1YJWH

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
171
structure length
160
Chain Sequence
KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome/antibiotic
total genus 38
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1yjwH00
5AN9F 3DLLJ 3CCMH 3G6EH 1K9MJ 2ZJPJ 3CCRH 3CCLH 3CXCH 1VQ7H 1YHQH 1VQOH 3CF5J 5H1SO 1KC8J 1K8AJ 3J7ZM 1Q82J 1YITH 1NJIJ 1YJ9H 1WKIA 5JVGJ 1N8RJ 2PA2A 1K73J 1VQ4H 5GADN 5DM7J 3CD6H 1Q7YJ 5GAHN 3CC2H 1VQNH 4IOAJ 1M90J 1Q86J 3I56H 1YJWH 4UY8M 4WFAJ 3CCUH 1VQ5H 1S72H 3G71H 3CC4H 3CCEH 2OTJH 1VQ9H 3G4SH 3CMAH 3CPWH 4U67J 2ZJQJ 4WCEJ 3OW2H 4WF9J 2QA4H 1Q81J 3CCQH 3CC7H 2OTLH 5MLCO 1VQ8H 1JJ2H 1VQLH 1VQKH 1VQMH 4WFNJ 5GAGN 1W2BH 5JVHJ 1VQ6H 1VQPH 1QVFH 1Y69K 4IOCJ 5DM6J 3I55H 5HL7J 1KQSH 1YI2H 1YJNH 1QVGH 1M1KJ 3PIPJ 2QEXH 3CCVH 4IO9J 3CCSH 1YIJH 3CMEH 3PIOJ 5GAEN 4WFBJ 2ZJRJ 3CCJH 1KD1J
chains in the Genus database with same CATH superfamily
2WK5A 4KWVA 5AN9F 3DLLJ 4AP8A 3CCMH 3G6EH 1K9MJ 3AMZA 2ZJPJ 3BIIE 3CCRH 1BRWA 3CCLH 5HUPA 3SR6C 5AYXA 3ETRC 3CXCH 1VQ7H 1YTKA 1YHQH 3H5QA 1VQOH 3WNZA 3CF5J 2B7NA 5H1SO 1KC8J 1K8AJ 3J7ZM 3RPFA 3FC4A 1Q82J 1YITH 1NJIJ 1YJ9H 3NVWC 1WKIA 5JVGJ 1N8RJ 2PA2A 4GA4A 4XR5A 1K73J 1VQ4H 2W3RB 3L4PA 3NVYC 2TPTA 5EY3A 1X1OA 5GADN 5DM7J 3CD6H 3VMMA 3WO0A 1Q7YJ 3C2OA 5GAHN 3CC2H 2JBMA 1VQNH 1FM0E 1SIJA 4IOAJ 1M90J 1Q86J 1OTPA 3I56H 1YJWH 1FMAE 4UY8M 3C2FA 1N63B 4EADA 4WFAJ 1UOUA 3CCUH 1VQ5H 1S72H 3C2EA 3G71H 3CC4H 2W54B 3CCEH 2OTJH 1VQ9H 3NRZC 4C7ZA 3FAHA 3G4SH 4US8A 3CMAH 3CPWH 3TQVA 4U67J 1AZYA 5MPOC 1FO4A 4WCEJ 1SB3A 2WK6A 2ZJQJ 2E3TA 2W55B 1ZXIB 3OW2H 1YTDA 1VDVA 4YYYA 1RM6A 3EUB4 1V97A 4GA5A 1JRPB 1QPNA 2I1OA 1QVFH 2I14A 1FFVB 5HUOA 4WF9J 2WP4A 3PAJA 2QA4H 1FFUB 1Q81J 3CCQH 1DGJA 1WYGA 2DSJA 1YTEA 3CC7H 1VLBA 2OTLH 5HULA 5MLCO 1VQ8H 1JJ2H 1NVIE 1VQLH 4GA6A 1VQKH 4I9AA 1VQMH 2W3SB 4WFNJ 5GAGN 3NS1C 2Q5WE 1N60B 1W2BH 1FIQC 3C2VA 5JVHJ 1VQPH 1Y69K 1N62B 5EP8A 1VQ6H 3AM9A 2OMDA 4ZOHA 2B7QA 4IOCJ 4X46A 5DM6J 4LHMA 1JROB 1QAPA 3I55H 1O4UA 4C80A 3NVZC 4US9A 1QPQA 5HL7J 1N61B 3B9JC 4KWWA 1KQSH 1NVJA 5AYYA 1YI2H 4YEKA 1YJNH 1QVGH 3AN1A 1QPRA 2QIEA 3L0GA 4EAFA 1N5WB 3PIPJ 3GNNA 2QEXH 1M1KJ 5AYZA 3WO1A 3CCVH 2B7PA 4IO9J 3CCSH 1YIJH 3CMEH 1QPOA 4C7YA 3PIOJ 4USAA 5GAEN 4WFBJ 2J0FA 2ZJRJ 1N5XA 3CCJH 1KD1J 3C2RA 3NVVC
chains in the Genus database with same CATH topology
5AN9F 3DLLJ 3CCMH 3G6EH 1K9MJ 2ZJPJ 3CCRH 3CCLH 3CXCH 1VQ7H 1YHQH 1VQOH 3CF5J 5H1SO 1KC8J 1K8AJ 3J7ZM 1Q82J 1YITH 1NJIJ 1YJ9H 1WKIA 5JVGJ 1N8RJ 2PA2A 1K73J 1VQ4H 5GADN 5DM7J 3CD6H 1Q7YJ 5GAHN 3CC2H 1VQNH 4IOAJ 1M90J 1Q86J 3I56H 1YJWH 4UY8M 4WFAJ 3CCUH 1VQ5H 1S72H 3G71H 3CC4H 3CCEH 2OTJH 1VQ9H 3G4SH 3CMAH 3CPWH 4U67J 2ZJQJ 4WCEJ 3OW2H 4WF9J 2QA4H 1Q81J 3CCQH 3CC7H 2OTLH 5MLCO 1VQ8H 1JJ2H 1VQLH 1VQKH 1VQMH 4WFNJ 5GAGN 1W2BH 5JVHJ 1VQ6H 1VQPH 1QVFH 1Y69K 4IOCJ 5DM6J 3I55H 5HL7J 1KQSH 1YI2H 1YJNH 1QVGH 1M1KJ 3PIPJ 2QEXH 3CCVH 4IO9J 3CCSH 1YIJH 3CMEH 3PIOJ 5GAEN 4WFBJ 2ZJRJ 3CCJH 1KD1J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AN9 F;  3DLL J;  3CCM H;  3G6E H;  1K9M J;  2ZJP J;  3CCR H;  3CCL H;  3CXC H;  1VQ7 H;  1YHQ H;  1VQO H;  3CF5 J;  5H1S O;  1KC8 J;  1K8A J;  3J7Z M;  1Q82 J;  1YIT H;  1NJI J;  1YJ9 H;  1WKI A;  5JVG J;  1N8R J;  2PA2 A;  1K73 J;  1VQ4 H;  5GAD N;  5DM7 J;  3CD6 H;  1Q7Y J;  5GAH N;  3CC2 H;  1VQN H;  4IOA J;  1M90 J;  1Q86 J;  3I56 H;  1YJW H;  4UY8 M;  4WFA J;  3CCU H;  1VQ5 H;  1S72 H;  3G71 H;  3CC4 H;  3CCE H;  2OTJ H;  1VQ9 H;  3G4S H;  3CMA H;  3CPW H;  4U67 J;  2ZJQ J;  4WCE J;  3OW2 H;  4WF9 J;  2QA4 H;  1Q81 J;  3CCQ H;  3CC7 H;  2OTL H;  5MLC O;  1VQ8 H;  1JJ2 H;  1VQL H;  1VQK H;  1VQM H;  4WFN J;  5GAG N;  1W2B H;  5JVH J;  1VQ6 H;  1VQP H;  1QVF H;  1Y69 K;  4IOC J;  5DM6 J;  3I55 H;  5HL7 J;  1KQS H;  1YI2 H;  1YJN H;  1QVG H;  1M1K J;  3PIP J;  2QEX H;  3CCV H;  4IO9 J;  3CCS H;  1YIJ H;  3CME H;  3PIO J;  5GAE N;  4WFB J;  2ZJR J;  3CCJ H;  1KD1 J; 
#chains in the Genus database with same CATH topology
 2WK5 A;  4KWV A;  5AN9 F;  3DLL J;  4AP8 A;  3CCM H;  3G6E H;  1K9M J;  3AMZ A;  2ZJP J;  3BII E;  3CCR H;  1BRW A;  3CCL H;  5HUP A;  3SR6 C;  5AYX A;  3ETR C;  3CXC H;  1VQ7 H;  1YTK A;  1YHQ H;  3H5Q A;  1VQO H;  3WNZ A;  3CF5 J;  2B7N A;  5H1S O;  1KC8 J;  1K8A J;  3J7Z M;  3RPF A;  3FC4 A;  1Q82 J;  1YIT H;  1NJI J;  1YJ9 H;  3NVW C;  1WKI A;  5JVG J;  1N8R J;  2PA2 A;  4GA4 A;  4XR5 A;  1K73 J;  1VQ4 H;  2W3R B;  3L4P A;  3NVY C;  2TPT A;  5EY3 A;  1X1O A;  5GAD N;  5DM7 J;  3CD6 H;  3VMM A;  3WO0 A;  1Q7Y J;  3C2O A;  5GAH N;  3CC2 H;  2JBM A;  1VQN H;  1FM0 E;  1SIJ A;  4IOA J;  1M90 J;  1Q86 J;  1OTP A;  3I56 H;  1YJW H;  1FMA E;  4UY8 M;  3C2F A;  1N63 B;  4EAD A;  4WFA J;  1UOU A;  3CCU H;  1VQ5 H;  1S72 H;  3C2E A;  3G71 H;  3CC4 H;  2W54 B;  3CCE H;  2OTJ H;  1VQ9 H;  3NRZ C;  4C7Z A;  3FAH A;  3G4S H;  4US8 A;  3CMA H;  3CPW H;  3TQV A;  4U67 J;  1AZY A;  5MPO C;  1FO4 A;  4WCE J;  1SB3 A;  2WK6 A;  2ZJQ J;  2E3T A;  2W55 B;  1ZXI B;  3OW2 H;  1YTD A;  1VDV A;  4YYY A;  1RM6 A;  3EUB 4;  1V97 A;  4GA5 A;  1JRP B;  1QPN A;  2I1O A;  1QVF H;  2I14 A;  1FFV B;  5HUO A;  4WF9 J;  2WP4 A;  3PAJ A;  2QA4 H;  1FFU B;  1Q81 J;  3CCQ H;  1DGJ A;  1WYG A;  2DSJ A;  1YTE A;  3CC7 H;  1VLB A;  2OTL H;  5HUL A;  5MLC O;  1VQ8 H;  1JJ2 H;  1NVI E;  1VQL H;  4GA6 A;  1VQK H;  4I9A A;  1VQM H;  2W3S B;  4WFN J;  5GAG N;  3NS1 C;  2Q5W E;  1N60 B;  1W2B H;  1FIQ C;  3C2V A;  5JVH J;  1VQP H;  1Y69 K;  1N62 B;  5EP8 A;  1VQ6 H;  3AM9 A;  2OMD A;  4ZOH A;  2B7Q A;  4IOC J;  4X46 A;  5DM6 J;  4LHM A;  1JRO B;  1QAP A;  3I55 H;  1O4U A;  4C80 A;  3NVZ C;  4US9 A;  1QPQ A;  5HL7 J;  1N61 B;  3B9J C;  4KWW A;  1KQS H;  1NVJ A;  5AYY A;  1YI2 H;  4YEK A;  1YJN H;  1QVG H;  3AN1 A;  1QPR A;  2QIE A;  3L0G A;  4EAF A;  1N5W B;  3PIP J;  3GNN A;  2QEX H;  1M1K J;  5AYZ A;  3WO1 A;  3CCV H;  2B7P A;  4IO9 J;  3CCS H;  1YIJ H;  3CME H;  1QPO A;  4C7Y A;  3PIO J;  4USA A;  5GAE N;  4WFB J;  2J0F A;  2ZJR J;  1N5X A;  3CCJ H;  1KD1 J;  3C2R A;  3NVV C; 
#chains in the Genus database with same CATH homology
 5AN9 F;  3DLL J;  3CCM H;  3G6E H;  1K9M J;  2ZJP J;  3CCR H;  3CCL H;  3CXC H;  1VQ7 H;  1YHQ H;  1VQO H;  3CF5 J;  5H1S O;  1KC8 J;  1K8A J;  3J7Z M;  1Q82 J;  1YIT H;  1NJI J;  1YJ9 H;  1WKI A;  5JVG J;  1N8R J;  2PA2 A;  1K73 J;  1VQ4 H;  5GAD N;  5DM7 J;  3CD6 H;  1Q7Y J;  5GAH N;  3CC2 H;  1VQN H;  4IOA J;  1M90 J;  1Q86 J;  3I56 H;  1YJW H;  4UY8 M;  4WFA J;  3CCU H;  1VQ5 H;  1S72 H;  3G71 H;  3CC4 H;  3CCE H;  2OTJ H;  1VQ9 H;  3G4S H;  3CMA H;  3CPW H;  4U67 J;  2ZJQ J;  4WCE J;  3OW2 H;  4WF9 J;  2QA4 H;  1Q81 J;  3CCQ H;  3CC7 H;  2OTL H;  5MLC O;  1VQ8 H;  1JJ2 H;  1VQL H;  1VQK H;  1VQM H;  4WFN J;  5GAG N;  1W2B H;  5JVH J;  1VQ6 H;  1VQP H;  1QVF H;  1Y69 K;  4IOC J;  5DM6 J;  3I55 H;  5HL7 J;  1KQS H;  1YI2 H;  1YJN H;  1QVG H;  1M1K J;  3PIP J;  2QEX H;  3CCV H;  4IO9 J;  3CCS H;  1YIJ H;  3CME H;  3PIO J;  5GAE N;  4WFB J;  2ZJR J;  3CCJ H;  1KD1 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...