1YIJH

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
171
structure length
160
Chain Sequence
KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule keywords 23S Ribosomal RNA
molecule tags Ribosome
total genus 39
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1yijH00
4IOCJ 5JVHJ 1YHQH 1Q81J 3G6EH 4WF9J 1S72H 5HL7J 1QVFH 1YIJH 1YI2H 1VQPH 4U67J 5JVGJ 2OTJH 1YJ9H 1JJ2H 3G4SH 3CCQH 3I55H 1M1KJ 1KQSH 3CCUH 3CMEH 5MLCO 3CMAH 3CF5J 5GAHN 3CC2H 3CCVH 4IOAJ 1N8RJ 1M90J 1VQLH 3CCMH 3CCJH 3PIPJ 1NJIJ 1VQ7H 1VQ5H 5H1SO 1Q82J 3J7ZM 3G71H 1YJNH 1VQ6H 1VQKH 1VQMH 1KD1J 1W2BH 5GADN 4WFNJ 4WFBJ 3CCLH 1QVGH 4IO9J 3PIOJ 5GAGN 2OTLH 2ZJQJ 2ZJPJ 2PA2A 4UY8M 1WKIA 3CCRH 1K73J 1VQOH 1Y69K 1VQ8H 1VQ9H 1Q7YJ 3CXCH 1KC8J 3I56H 3CC7H 3CPWH 3DLLJ 4WCEJ 1YJWH 1VQNH 5AN9F 2ZJRJ 3OW2H 1Q86J 5DM7J 3CCSH 3CC4H 5DM6J 1VQ4H 2QEXH 3CD6H 1YITH 3CCEH 1K9MJ 1K8AJ 4WFAJ 5GAEN 2QA4H
chains in the Genus database with same CATH superfamily
1SB3A 2I1OA 4AP8A 4C80A 3RPFA 2WK5A 4YYYA 2W3RB 1YTKA 4IOCJ 5JVHJ 3C2FA 3AM9A 1YHQH 1Q81J 4YEKA 3G6EH 1YTEA 1FMAE 2DSJA 3SR6C 3FAHA 4WF9J 1S72H 3AMZA 1NVIE 5HL7J 2B7NA 2B7PA 1QVFH 4GA6A 4X46A 4US9A 4ZOHA 3L4PA 5HULA 1YIJH 1YI2H 4USAA 1VQPH 1QPRA 4U67J 1X1OA 5JVGJ 2OTJH 1YJ9H 4XR5A 1JJ2H 3G4SH 3CCQH 3I55H 1M1KJ 3WNZA 1KQSH 3C2EA 3NVVC 3CCUH 3CMEH 4EADA 5MLCO 3NVWC 3CMAH 1V97A 3CF5J 1OTPA 5GAHN 3C2VA 3CC2H 3CCVH 4IOAJ 1N8RJ 3B9JC 5AYXA 1M90J 5HUPA 1VQLH 2J0FA 3CCMH 3CCJH 1SIJA 1VLBA 3PIPJ 2OMDA 2W54B 1N5XA 2W3SB 1N62B 1JROB 1YTDA 1NJIJ 3NRZC 2B7QA 1ZXIB 1VQ7H 1FIQC 1FFUB 1VQ5H 3H5QA 5H1SO 2JBMA 1Q82J 1RM6A 3J7ZM 3G71H 3PAJA 1YJNH 3NVZC 3EUB4 1N5WB 3BIIE 2E3TA 1VQ6H 2QA4H 1VQKH 1VQMH 1KD1J 1W2BH 5GADN 4WFNJ 4WFBJ 1FFVB 1WYGA 3CCLH 1N61B 1QAPA 4I9AA 4US8A 1QVGH 4GA4A 4IO9J 3PIOJ 5GAGN 2OTLH 2ZJQJ 2WP4A 2ZJPJ 2PA2A 4UY8M 1WKIA 3CCRH 3ETRC 1K73J 1VQOH 1Y69K 1VQ8H 1VQ9H 1Q7YJ 4GA5A 4C7YA 1AZYA 5HUOA 3CXCH 1KC8J 1N63B 4EAFA 3I56H 3CC7H 3CPWH 3DLLJ 3AN1A 1FO4A 4WCEJ 1QPNA 1YJWH 3GNNA 1VQNH 1NVJA 5AN9F 1O4UA 5EP8A 3OW2H 2ZJRJ 1Q86J 5MPOC 1FM0E 3TQVA 2WK6A 5DM7J 1QPOA 3NVYC 3CC4H 1QPQA 4C7ZA 3CCSH 4KWVA 1VDVA 1UOUA 5DM6J 2TPTA 1VQ4H 3WO1A 2Q5WE 1JRPB 3FC4A 4KWWA 3WO0A 4LHMA 2QEXH 3CD6H 2QIEA 3VMMA 3CCEH 1YITH 1K9MJ 5EY3A 5AYYA 1K8AJ 1BRWA 5AYZA 3NS1C 3L0GA 4WFAJ 2I14A 2W55B 5GAEN 1DGJA 3C2RA 3C2OA 1N60B
chains in the Genus database with same CATH topology
4IOCJ 5JVHJ 1YHQH 1Q81J 3G6EH 4WF9J 1S72H 5HL7J 1QVFH 1YIJH 1YI2H 1VQPH 4U67J 5JVGJ 2OTJH 1YJ9H 1JJ2H 3G4SH 3CCQH 3I55H 1M1KJ 1KQSH 3CCUH 3CMEH 5MLCO 3CMAH 3CF5J 5GAHN 3CC2H 3CCVH 4IOAJ 1N8RJ 1M90J 1VQLH 3CCMH 3CCJH 3PIPJ 1NJIJ 1VQ7H 1VQ5H 5H1SO 1Q82J 3J7ZM 3G71H 1YJNH 1VQ6H 1VQKH 1VQMH 1KD1J 1W2BH 5GADN 4WFNJ 4WFBJ 3CCLH 1QVGH 4IO9J 3PIOJ 5GAGN 2OTLH 2ZJQJ 2ZJPJ 2PA2A 4UY8M 1WKIA 3CCRH 1K73J 1VQOH 1Y69K 1VQ8H 1VQ9H 1Q7YJ 3CXCH 1KC8J 3I56H 3CC7H 3CPWH 3DLLJ 4WCEJ 1YJWH 1VQNH 5AN9F 2ZJRJ 3OW2H 1Q86J 5DM7J 3CCSH 3CC4H 5DM6J 1VQ4H 2QEXH 3CD6H 1YITH 3CCEH 1K9MJ 1K8AJ 4WFAJ 5GAEN 2QA4H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOC J;  5JVH J;  1YHQ H;  1Q81 J;  3G6E H;  4WF9 J;  1S72 H;  5HL7 J;  1QVF H;  1YIJ H;  1YI2 H;  1VQP H;  4U67 J;  5JVG J;  2OTJ H;  1YJ9 H;  1JJ2 H;  3G4S H;  3CCQ H;  3I55 H;  1M1K J;  1KQS H;  3CCU H;  3CME H;  5MLC O;  3CMA H;  3CF5 J;  5GAH N;  3CC2 H;  3CCV H;  4IOA J;  1N8R J;  1M90 J;  1VQL H;  3CCM H;  3CCJ H;  3PIP J;  1NJI J;  1VQ7 H;  1VQ5 H;  5H1S O;  1Q82 J;  3J7Z M;  3G71 H;  1YJN H;  1VQ6 H;  1VQK H;  1VQM H;  1KD1 J;  1W2B H;  5GAD N;  4WFN J;  4WFB J;  3CCL H;  1QVG H;  4IO9 J;  3PIO J;  5GAG N;  2OTL H;  2ZJQ J;  2ZJP J;  2PA2 A;  4UY8 M;  1WKI A;  3CCR H;  1K73 J;  1VQO H;  1Y69 K;  1VQ8 H;  1VQ9 H;  1Q7Y J;  3CXC H;  1KC8 J;  3I56 H;  3CC7 H;  3CPW H;  3DLL J;  4WCE J;  1YJW H;  1VQN H;  5AN9 F;  2ZJR J;  3OW2 H;  1Q86 J;  5DM7 J;  3CCS H;  3CC4 H;  5DM6 J;  1VQ4 H;  2QEX H;  3CD6 H;  1YIT H;  3CCE H;  1K9M J;  1K8A J;  4WFA J;  5GAE N;  2QA4 H; 
#chains in the Genus database with same CATH topology
 1SB3 A;  2I1O A;  4AP8 A;  4C80 A;  3RPF A;  2WK5 A;  4YYY A;  2W3R B;  1YTK A;  4IOC J;  5JVH J;  3C2F A;  3AM9 A;  1YHQ H;  1Q81 J;  4YEK A;  3G6E H;  1YTE A;  1FMA E;  2DSJ A;  3SR6 C;  3FAH A;  4WF9 J;  1S72 H;  3AMZ A;  1NVI E;  5HL7 J;  2B7N A;  2B7P A;  1QVF H;  4GA6 A;  4X46 A;  4US9 A;  4ZOH A;  3L4P A;  5HUL A;  1YIJ H;  1YI2 H;  4USA A;  1VQP H;  1QPR A;  4U67 J;  1X1O A;  5JVG J;  2OTJ H;  1YJ9 H;  4XR5 A;  1JJ2 H;  3G4S H;  3CCQ H;  3I55 H;  1M1K J;  3WNZ A;  1KQS H;  3C2E A;  3NVV C;  3CCU H;  3CME H;  4EAD A;  5MLC O;  3NVW C;  3CMA H;  1V97 A;  3CF5 J;  1OTP A;  5GAH N;  3C2V A;  3CC2 H;  3CCV H;  4IOA J;  1N8R J;  3B9J C;  5AYX A;  1M90 J;  5HUP A;  1VQL H;  2J0F A;  3CCM H;  3CCJ H;  1SIJ A;  1VLB A;  3PIP J;  2OMD A;  2W54 B;  1N5X A;  2W3S B;  1N62 B;  1JRO B;  1YTD A;  1NJI J;  3NRZ C;  2B7Q A;  1ZXI B;  1VQ7 H;  1FIQ C;  1FFU B;  1VQ5 H;  3H5Q A;  5H1S O;  2JBM A;  1Q82 J;  1RM6 A;  3J7Z M;  3G71 H;  3PAJ A;  1YJN H;  3NVZ C;  3EUB 4;  1N5W B;  3BII E;  2E3T A;  1VQ6 H;  2QA4 H;  1VQK H;  1VQM H;  1KD1 J;  1W2B H;  5GAD N;  4WFN J;  4WFB J;  1FFV B;  1WYG A;  3CCL H;  1N61 B;  1QAP A;  4I9A A;  4US8 A;  1QVG H;  4GA4 A;  4IO9 J;  3PIO J;  5GAG N;  2OTL H;  2ZJQ J;  2WP4 A;  2ZJP J;  2PA2 A;  4UY8 M;  1WKI A;  3CCR H;  3ETR C;  1K73 J;  1VQO H;  1Y69 K;  1VQ8 H;  1VQ9 H;  1Q7Y J;  4GA5 A;  4C7Y A;  1AZY A;  5HUO A;  3CXC H;  1KC8 J;  1N63 B;  4EAF A;  3I56 H;  3CC7 H;  3CPW H;  3DLL J;  3AN1 A;  1FO4 A;  4WCE J;  1QPN A;  1YJW H;  3GNN A;  1VQN H;  1NVJ A;  5AN9 F;  1O4U A;  5EP8 A;  3OW2 H;  2ZJR J;  1Q86 J;  5MPO C;  1FM0 E;  3TQV A;  2WK6 A;  5DM7 J;  1QPO A;  3NVY C;  3CC4 H;  1QPQ A;  4C7Z A;  3CCS H;  4KWV A;  1VDV A;  1UOU A;  5DM6 J;  2TPT A;  1VQ4 H;  3WO1 A;  2Q5W E;  1JRP B;  3FC4 A;  4KWW A;  3WO0 A;  4LHM A;  2QEX H;  3CD6 H;  2QIE A;  3VMM A;  3CCE H;  1YIT H;  1K9M J;  5EY3 A;  5AYY A;  1K8A J;  1BRW A;  5AYZ A;  3NS1 C;  3L0G A;  4WFA J;  2I14 A;  2W55 B;  5GAE N;  1DGJ A;  3C2R A;  3C2O A;  1N60 B; 
#chains in the Genus database with same CATH homology
 4IOC J;  5JVH J;  1YHQ H;  1Q81 J;  3G6E H;  4WF9 J;  1S72 H;  5HL7 J;  1QVF H;  1YIJ H;  1YI2 H;  1VQP H;  4U67 J;  5JVG J;  2OTJ H;  1YJ9 H;  1JJ2 H;  3G4S H;  3CCQ H;  3I55 H;  1M1K J;  1KQS H;  3CCU H;  3CME H;  5MLC O;  3CMA H;  3CF5 J;  5GAH N;  3CC2 H;  3CCV H;  4IOA J;  1N8R J;  1M90 J;  1VQL H;  3CCM H;  3CCJ H;  3PIP J;  1NJI J;  1VQ7 H;  1VQ5 H;  5H1S O;  1Q82 J;  3J7Z M;  3G71 H;  1YJN H;  1VQ6 H;  1VQK H;  1VQM H;  1KD1 J;  1W2B H;  5GAD N;  4WFN J;  4WFB J;  3CCL H;  1QVG H;  4IO9 J;  3PIO J;  5GAG N;  2OTL H;  2ZJQ J;  2ZJP J;  2PA2 A;  4UY8 M;  1WKI A;  3CCR H;  1K73 J;  1VQO H;  1Y69 K;  1VQ8 H;  1VQ9 H;  1Q7Y J;  3CXC H;  1KC8 J;  3I56 H;  3CC7 H;  3CPW H;  3DLL J;  4WCE J;  1YJW H;  1VQN H;  5AN9 F;  2ZJR J;  3OW2 H;  1Q86 J;  5DM7 J;  3CCS H;  3CC4 H;  5DM6 J;  1VQ4 H;  2QEX H;  3CD6 H;  1YIT H;  3CCE H;  1K9M J;  1K8A J;  4WFA J;  5GAE N;  2QA4 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...