1YHQH

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
160
Chain Sequence
KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule keywords 23S Ribosomal RNA
molecule tags Ribosome
total genus 42
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1yhqH00
1YJNH 3PIPJ 3CCVH 1K73J 3CCJH 1VQ6H 1Y69K 1YJ9H 2OTLH 4WCEJ 1VQNH 2QA4H 1VQ5H 4U67J 5H1SO 1VQ4H 1YHQH 1YITH 1K9MJ 2PA2A 5DM7J 3CC4H 2ZJQJ 3DLLJ 1NJIJ 3CF5J 3I55H 5JVHJ 1VQ7H 1KD1J 3CCQH 5HL7J 1K8AJ 5AN9F 2OTJH 1M1KJ 3OW2H 2ZJRJ 5GAEN 1M90J 3CMEH 5MLCO 1N8RJ 4IOCJ 5GAGN 5GADN 1YJWH 5GAHN 1W2BH 1YI2H 1VQOH 1VQ8H 3CD6H 1JJ2H 3CXCH 4IO9J 2QEXH 3I56H 3CPWH 1Q7YJ 3PIOJ 4IOAJ 1VQLH 3J7ZM 1WKIA 1KC8J 1VQPH 4WFBJ 1QVFH 3CCEH 1VQMH 3CC7H 4WFAJ 1Q86J 3CCUH 3CCLH 1S72H 1KQSH 5DM6J 3CC2H 1VQKH 3CCRH 1Q81J 1YIJH 3G4SH 3CCMH 3CMAH 5JVGJ 1Q82J 3G71H 3CCSH 3G6EH 4UY8M 1VQ9H 4WFNJ 1QVGH 2ZJPJ 4WF9J
chains in the Genus database with same CATH superfamily
4USAA 1QPOA 1YJNH 2OMDA 3PIPJ 3WO0A 2B7QA 4YYYA 3CCVH 1QPQA 1K73J 3AMZA 3B9JC 3C2OA 1Y69K 1YJ9H 3CCJH 1VQ6H 2OTLH 4WCEJ 1QPNA 1VQNH 2QA4H 1VQ5H 4U67J 1FFVB 1YTDA 5H1SO 1VQ4H 1YHQH 1OTPA 1YITH 1K9MJ 2QIEA 2W55B 3FC4A 2I14A 2PA2A 5DM7J 3CC4H 2ZJQJ 1NVJA 3DLLJ 1NJIJ 2J0FA 5AYXA 2E3TA 3CF5J 3I55H 1SB3A 3AN1A 5JVHJ 1VQ7H 1N5WB 4GA4A 4EAFA 4US8A 1X1OA 4GA5A 4KWVA 3PAJA 5EY3A 1WYGA 1N61B 1KD1J 4AP8A 4C7ZA 3CCQH 5AYZA 5HL7J 1K8AJ 4KWWA 5AN9F 2W3RB 1FMAE 4I9AA 2OTJH 1M1KJ 3OW2H 1VLBA 2WK6A 3L4PA 3NVYC 2ZJRJ 5GAEN 1M90J 5HULA 3CMEH 1V97A 3WNZA 1AZYA 3VMMA 2TPTA 5MLCO 1N8RJ 3RPFA 1FFUB 3NS1C 1O4UA 3SR6C 4IOCJ 3H5QA 3TQVA 5GADN 5GAGN 1N60B 2I1OA 3C2VA 1YJWH 5GAHN 1JRPB 1N62B 1BRWA 1W2BH 5AYYA 3GNNA 1YI2H 1VQOH 1VDVA 3NVVC 1DGJA 1FO4A 1VQ8H 3NVWC 3CD6H 1JJ2H 3CXCH 4IO9J 2QEXH 3I56H 2B7PA 1FM0E 3CPWH 1Q7YJ 3PIOJ 4IOAJ 1SIJA 1RM6A 3J7ZM 2W3SB 1VQLH 4C80A 1WKIA 5HUOA 3ETRC 4LHMA 1KC8J 1N63B 1VQPH 4WFBJ 3AM9A 1QAPA 1YTEA 2W54B 1QVFH 3CCEH 1VQMH 3CC7H 1FIQC 1YTKA 2JBMA 4WFAJ 1Q86J 4EADA 5EP8A 3CCUH 3CCLH 1S72H 5MPOC 1KQSH 5DM6J 1N5XA 1NVIE 3EUB4 4GA6A 3C2FA 3CC2H 1VQKH 5HUPA 3C2RA 1UOUA 1JROB 4US9A 1ZXIB 2DSJA 3CCRH 1Q81J 3FAHA 3BIIE 4ZOHA 1YIJH 3G4SH 3CCMH 1QPRA 3WO1A 3L0GA 2WP4A 3CMAH 5JVGJ 1Q82J 3G71H 3CCSH 3G6EH 3C2EA 2B7NA 4C7YA 4UY8M 2Q5WE 1VQ9H 3NRZC 4XR5A 4X46A 4WFNJ 4YEKA 1QVGH 2ZJPJ 4WF9J 3NVZC 2WK5A
chains in the Genus database with same CATH topology
1YJNH 3PIPJ 3CCVH 1K73J 3CCJH 1VQ6H 1Y69K 1YJ9H 2OTLH 4WCEJ 1VQNH 2QA4H 1VQ5H 4U67J 5H1SO 1VQ4H 1YHQH 1YITH 1K9MJ 2PA2A 5DM7J 3CC4H 2ZJQJ 3DLLJ 1NJIJ 3CF5J 3I55H 5JVHJ 1VQ7H 1KD1J 3CCQH 5HL7J 1K8AJ 5AN9F 2OTJH 1M1KJ 3OW2H 2ZJRJ 5GAEN 1M90J 3CMEH 5MLCO 1N8RJ 4IOCJ 5GAGN 5GADN 1YJWH 5GAHN 1W2BH 1YI2H 1VQOH 1VQ8H 3CD6H 1JJ2H 3CXCH 4IO9J 2QEXH 3I56H 3CPWH 1Q7YJ 3PIOJ 4IOAJ 1VQLH 3J7ZM 1WKIA 1KC8J 1VQPH 4WFBJ 1QVFH 3CCEH 1VQMH 3CC7H 4WFAJ 1Q86J 3CCUH 3CCLH 1S72H 1KQSH 5DM6J 3CC2H 1VQKH 3CCRH 1Q81J 1YIJH 3G4SH 3CCMH 3CMAH 5JVGJ 1Q82J 3G71H 3CCSH 3G6EH 4UY8M 1VQ9H 4WFNJ 1QVGH 2ZJPJ 4WF9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN H;  3PIP J;  3CCV H;  1K73 J;  3CCJ H;  1VQ6 H;  1Y69 K;  1YJ9 H;  2OTL H;  4WCE J;  1VQN H;  2QA4 H;  1VQ5 H;  4U67 J;  5H1S O;  1VQ4 H;  1YHQ H;  1YIT H;  1K9M J;  2PA2 A;  5DM7 J;  3CC4 H;  2ZJQ J;  3DLL J;  1NJI J;  3CF5 J;  3I55 H;  5JVH J;  1VQ7 H;  1KD1 J;  3CCQ H;  5HL7 J;  1K8A J;  5AN9 F;  2OTJ H;  1M1K J;  3OW2 H;  2ZJR J;  5GAE N;  1M90 J;  3CME H;  5MLC O;  1N8R J;  4IOC J;  5GAG N;  5GAD N;  1YJW H;  5GAH N;  1W2B H;  1YI2 H;  1VQO H;  1VQ8 H;  3CD6 H;  1JJ2 H;  3CXC H;  4IO9 J;  2QEX H;  3I56 H;  3CPW H;  1Q7Y J;  3PIO J;  4IOA J;  1VQL H;  3J7Z M;  1WKI A;  1KC8 J;  1VQP H;  4WFB J;  1QVF H;  3CCE H;  1VQM H;  3CC7 H;  4WFA J;  1Q86 J;  3CCU H;  3CCL H;  1S72 H;  1KQS H;  5DM6 J;  3CC2 H;  1VQK H;  3CCR H;  1Q81 J;  1YIJ H;  3G4S H;  3CCM H;  3CMA H;  5JVG J;  1Q82 J;  3G71 H;  3CCS H;  3G6E H;  4UY8 M;  1VQ9 H;  4WFN J;  1QVG H;  2ZJP J;  4WF9 J; 
#chains in the Genus database with same CATH topology
 4USA A;  1QPO A;  1YJN H;  2OMD A;  3PIP J;  3WO0 A;  2B7Q A;  4YYY A;  3CCV H;  1QPQ A;  1K73 J;  3AMZ A;  3B9J C;  3C2O A;  1Y69 K;  1YJ9 H;  3CCJ H;  1VQ6 H;  2OTL H;  4WCE J;  1QPN A;  1VQN H;  2QA4 H;  1VQ5 H;  4U67 J;  1FFV B;  1YTD A;  5H1S O;  1VQ4 H;  1YHQ H;  1OTP A;  1YIT H;  1K9M J;  2QIE A;  2W55 B;  3FC4 A;  2I14 A;  2PA2 A;  5DM7 J;  3CC4 H;  2ZJQ J;  1NVJ A;  3DLL J;  1NJI J;  2J0F A;  5AYX A;  2E3T A;  3CF5 J;  3I55 H;  1SB3 A;  3AN1 A;  5JVH J;  1VQ7 H;  1N5W B;  4GA4 A;  4EAF A;  4US8 A;  1X1O A;  4GA5 A;  4KWV A;  3PAJ A;  5EY3 A;  1WYG A;  1N61 B;  1KD1 J;  4AP8 A;  4C7Z A;  3CCQ H;  5AYZ A;  5HL7 J;  1K8A J;  4KWW A;  5AN9 F;  2W3R B;  1FMA E;  4I9A A;  2OTJ H;  1M1K J;  3OW2 H;  1VLB A;  2WK6 A;  3L4P A;  3NVY C;  2ZJR J;  5GAE N;  1M90 J;  5HUL A;  3CME H;  1V97 A;  3WNZ A;  1AZY A;  3VMM A;  2TPT A;  5MLC O;  1N8R J;  3RPF A;  1FFU B;  3NS1 C;  1O4U A;  3SR6 C;  4IOC J;  3H5Q A;  3TQV A;  5GAD N;  5GAG N;  1N60 B;  2I1O A;  3C2V A;  1YJW H;  5GAH N;  1JRP B;  1N62 B;  1BRW A;  1W2B H;  5AYY A;  3GNN A;  1YI2 H;  1VQO H;  1VDV A;  3NVV C;  1DGJ A;  1FO4 A;  1VQ8 H;  3NVW C;  3CD6 H;  1JJ2 H;  3CXC H;  4IO9 J;  2QEX H;  3I56 H;  2B7P A;  1FM0 E;  3CPW H;  1Q7Y J;  3PIO J;  4IOA J;  1SIJ A;  1RM6 A;  3J7Z M;  2W3S B;  1VQL H;  4C80 A;  1WKI A;  5HUO A;  3ETR C;  4LHM A;  1KC8 J;  1N63 B;  1VQP H;  4WFB J;  3AM9 A;  1QAP A;  1YTE A;  2W54 B;  1QVF H;  3CCE H;  1VQM H;  3CC7 H;  1FIQ C;  1YTK A;  2JBM A;  4WFA J;  1Q86 J;  4EAD A;  5EP8 A;  3CCU H;  3CCL H;  1S72 H;  5MPO C;  1KQS H;  5DM6 J;  1N5X A;  1NVI E;  3EUB 4;  4GA6 A;  3C2F A;  3CC2 H;  1VQK H;  5HUP A;  3C2R A;  1UOU A;  1JRO B;  4US9 A;  1ZXI B;  2DSJ A;  3CCR H;  1Q81 J;  3FAH A;  3BII E;  4ZOH A;  1YIJ H;  3G4S H;  3CCM H;  1QPR A;  3WO1 A;  3L0G A;  2WP4 A;  3CMA H;  5JVG J;  1Q82 J;  3G71 H;  3CCS H;  3G6E H;  3C2E A;  2B7N A;  4C7Y A;  4UY8 M;  2Q5W E;  1VQ9 H;  3NRZ C;  4XR5 A;  4X46 A;  4WFN J;  4YEK A;  1QVG H;  2ZJP J;  4WF9 J;  3NVZ C;  2WK5 A; 
#chains in the Genus database with same CATH homology
 1YJN H;  3PIP J;  3CCV H;  1K73 J;  3CCJ H;  1VQ6 H;  1Y69 K;  1YJ9 H;  2OTL H;  4WCE J;  1VQN H;  2QA4 H;  1VQ5 H;  4U67 J;  5H1S O;  1VQ4 H;  1YHQ H;  1YIT H;  1K9M J;  2PA2 A;  5DM7 J;  3CC4 H;  2ZJQ J;  3DLL J;  1NJI J;  3CF5 J;  3I55 H;  5JVH J;  1VQ7 H;  1KD1 J;  3CCQ H;  5HL7 J;  1K8A J;  5AN9 F;  2OTJ H;  1M1K J;  3OW2 H;  2ZJR J;  5GAE N;  1M90 J;  3CME H;  5MLC O;  1N8R J;  4IOC J;  5GAG N;  5GAD N;  1YJW H;  5GAH N;  1W2B H;  1YI2 H;  1VQO H;  1VQ8 H;  3CD6 H;  1JJ2 H;  3CXC H;  4IO9 J;  2QEX H;  3I56 H;  3CPW H;  1Q7Y J;  3PIO J;  4IOA J;  1VQL H;  3J7Z M;  1WKI A;  1KC8 J;  1VQP H;  4WFB J;  1QVF H;  3CCE H;  1VQM H;  3CC7 H;  4WFA J;  1Q86 J;  3CCU H;  3CCL H;  1S72 H;  1KQS H;  5DM6 J;  3CC2 H;  1VQK H;  3CCR H;  1Q81 J;  1YIJ H;  3G4S H;  3CCM H;  3CMA H;  5JVG J;  1Q82 J;  3G71 H;  3CCS H;  3G6E H;  4UY8 M;  1VQ9 H;  4WFN J;  1QVG H;  2ZJP J;  4WF9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...