1Y69K

Rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
136
structure length
136
Chain Sequence
KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallography on ribosome recycling: mechanism of binding and action of RRF on the 50S ribosomal subunit
pubmed doi rcsb
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
source organism Escherichia coli
total genus 8
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1y69K01
1JJ2H 5MLCO 1VQNH 5AN9F 3G4SH 3CCJH 1S72H 1KD1J 4IOCJ 1YJWH 4IOAJ 3CXCH 1VQMH 5GAEN 5DM7J 3I55H 1YHQH 1YJNH 1Q82J 4WFNJ 5JVGJ 5DM6J 1VQ9H 1VQOH 3CC2H 2OTJH 4U67J 1Q86J 3PIPJ 2OTLH 3CPWH 5JVHJ 1Y69K 3CF5J 2ZJRJ 1N8RJ 1Q7YJ 1M1KJ 3J7ZM 2QA4H 4IO9J 3CCLH 5GAGN 3CCEH 4WCEJ 1K8AJ 1K9MJ 1KQSH 2ZJPJ 1YIJH 1Q81J 3G71H 4WFBJ 3CC4H 3CCVH 2ZJQJ 3CCUH 2QEXH 3CMEH 4UY8M 4WF9J 1VQPH 1NJIJ 1KC8J 1WKIA 3DLLJ 1VQKH 1VQ6H 3CMAH 3I56H 3G6EH 3CCRH 3OW2H 1W2BH 1QVFH 2PA2A 3CC7H 1QVGH 1YITH 1VQ4H 5GADN 5H1SO 1VQ7H 3CCSH 1M90J 5HL7J 1YI2H 1VQ8H 3PIOJ 1YJ9H 4WFAJ 1K73J 3CCQH 3CCMH 1VQ5H 1VQLH 3CD6H 5GAHN
chains in the Genus database with same CATH superfamily
4GA4A 5MLCO 1JJ2H 2Q5WE 3NS1C 1VQNH 5AN9F 3G4SH 4GA6A 1QAPA 3WO0A 5AYYA 3CCJH 2W3RB 1S72H 1KD1J 3WO1A 3FC4A 4IOCJ 1YJWH 4IOAJ 3C2OA 3CXCH 1VQMH 5EY3A 1YTEA 5GAEN 4ZOHA 5DM7J 3I55H 1YHQH 1YJNH 1ZXIB 1Q82J 4WFNJ 2TPTA 4EADA 4GA5A 2J0FA 1NVIE 3AM9A 4X46A 1FO4A 5DM6J 1SIJA 5JVGJ 1VQ9H 1VQOH 1V97A 2QIEA 5HUOA 1JRPB 3CC2H 2OTJH 3FAHA 1SB3A 4U67J 1Q86J 1UOUA 3PIPJ 2OTLH 3NRZC 4KWWA 5HUPA 4KWVA 2I1OA 3CPWH 5JVHJ 3C2EA 1Y69K 3L4PA 1N62B 1NVJA 3CF5J 2ZJRJ 1N8RJ 3VMMA 2B7NA 2WK6A 3L0GA 3EUB4 1WYGA 4C7YA 1Q7YJ 1M1KJ 1QPOA 1YTKA 2E3TA 3J7ZM 4EAFA 2W55B 1FM0E 2OMDA 2QA4H 4IO9J 1N60B 3CCLH 1OTPA 3AMZA 5GAGN 3CCEH 1VQLH 4WCEJ 2B7QA 3RPFA 1K9MJ 3NVYC 1K8AJ 1QPQA 1N61B 1QPRA 3TQVA 1KQSH 2ZJPJ 2DSJA 4XR5A 2I14A 1YIJH 1Q81J 3NVWC 3BIIE 3G71H 4WFBJ 3CC4H 3B9JC 5EP8A 1JROB 3CCVH 1VDVA 2ZJQJ 3SR6C 3CCUH 3C2RA 1FFVB 3AN1A 4USAA 2JBMA 2QEXH 3CMEH 4C7ZA 4YYYA 4UY8M 4WF9J 5MPOC 1VQPH 3GNNA 1KC8J 1NJIJ 1WKIA 4I9AA 3WNZA 4LHMA 1AZYA 3DLLJ 1X1OA 1VQKH 4YEKA 1VQ6H 1O4UA 3H5QA 2B7PA 3C2FA 3I56H 3CMAH 3G6EH 3CCRH 3OW2H 1W2BH 1QVFH 2PA2A 3CC7H 1QVGH 1YITH 3C2VA 2WK5A 1VQ4H 1FFUB 2WP4A 3PAJA 1FMAE 4AP8A 1N5XA 1N5WB 1RM6A 5GADN 1QPNA 3NVVC 4US8A 5H1SO 1FIQC 1YTDA 1VQ7H 3CCSH 4C80A 1M90J 3NVZC 5HL7J 5AYXA 1YI2H 1VQ8H 2W3SB 1BRWA 3PIOJ 5AYZA 1YJ9H 1VLBA 4WFAJ 1K73J 2W54B 4US9A 1DGJA 3CCQH 3CCMH 3ETRC 1VQ5H 1N63B 3CD6H 5HULA 5GAHN
chains in the Genus database with same CATH topology
1JJ2H 5MLCO 1VQNH 5AN9F 3G4SH 3CCJH 1S72H 1KD1J 4IOCJ 1YJWH 4IOAJ 3CXCH 1VQMH 5GAEN 5DM7J 3I55H 1YHQH 1YJNH 1Q82J 4WFNJ 5JVGJ 5DM6J 1VQ9H 1VQOH 3CC2H 2OTJH 4U67J 1Q86J 3PIPJ 2OTLH 3CPWH 5JVHJ 1Y69K 3CF5J 2ZJRJ 1N8RJ 1Q7YJ 1M1KJ 3J7ZM 2QA4H 4IO9J 3CCLH 5GAGN 3CCEH 4WCEJ 1K8AJ 1K9MJ 1KQSH 2ZJPJ 1YIJH 1Q81J 3G71H 4WFBJ 3CC4H 3CCVH 2ZJQJ 3CCUH 2QEXH 3CMEH 4UY8M 4WF9J 1VQPH 1NJIJ 1KC8J 1WKIA 3DLLJ 1VQKH 1VQ6H 3CMAH 3I56H 3G6EH 3CCRH 3OW2H 1W2BH 1QVFH 2PA2A 3CC7H 1QVGH 1YITH 1VQ4H 5GADN 5H1SO 1VQ7H 3CCSH 1M90J 5HL7J 1YI2H 1VQ8H 3PIOJ 1YJ9H 4WFAJ 1K73J 3CCQH 3CCMH 1VQ5H 1VQLH 3CD6H 5GAHN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 H;  5MLC O;  1VQN H;  5AN9 F;  3G4S H;  3CCJ H;  1S72 H;  1KD1 J;  4IOC J;  1YJW H;  4IOA J;  3CXC H;  1VQM H;  5GAE N;  5DM7 J;  3I55 H;  1YHQ H;  1YJN H;  1Q82 J;  4WFN J;  5JVG J;  5DM6 J;  1VQ9 H;  1VQO H;  3CC2 H;  2OTJ H;  4U67 J;  1Q86 J;  3PIP J;  2OTL H;  3CPW H;  5JVH J;  1Y69 K;  3CF5 J;  2ZJR J;  1N8R J;  1Q7Y J;  1M1K J;  3J7Z M;  2QA4 H;  4IO9 J;  3CCL H;  5GAG N;  3CCE H;  4WCE J;  1K8A J;  1K9M J;  1KQS H;  2ZJP J;  1YIJ H;  1Q81 J;  3G71 H;  4WFB J;  3CC4 H;  3CCV H;  2ZJQ J;  3CCU H;  2QEX H;  3CME H;  4UY8 M;  4WF9 J;  1VQP H;  1NJI J;  1KC8 J;  1WKI A;  3DLL J;  1VQK H;  1VQ6 H;  3CMA H;  3I56 H;  3G6E H;  3CCR H;  3OW2 H;  1W2B H;  1QVF H;  2PA2 A;  3CC7 H;  1QVG H;  1YIT H;  1VQ4 H;  5GAD N;  5H1S O;  1VQ7 H;  3CCS H;  1M90 J;  5HL7 J;  1YI2 H;  1VQ8 H;  3PIO J;  1YJ9 H;  4WFA J;  1K73 J;  3CCQ H;  3CCM H;  1VQ5 H;  1VQL H;  3CD6 H;  5GAH N; 
#chains in the Genus database with same CATH topology
 4GA4 A;  5MLC O;  1JJ2 H;  2Q5W E;  3NS1 C;  1VQN H;  5AN9 F;  3G4S H;  4GA6 A;  1QAP A;  3WO0 A;  5AYY A;  3CCJ H;  2W3R B;  1S72 H;  1KD1 J;  3WO1 A;  3FC4 A;  4IOC J;  1YJW H;  4IOA J;  3C2O A;  3CXC H;  1VQM H;  5EY3 A;  1YTE A;  5GAE N;  4ZOH A;  5DM7 J;  3I55 H;  1YHQ H;  1YJN H;  1ZXI B;  1Q82 J;  4WFN J;  2TPT A;  4EAD A;  4GA5 A;  2J0F A;  1NVI E;  3AM9 A;  4X46 A;  1FO4 A;  5DM6 J;  1SIJ A;  5JVG J;  1VQ9 H;  1VQO H;  1V97 A;  2QIE A;  5HUO A;  1JRP B;  3CC2 H;  2OTJ H;  3FAH A;  1SB3 A;  4U67 J;  1Q86 J;  1UOU A;  3PIP J;  2OTL H;  3NRZ C;  4KWW A;  5HUP A;  4KWV A;  2I1O A;  3CPW H;  5JVH J;  3C2E A;  1Y69 K;  3L4P A;  1N62 B;  1NVJ A;  3CF5 J;  2ZJR J;  1N8R J;  3VMM A;  2B7N A;  2WK6 A;  3L0G A;  3EUB 4;  1WYG A;  4C7Y A;  1Q7Y J;  1M1K J;  1QPO A;  1YTK A;  2E3T A;  3J7Z M;  4EAF A;  2W55 B;  1FM0 E;  2OMD A;  2QA4 H;  4IO9 J;  1N60 B;  3CCL H;  1OTP A;  3AMZ A;  5GAG N;  3CCE H;  1VQL H;  4WCE J;  2B7Q A;  3RPF A;  1K9M J;  3NVY C;  1K8A J;  1QPQ A;  1N61 B;  1QPR A;  3TQV A;  1KQS H;  2ZJP J;  2DSJ A;  4XR5 A;  2I14 A;  1YIJ H;  1Q81 J;  3NVW C;  3BII E;  3G71 H;  4WFB J;  3CC4 H;  3B9J C;  5EP8 A;  1JRO B;  3CCV H;  1VDV A;  2ZJQ J;  3SR6 C;  3CCU H;  3C2R A;  1FFV B;  3AN1 A;  4USA A;  2JBM A;  2QEX H;  3CME H;  4C7Z A;  4YYY A;  4UY8 M;  4WF9 J;  5MPO C;  1VQP H;  3GNN A;  1KC8 J;  1NJI J;  1WKI A;  4I9A A;  3WNZ A;  4LHM A;  1AZY A;  3DLL J;  1X1O A;  1VQK H;  4YEK A;  1VQ6 H;  1O4U A;  3H5Q A;  2B7P A;  3C2F A;  3I56 H;  3CMA H;  3G6E H;  3CCR H;  3OW2 H;  1W2B H;  1QVF H;  2PA2 A;  3CC7 H;  1QVG H;  1YIT H;  3C2V A;  2WK5 A;  1VQ4 H;  1FFU B;  2WP4 A;  3PAJ A;  1FMA E;  4AP8 A;  1N5X A;  1N5W B;  1RM6 A;  5GAD N;  1QPN A;  3NVV C;  4US8 A;  5H1S O;  1FIQ C;  1YTD A;  1VQ7 H;  3CCS H;  4C80 A;  1M90 J;  3NVZ C;  5HL7 J;  5AYX A;  1YI2 H;  1VQ8 H;  2W3S B;  1BRW A;  3PIO J;  5AYZ A;  1YJ9 H;  1VLB A;  4WFA J;  1K73 J;  2W54 B;  4US9 A;  1DGJ A;  3CCQ H;  3CCM H;  3ETR C;  1VQ5 H;  1N63 B;  3CD6 H;  5HUL A;  5GAH N; 
#chains in the Genus database with same CATH homology
 1JJ2 H;  5MLC O;  1VQN H;  5AN9 F;  3G4S H;  3CCJ H;  1S72 H;  1KD1 J;  4IOC J;  1YJW H;  4IOA J;  3CXC H;  1VQM H;  5GAE N;  5DM7 J;  3I55 H;  1YHQ H;  1YJN H;  1Q82 J;  4WFN J;  5JVG J;  5DM6 J;  1VQ9 H;  1VQO H;  3CC2 H;  2OTJ H;  4U67 J;  1Q86 J;  3PIP J;  2OTL H;  3CPW H;  5JVH J;  1Y69 K;  3CF5 J;  2ZJR J;  1N8R J;  1Q7Y J;  1M1K J;  3J7Z M;  2QA4 H;  4IO9 J;  3CCL H;  5GAG N;  3CCE H;  4WCE J;  1K8A J;  1K9M J;  1KQS H;  2ZJP J;  1YIJ H;  1Q81 J;  3G71 H;  4WFB J;  3CC4 H;  3CCV H;  2ZJQ J;  3CCU H;  2QEX H;  3CME H;  4UY8 M;  4WF9 J;  1VQP H;  1NJI J;  1KC8 J;  1WKI A;  3DLL J;  1VQK H;  1VQ6 H;  3CMA H;  3I56 H;  3G6E H;  3CCR H;  3OW2 H;  1W2B H;  1QVF H;  2PA2 A;  3CC7 H;  1QVG H;  1YIT H;  1VQ4 H;  5GAD N;  5H1S O;  1VQ7 H;  3CCS H;  1M90 J;  5HL7 J;  1YI2 H;  1VQ8 H;  3PIO J;  1YJ9 H;  4WFA J;  1K73 J;  3CCQ H;  3CCM H;  1VQ5 H;  1VQL H;  3CD6 H;  5GAH N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...