D4D A;  2R4E A;  1JEH A;  4YT0 A;  1AOG A;  2YAU A;  1GXF A;  1PXB A;  1B5Q A;  3SX6 A;  4II2 A;  3KD9 A;  1YKJ A;  3CUK A;  1IUU A;  1CC4 A;  2OLO A;  2GQF A;  3AYJ A;  3UTF A;  3DK8 A;  2OLN A;  4QFD A;  3FIM B;  4K5R A;  3CNT A;  2C75 A;  4CNK A;  2J3N A;  1DNC A;  4YXD A;  2H88 A;  1JOA A;  2WQY A;  2GAG B;  2BRY A;  1KSS A;  2ZBW A;  4M52 A;  3VRB A;  5FS7 A;  4YSZ A;  3PO7 A;  3B6D A;  2YG3 A;  2WS3 A;  2DKI A;  4C3Y A;  1S3B A;  3ZNO A;  4B67 A;  1S2Y A;  4CY8 A;  1F8R A;  2YG4 A;  3II4 A;  3RNM A;  3SZC A;  1H7W A;  1GET A;  1GEU A;  3WGT A;  4OPL A;  3DH9 A;  4UDP A;  4IA5 A;  2RGJ A;  3UCL A;  1BKW A;  2VZ2 A;  2EQ6 A;  4EM3 A;  2GR1 A;  3RED A;  3DJD A;  1TDK A;  1IUS A;  3D1C A;  3GYJ A;  1MOK A;  1D4E A;  2PYX A;  3DA1 A;  4DSG A;  3GD3 A;  1GRE A;  2QCU A;  1GER A;  5FS8 A;  4B63 A;  3ATQ A;  2B9X A;  4G74 A;  4BK1 A;  4WCT A;  2JK6 A;  2BC0 A;  3Q6J A;  1YQ4 A;  2YLX A;  1LV0 A;  4NTC A;  2YM2 A;  4H4V A;  3COX A;  3S61 A;  1ZKQ A;  5EBK A;  2GB0 A;  3HYV A;  2CFY A;  2H89 A;  3W4I A;  2OA1 A;  2Z5X A;  3AE1 A;  3H8L A;  4H50 A;  2RGO A;  3UP4 A;  5KMP A;  1VQW A;  1CJ3 A;  2WEU A;  4QFC A;  1GT8 A;  1Q9I A;  2VVM A;  1CJ2 A;  3FPZ A;  2BA9 A;  3NTA A;  1NHQ A;  3CPH G;  3SZ0 A;  1JRZ A;  2Y6R A;  4C3X A;  4EQR A;  1PBB A;  1PJ6 A;  1CJC A;  3W4K A;  1GRH A;  1MXT A;  1FEA A;  2WP9 A;  2YG5 A;  3IC9 A;  4JY2 A;  4H4P A;  4BJZ A;  4U8P A;  3K7M X;  1KF6 A;  4YKF A;  5KMQ A;  4EQX A;  2E1M A;  3LZW A;  1K0J A;  2VVL G;  3HYX A;  4TM3 A;  2A8X A;  4U2S A;  5U1O A;  3NNE A;  4ECH A;  3R9U A;  4AP3 A;  1GTE A;  3G5Q A;  1GPE A;  2F5Z A;  2ZZ0 A;  2BS4 A;  1ZX9 A;  2A87 A;  3UOV A;  3P4P A;  5C3J A;  5FS6 A;  2XVE A;  1KNR A;  4K5S A;  3AEE A;  3CNS A;  2WDQ A;  3NYF A;  2WHD A;  4CBQ A;  3F8R A;  2XLS A;  1F8W A;  2YR6 A;  4A99 A;  5EB4 A;  1MO9 A;  1N1P A;  3P4R A;  1GRG A;  2C65 A;  5CQF A;  2WPE A;  2YLR A;  1PBE A;  5JCL A;  1KFY A;  1EL8 A;  1NHP A;  1KIF A;  2WP5 A;  3IWA A;  5U25 A;  4EMW A;  3CGC A;  4GCM A;  1IJH A;  2XLT A;  4A9W A;  5TR3 A;  3VRD B;  3OZ2 A;  4ZN0 A;  2TPR A;  3AEG A;  1BF3 A;  1L9E A;  1PBD A;  3ICR A;  4A6N A;  2R9Z A;  1M64 A;  1BWC A;  2OAM A;  3HZL A;  1H6V A;  3SFE A;  1PBF A;  2X99 A;  2YLZ A;  5DBJ A;  1V59 A;  1PXC A;  1BGJ A;  4II3 A;  1GRF A;  3ZYX A;  4H4Q A;  2V3B A;  2GF3 A;  3AE9 A;  3BI5 A;  1Y56 B;  3V76 A;  4RSL A;  4YTM A;  1IUV A;  4XWZ A;  2ACZ A;  4YJH A;  5ER0 A;  3T14 A;  2R0C A;  2YVF A;  3I3L A;  3UTH A;  4NEW A;  2NVK X;  2XLP A;  3QSE A;  3GDN A;  3NG7 X;  3KPF A;  3JSK A;  2C67 A;  2WET A;  4J36 A;  2GV8 A;  3NTD A;  2BXS A;  4NWZ A;  2XVI A;  4EM4 A;  3RP7 A;  2FBW A;  4OCG A;  4FK1 A;  4Z2U A;  5HXI A;  2V5Z A;  1E7P A;  1JNR A;  4H4Z A;  3M12 A;  4AOX A;  1ZOY A;  2BS3 A;  2XVJ A;  5HHF A;  3UKL A;  4CY6 A;  1E39 A;  2BK3 A;  2XFU A;  3ALL A;  3T0K A;  5JCM A;  4G6H A;  1COY A;  3LZX A;  4Y4N A;  3PS9 A;  5IPY A;  3AXB A;  1GRT A;  1OJT A;  2WP6 A;  2JB2 A;  4H4X A;  1O5W A;  2EQ8 A;  2VRM A;  2BS2 A;  1OJC A;  1NHR A;  3S5W A;  4A65 A;  3QSS A;  1B8S A;  2GR0 A;  2XDO A;  1H86 A;  1Y0P A;  2EQ7 A;  2WU2 A;  5BRT A;  2WDR A;  5HY5 A;  3PVC A;  1DJQ A;  2V6O A;  5KOX A;  5KXJ A;  2Q0K A;  1L9D A;  1C0L A;  1L0V A;  3T31 A;  3ZNQ A;  3AE6 A;  1XAN A;  2VQB A;  3V3O A;  3SYI A;  1PDH A;  3UOX A;  4ZCC A;  5IQ4 A;  2ARD A;  2WPC A;  3AED A;  5BUL A;  5GRT A;  2APG A;  2V61 A;  3V3N A;  1D7Y A;  1FEC A;  4GR1 A;  2WPF A;  1PHH A;  3EAO A;  1H82 A;  4J34 A;  4KPR A;  4N9X A;  3AEF A;  3NN6 X;  4REK A;  2WDV A;  4K8D A;  2GAH B;  1SEZ A;  4U8I A;  4B69 A;  1QLB A;  3CND A;  4RG3 A;  4TM1 A;  2GQW A;  3ITJ A;  3BNM A;  1B4V A;  3SFD A;  3UKH A;  4AT2 A;  2XYO A;  2B76 A;  5JCN A;  1GV4 A;  3EF6 A;  1RYI A;  3NK0 X;  3M13 A;  2Z5Y A;  1TDO A;  2ZZC A;  5IQ1 A;  5BUK A;  3BHK A;  3AEA A;  1EVI A;  4H2P A;  1CHU A;  4YJG B;  2IID A;  3VRA A;  3C96 A;  1ZK7 A;  4CCR A;  1TRB A;  5FMH A;  4OVI A;  3ZNP A;  1QO8 A;  1CBO A;  3IHG A;  5EB5 A;  2E82 A;  2BC1 A;  2C72 A;  1H7X A;  4G9K A;  2JKC A;  3KVE A;  4K22 A;  4PAB A;  2GRT A;  4U8O A;  1ONF A;  4YKG A;  3LXD A;  4OPD A;  2BRA A;  3EAN A;  2YLT A;  1FEB A;  4H7U A;  3SZW A;  4XXG A;  2WOI A;  3UKA A;  1EL9 A;  4B68 A;  3M0O A;  3AYL A;  4ZCD A;  1CL0 A;  5KNL A;  4YWO A;  3CGB A;  5CKU A;  3BI4 A;  1NPX A;  4EIP A;  2RGH A;  4GF7 A;  3LOV A;  3QVP A;  4GDP A;  1PXA A;  2XFN A;  4TLZ A;  1CC6 A;  1DOD A;  3FBS A;  5GSN A;  5JCK A;  4USR A;  1F8S A;  1VG9 A;  5KOW A;  1VDC A;  5L46 A;  2YM1 A;  1PJ7 A;  1PN0 A;  3QSM A;  1YY5 A;  1ZMC A;  1GES A;  4YJF B;  4U8L A;  2B7S A;  3ICT A;  3T2Y A;  2Y6Q A;  1VRQ B;  2WOW A;  2QA1 A;  4BK3 A;  4HA6 A;  1N4W A;  3C4N A;  3Q9T A;  3RHA A;  4J57 A;  3BHF A;  4B64 A;  5BVA A;  3LB8 A;  4Z25 A;  1P2H A;  2V60 A;  5KMR A;  4UP3 A;  2EQ9 A;  5U63 A;  2R4J A;  1DXL A;  4ADW A;  2YG6 A;  3C4A A;  3NK2 X;  4FK1 C;  1OJD A;  3L1R A;  3UKK A;  1EL7 A;  4AP1 A;  4YSH A;  1BZL A;  3GWF A;  5EOW A;  4ICY A;  2C3D A;  3SY4 A;  3LAD A;  5KMS A;  3CIR A;  5KWF A;  1IUW A;  2DU8 A;  3ADA B;  4Z24 A;  4JN9 A;  2YWL A;  4Z44 A;  1PBC A;  1O94 A;  4U8M A;  1O95 A;  5J60 A;  3ZNN A;  2XFQ A;  4AT0 A;  4Y4M A;  4OPT A;  3KKJ A;  1LQT A;  5KRQ A;  1TDF A;  4RG4 A;  4XWR A;  1GND A;  4NNJ A;  1S2Q A;  3QFB A;  4J33 A;  1TDE A;  4H4Y A;  3UKP A;  3LJP A;  1C0I A;  2ZZB A;  5M10 A;  1E1N A;  3CTY A;  2C76 A;  4A79 A;  2YVG A;  3P9U A;  1XDI A;  4A5L A;  4X4J A;  3VR9 A;  2DKH A;  1YQ3 A;  4YSX A;  2PHH A;  3DK9 A;  3RP8 A;  2UZZ A;  4TM4 A;  4USQ A;  3W4J A;  3GWD A;  3T37 A;  1C0K A;  4FX9 A;  2E49 A;  2GVC A;  2YVJ A;  4E0V A;  3GDP A;  2Q0L A;  3GMB A;  2I0Z A;  4MJW A;  2XVH A;  2AAQ A;  3ZDN A;  1L9C A;  4YJD A;  3DME A;  2GEW A;  3CGD A;  4LU6 A;  3NK1 X;  4FDC B;  4IVO B;  1RSG A;  2X8C A;  4HB9 A;  4OPG A;  1NAA A;  1JU2 A;  4U2T A;  3AE4 A;  4CRT A;  1DAO A;  2E5V A;  3NKS A;  4OPU A;  1Q1R A;  3WE0 A;  1NG3 A;  4H4S A;  3T2Z A;  3T2K A;  2GH5 A;  4Z43 A;  1H81 A;  2X3N A;  4Z2T A;  3AB1 A;  1E1M A;  1W4X A;  3CPI G;  3P1W A;  4GUV A;  1JRY A;  4TM0 A;  2JAE A;  2GR3 A;  3GMC A;  1JNZ A;  4JNQ A;  2XCG A;  2XVF A;  3ABV A;  3RP6 A;  2BAC A;  4EQS A;  1GOS A;  2FJA A;  3HYW A;  1E1L A;  2O9Z A;  4Y4L A;  1D5T A;  1LJ1 A;  2JB1 A;  3GD4 A;  1Y56 A;  2WU5 A;  3K7Q X;  1ZDL A;  1DDO A;  3G5R A;  4J31 A;  4NEV A;  4O5Q A;  4WX1 A;  2Q6U A;  3ALJ A;  2YQU A;  1ELI A;  1EBD A;  1RP0 A;  2YLW A;  4U8K A;  3EPT A;  3UKF A;  1REO A;  3NH3 X;  4Z2R A;  3GRT A;  1ZOV A;  1JRX A;  3NN0 X;  3VQR A;  4I58 A;  1Q1W A;  1LQU A;  3O0H A;  1NEN A;  1EL5 A;  4H4T A;  2Q7V A;  4I59 A;  2CDU A;  2XFO A;  2CUL A;  5KVI A;  1YQZ A;  2W0H A;  4C77 A;  1N4U A;  3NT6 A;  2VOU A;  3GYI A;  4GAV A;  2WBA A;  4B1B A;  2BCG G;  3AEB A;  2X50 A;  3NGC X;  3SQP A;  4K2X A;  3UP5 A;  5LV9 A;  1F3P A;  3L8K A;  3KA7 A;  4J56 A;  2C64 A;  3P4S A;  4H2N A;  4X9N A;  3FG2 P;  3DJG X;  3VR8 A;  4X9M A;  2BK4 A;  4EIQ A;  4IVM B;  4NTD A;  1PJ5 A;  4UDR A;  3NIX A;  3IHM A;  1GRA A;  4C5O A;  2XLU A;  3OC4 A;  1E1K A;  3CNP A;  4UDQ A;  1GSN A;  3DK4 A;  1KSU A;  4YSY A;  1F6M A;  2BXR A;  2VRL A;  1ZY8 A;  2VVL A;  2E4G A;  1UKV G;  4U8N A;  2OAL A;  1C0P A;  2FJE A;  3E1T A;  3H4K A;  2A89 A;  3AWI A;  3AE8 A;  1QJD A;  2R46 A;  2IVD A;  1X31 B;  2JB3 A;  1NDA A;  4D04 A;  1VG0 A;  2HQM A;  2X8G A;  4NZH A;  2BAB A;  1KNP A;  4EMJ A;  2B9Y A;  1P2E A;  4DSH A;  4YJG A;  2YG7 A;  4OPI A;  3CNJ A;  1HYU A;  4TLX A;  1NEK A;  3AEC A;  4K7Z A;  2X8H A;  3UTG A;  4JY3 A;  2YR4 A;  2GMH A;  3GRS A;  4O5U A;  3UKQ A;  4G73 A;  2VQ7 A;  4B65 A;  4EMI A;  3NYE A;  3CPJ G;  5HYM A;  1GRB A;  2BCP A;  2FJB A;  3DGZ A;  4JDR A;  3KU9 A;  3QJ4 A;  4IV9 A;  3BI2 A;  1H83 A;  3UOZ A;  1B37 A;  5M0Z A;  3NLC A;  4G6G A;  2E4A A;  3B3R A;  3IF9 A;  4OPC A;  2YR5 A;  4A6N B;  3AE5 A;  1LVL A;  1OJA A;  4EQW A;  3AE7 A;  3ATR A;  3CMM A;  2C3C A;  5FS9 A;  1OJ9 A;  1K4Q A;  1TYP A;  4U2L A;  4JNA A;  1NG4 A; 
#chains in the Genus database with same CATH homology
 4BUR A;  2QAE A;  1E6E A;  4H2R A;  2IVE A;  3F8P A;  5C2T A;  3P4Q A;  2XFP A;  2AQJ A;  4YTN A;  1N4V A;  1FCD A;  2JBV A;  2GMJ A;  3KLJ A;  3CN8 A;  3QFA A;  4GRT A;  3UTE A;  3KPK A;  3DJJ A;  4YJF A;  2CVJ A;  1K0L A;  3I6D A;  4H4U A;  4BV6 A;  3ALM A;  4DNA A;  1DOB A;  1DOE A;  4H4R A;  3ICS A;  4J2W A;  3DJE A;  4YJH B;  2C70 A;  4GDE A;  3AYI A;  2XLR A;  2C73 A;  3K7T A;  3SM8 A;  3BNU A;  4JQ9 A;  4PAA A;  3AD7 B;  2B7R A;  4C74 A;  1LPF A;  1XPQ A;  1AN9 A;  3K30 A;  3SXI A;  3SGL A;  4CNJ A;  1PS9 A;  3GSI A;  4Z26 A;  3AD9 B;  1M6I A;  3QVR A;  1H84 A;  2R45 A;  1XHC A;  2V3A A;  5J7X A;  1BGN A;  1FL2 A;  4NTE A;  1VE9 A;  1GTH A;  1TYT A;  3H8I A;  3NRN A;  4AOS A;  1CJ4 A;  1FOH A;  4B66 A;  5JCI A;  2C66 A;  3AD8 B;  2RAB A;  2BYB A;  4P9S A;  3G3E A;  1DOC A;  1KDG A;  3F8D A;  3FMW A;  1ZMD A;  1ZP0 A;  2QA2 A;  4GAP A;  2R0P A;  3ISH A;  4KX6 A;  2C7G A;  3D8X A;  4APN A;  1CF3 A;  2TMD A;  4DGK A;  2YLS A;  4CCQ A;  2E48 A;  1S3E A;  1DJN A;  2NPX A;  3DGH A;  4BJY A;  2C4C A;  1IUX A;  3URH A;  2BK5 A;  4A7A A;  3SZF A;  2WOV A;  2GR2 A;  1LTX R;  4H4W A;  3NHO X;  1GAL A;  2FJD A;  1K0I A;  4BK2 A;  3AE3 A;  2WES A;  4YTP A;  1D4C A;  3AE2 A;  4H2Q A;  1TDN A;  1Z6L A;  4IA6 A;  1IUT A;  2B9W A;  4LA1 A;  2R0G A;  4LII A;  4U8J A;  1NHS A;  4D03 A;  5KVH A;  3NYC A;  3G5S A;  3UOY A;  1D7L A;  1CC2 A;  3GYX A;  3CGE A;  2AR8 A;  1D4D A;  2R4E A;  1JEH A;  4YT0 A;  1AOG A;  2YAU A;  1GXF A;  1PXB A;  1B5Q A;  3SX6 A;  4II2 A;  3KD9 A;  1YKJ A;  3CUK A;  1IUU A;  1CC4 A;  2OLO A;  2GQF A;  3AYJ A;  3UTF A;  3DK8 A;  2OLN A;  4QFD A;  3FIM B;  4K5R A;  3CNT A;  2C75 A;  4CNK A;  2J3N A;  1DNC A;  4YXD A;  2H88 A;  1JOA A;  2WQY A;  2GAG B;  2BRY A;  1KSS A;  2ZBW A;  4M52 A;  3VRB A;  5FS7 A;  4YSZ A;  3PO7 A;  3B6D A;  2YG3 A;  2WS3 A;  2DKI A;  4C3Y A;  1S3B A;  3ZNO A;  4B67 A;  1S2Y A;  4CY8 A;  1F8R A;  2YG4 A;  3II4 A;  3RNM A;  3SZC A;  1H7W A;  1GET A;  1GEU A;  3WGT A;  4OPL A;  3DH9 A;  4UDP A;  4IA5 A;  2RGJ A;  3UCL A;  1BKW A;  2VZ2 A;  2EQ6 A;  4EM3 A;  2GR1 A;  3RED A;  3DJD A;  1TDK A;  1IUS A;  3D1C A;  3GYJ A;  1MOK A;  1D4E A;  2PYX A;  3DA1 A;  4DSG A;  3GD3 A;  1GRE A;  2QCU A;  1GER A;  5FS8 A;  4B63 A;  3ATQ A;  2B9X A;  4G74 A;  4WCT A;  2JK6 A;  4BK1 A;  2BC0 A;  3Q6J A;  1YQ4 A;  2YLX A;  1LV0 A;  4NTC A;  2YM2 A;  4H4V A;  3COX A;  3S61 A;  1ZKQ A;  5EBK A;  2GB0 A;  3HYV A;  2CFY A;  2H89 A;  3W4I A;  2OA1 A;  2Z5X A;  3AE1 A;  3H8L A;  4H50 A;  2RGO A;  3UP4 A;  5KMP A;  1VQW A;  1CJ3 A;  2WEU A;  4QFC A;  1GT8 A;  1Q9I A;  2VVM A;  1CJ2 A;  3FPZ A;  2BA9 A;  3NTA A;  1NHQ A;  3CPH G;  3SZ0 A;  1JRZ A;  2Y6R A;  4C3X A;  4EQR A;  1PBB A;  1PJ6 A;  1CJC A;  3W4K A;  1GRH A;  1MXT A;  1FEA A;  2WP9 A;  2YG5 A;  3IC9 A;  4JY2 A;  4H4P A;  4BJZ A;  4U8P A;  3K7M X;  1KF6 A;  4YKF A;  5KMQ A;  4EQX A;  2E1M A;  3LZW A;  1K0J A;  2VVL G;  3HYX A;  4TM3 A;  2A8X A;  4U2S A;  5U1O A;  3NNE A;  4ECH A;  3R9U A;  4AP3 A;  1GTE A;  3G5Q A;  1GPE A;  2F5Z A;  2ZZ0 A;  2BS4 A;  1ZX9 A;  2A87 A;  3UOV A;  3P4P A;  5C3J A;  5FS6 A;  2XVE A;  1KNR A;  4K5S A;  3AEE A;  3CNS A;  2WDQ A;  3NYF A;  2WHD A;  4CBQ A;  3F8R A;  2XLS A;  1F8W A;  2YR6 A;  4A99 A;  5EB4 A;  1MO9 A;  1N1P A;  3P4R A;  1GRG A;  2C65 A;  5CQF A;  2WPE A;  2YLR A;  1PBE A;  5JCL A;  1KFY A;  1EL8 A;  1NHP A;  1KIF A;  2WP5 A;  3IWA A;  5U25 A;  4EMW A;  3CGC A;  4GCM A;  1IJH A;  2XLT A;  4A9W A;  5TR3 A;  3VRD B;  3OZ2 A;  4ZN0 A;  2TPR A;  3AEG A;  1BF3 A;  1L9E A;  1PBD A;  3ICR A;  4A6N A;  2R9Z A;  1M64 A;  1BWC A;  2OAM A;  3HZL A;  1H6V A;  3SFE A;  1PBF A;  2X99 A;  2YLZ A;  5DBJ A;  1V59 A;  1PXC A;  1BGJ A;  4II3 A;  1GRF A;  3ZYX A;  4H4Q A;  2V3B A;  2GF3 A;  3AE9 A;  3BI5 A;  1Y56 B;  3V76 A;  4RSL A;  4YTM A;  1IUV A;  4XWZ A;  2ACZ A;  4YJH A;  5ER0 A;  3T14 A;  2R0C A;  2YVF A;  3I3L A;  3UTH A;  4NEW A;  2NVK X;  2XLP A;  3QSE A;  3GDN A;  3NG7 X;  1NG4 A;  3KPF A;  3JSK A;  2C67 A;  2WET A;  4J36 A;  2GV8 A;  3NTD A;  2BXS A;  4NWZ A;  2XVI A;  4EM4 A;  3RP7 A;  2FBW A;  4OCG A;  4FK1 A;  4Z2U A;  5HXI A;  2V5Z A;  1E7P A;  1JNR A;  4H4Z A;  3M12 A;  4AOX A;  1ZOY A;  2BS3 A;  2XVJ A;  5HHF A;  3UKL A;  4CY6 A;  1E39 A;  2BK3 A;  2XFU A;  3ALL A;  3T0K A;  5JCM A;  4G6H A;  1COY A;  3LZX A;  4Y4N A;  3PS9 A;  5IPY A;  3AXB A;  1GRT A;  1OJT A;  2WP6 A;  2JB2 A;  4H4X A;  1O5W A;  2EQ8 A;  2VRM A;  2BS2 A;  1OJC A;  1NHR A;  3S5W A;  4A65 A;  3QSS A;  1B8S A;  2GR0 A;  2XDO A;  1H86 A;  1Y0P A;  2EQ7 A;  2WU2 A;  5BRT A;  2WDR A;  5HY5 A;  3PVC A;  1DJQ A;  2V6O A;  5KOX A;  5KXJ A;  2Q0K A;  1L9D A;  1C0L A;  1L0V A;  3T31 A;  3ZNQ A;  3AE6 A;  1XAN A;  2VQB A;  3V3O A;  3SYI A;  1PDH A;  3UOX A;  4ZCC A;  5IQ4 A;  2ARD A;  2WPC A;  3AED A;  5BUL A;  5GRT A;  2APG A;  2V61 A;  3V3N A;  1D7Y A;  1FEC A;  4GR1 A;  2WPF A;  1PHH A;  3EAO A;  1H82 A;  4J34 A;  4KPR A;  4N9X A;  3AEF A;  3NN6 X;  4REK A;  2WDV A;  4K8D A;  2GAH B;  1SEZ A;  4U8I A;  4B69 A;  1QLB A;  3CND A;  4RG3 A;  4TM1 A;  2GQW A;  3ITJ A;  3BNM A;  1B4V A;  3SFD A;  3UKH A;  4AT2 A;  2XYO A;  2B76 A;  5JCN A;  1GV4 A;  3EF6 A;  1RYI A;  3NK0 X;  3M13 A;  2Z5Y A;  1TDO A;  2ZZC A;  5IQ1 A;  5BUK A;  3BHK A;  3AEA A;  1EVI A;  4H2P A;  1CHU A;  4YJG B;  2IID A;  3VRA A;  3C96 A;  1ZK7 A;  4CCR A;  1TRB A;  5FMH A;  4OVI A;  3ZNP A;  1QO8 A;  1CBO A;  3IHG A;  5EB5 A;  2E82 A;  2BC1 A;  2C72 A;  1H7X A;  4G9K A;  2JKC A;  3KVE A;  4K22 A;  4PAB A;  2GRT A;  4U8O A;  1ONF A;  4YKG A;  3LXD A;  4OPD A;  2BRA A;  3EAN A;  2YLT A;  1FEB A;  4H7U A;  3SZW A;  4XXG A;  2WOI A;  3UKA A;  1EL9 A;  4B68 A;  3M0O A;  3AYL A;  4ZCD A;  1CL0 A;  5KNL A;  4YWO A;  3CGB A;  5CKU A;  3BI4 A;  1NPX A;  4GDP A;  2RGH A;  4GF7 A;  3LOV A;  3QVP A;  4TLZ A;  1PXA A;  2XFN A;  5GSN A;  1CC6 A;  1DOD A;  3FBS A;  5JCK A;  4USR A;  1F8S A;  1VG9 A;  5KOW A;  1VDC A;  5L46 A;  2YM1 A;  1PJ7 A;  1PN0 A;  3QSM A;  4U8L A;  1ZMC A;  1GES A;  4YJF B;  2B7S A;  3ICT A;  3T2Y A;  2Y6Q A;  1VRQ B;  2WOW A;  2QA1 A;  4HA6 A;  4BK3 A;  1N4W A;  3C4N A;  3Q9T A;  3RHA A;  4J57 A;  3BHF A;  4B64 A;  5BVA A;  3LB8 A;  4Z25 A;  1P2H A;  2V60 A;  5KMR A;  4UP3 A;  2EQ9 A;  5U63 A;  2R4J A;  1DXL A;  4ADW A;  2YG6 A;  3C4A A;  3NK2 X;  4FK1 C;  1OJD A;  3L1R A;  3UKK A;  1EL7 A;  4AP1 A;  4YSH A;  1BZL A;  3GWF A;  5EOW A;  4ICY A;  2C3D A;  3SY4 A;  3LAD A;  5KMS A;  3CIR A;  5KWF A;  1IUW A;  2DU8 A;  3ADA B;  4Z24 A;  4JN9 A;  2YWL A;  4Z44 A;  1PBC A;  1O94 A;  4U8M A;  1O95 A;  5J60 A;  3ZNN A;  2XFQ A;  4AT0 A;  4Y4M A;  4OPT A;  3KKJ A;  1LQT A;  5KRQ A;  1TDF A;  4RG4 A;  4XWR A;  1GND A;  4NNJ A;  1S2Q A;  3QFB A;  4J33 A;  1TDE A;  4H4Y A;  3UKP A;  3LJP A;  1C0I A;  2ZZB A;  4EIP A;  1E1N A;  3CTY A;  5M10 A;  2C76 A;  4A79 A;  2YVG A;  3P9U A;  1XDI A;  4A5L A;  4X4J A;  3VR9 A;  2DKH A;  1YQ3 A;  4YSX A;  2PHH A;  3DK9 A;  3RP8 A;  2UZZ A;  4TM4 A;  4USQ A;  3W4J A;  3GWD A;  3T37 A;  1C0K A;  4FX9 A;  2E49 A;  2GVC A;  2YVJ A;  4E0V A;  3GDP A;  2Q0L A;  3GMB A;  2I0Z A;  4MJW A;  2XVH A;  2AAQ A;  3ZDN A;  1L9C A;  4YJD A;  3DME A;  2GEW A;  3CGD A;  4LU6 A;  3NK1 X;  4FDC B;  4IVO B;  1RSG A;  2X8C A;  4HB9 A;  4OPG A;  1NAA A;  1JU2 A;  4U2T A;  3AE4 A;  4CRT A;  1DAO A;  2E5V A;  3NKS A;  4OPU A;  1Q1R A;  3WE0 A;  1NG3 A;  4H4S A;  3T2Z A;  3T2K A;  2GH5 A;  4Z43 A;  1H81 A;  2X3N A;  4Z2T A;  3AB1 A;  1E1M A;  1W4X A;  3CPI G;  3P1W A;  4GUV A;  1JRY A;  4TM0 A;  2JAE A;  2GR3 A;  1JNZ A;  3GMC A;  4JNQ A;  2XCG A;  2XVF A;  3ABV A;  2BAC A;  3RP6 A;  4EQS A;  1GOS A;  2FJA A;  3HYW A;  1E1L A;  2O9Z A;  4Y4L A;  1D5T A;  1LJ1 A;  2JB1 A;  3GD4 A;  1Y56 A;  2WU5 A;  3K7Q X;  1ZDL A;  1DDO A;  3G5R A;  4J31 A;  4NEV A;  4O5Q A;  4WX1 A;  2Q6U A;  2YQU A;  3ALJ A;  1ELI A;  1EBD A;  1RP0 A;  2YLW A;  4U8K A;  3EPT A;  3UKF A;  1REO A;  3NH3 X;  4Z2R A;  3GRT A;  1ZOV A;  1JRX A;  3NN0 X;  3VQR A;  4I58 A;  1Q1W A;  1LQU A;  3O0H A;  1NEN A;  1EL5 A;  4H4T A;  2Q7V A;  4I59 A;  2CDU A;  2XFO A;  2CUL A;  5KVI A;  1YQZ A;  2W0H A;  4C77 A;  1N4U A;  3NT6 A;  2VOU A;  3GYI A;  4GAV A;  2WBA A;  4B1B A;  2BCG G;  3AEB A;  2X50 A;  3NGC X;  3SQP A;  4K2X A;  3UP5 A;  5LV9 A;  1F3P A;  3L8K A;  3KA7 A;  4J56 A;  2C64 A;  3P4S A;  4H2N A;  4X9N A;  3FG2 P;  3DJG X;  3VR8 A;  4X9M A;  2BK4 A;  4IVM B;  4NTD A;  4UDR A;  1PJ5 A;  4EIQ A;  3NIX A;  3IHM A;  1GRA A;  4C5O A;  2XLU A;  3OC4 A;  1E1K A;  3CNP A;  4UDQ A;  1GSN A;  3DK4 A;  1KSU A;  4YSY A;  1F6M A;  2BXR A;  2VRL A;  1ZY8 A;  2VVL A;  2E4G A;  1UKV G;  4U8N A;  2OAL A;  1C0P A;  2FJE A;  3E1T A;  3H4K A;  2A89 A;  3AWI A;  3AE8 A;  1QJD A;  2R46 A;  2IVD A;  1X31 B;  2JB3 A;  1NDA A;  4D04 A;  1VG0 A;  2HQM A;  2X8G A;  4NZH A;  2BAB A;  1KNP A;  4EMJ A;  2B9Y A;  1P2E A;  4DSH A;  4YJG A;  2YG7 A;  4OPI A;  3CNJ A;  1HYU A;  4TLX A;  1NEK A;  3AEC A;  4K7Z A;  2X8H A;  3UTG A;  2YR4 A;  4JY3 A;  2GMH A;  3GRS A;  4O5U A;  3UKQ A;  4G73 A;  2VQ7 A;  4B65 A;  4EMI A;  3NYE A;  3CPJ G;  5HYM A;  1GRB A;  2BCP A;  2FJB A;  3DGZ A;  4JDR A;  3KU9 A;  3QJ4 A;  4IV9 A;  3BI2 A;  1H83 A;  3UOZ A;  1B37 A;  5M0Z A;  3NLC A;  4G6G A;  2E4A A;  3B3R A;  3IF9 A;  4OPC A;  2YR5 A;  4A6N B;  3AE5 A;  1LVL A;  1OJA A;  4EQW A;  3AE7 A;  3ATR A;  3CMM A;  2C3C A;  5FS9 A;  1OJ9 A;  1K4Q A;  1TYP A;  4U2L A;  4JNA A;  1YY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...