1Z7KB

Crystal structure of trypsin- ovomucoid turkey egg white inhibitor complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
b'VPMDCSRYPNTTSEEGKVMILCNKALNPVCGTDGVTYDNECVLCAHNLEQGTSVGKKHDGEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Crystal structure of trypsin-turkey egg white inhibitor complex
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2005-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1z7kB00
1M8BA 1H0ZA 1LR7A 2KMOA 1YU6C 5JHWC 4OVOA 1M8CA 1OYVI 1SGPI 1LR8A 2SGDI 5DAEA 1Y1CA 1OMUA 1IY5A 2GKVA 2JZMA 1DS2I 1SGNI 1Y1BA 2KMRA 2KMQA 1SGYI 1R0RI 1CT4I 1OVOA 2WCYA 1UUCA 1SGQI 3SGBI 2N71A 2GKRI 1HPTA 2ARPF 2KCXA 1HJAI 3OVOA 2SGQI 1PJUA 2NU3I 3QTLD 3SEKC 1TBQR 2F3CI 1CHOI 3HH2C 1SGRI 4GI3C 1DS3I 1TBRR 1CE3A 1TGSI 3SGQI 2N52A 1CT2I 1IW4A 2M5XA 2BUSA 1N13A 1NUBA 1AN1I 2QQCA 1PCEA 1UVGA 1BUSA 1TUSA 1PPFI 2P6AC 1LR9A 1Z7KB 2NU0I 1SGDI 2OVOA 2JYYA 3B4VC 1MT1A 2SGPI 2KMPA 2NU4I 1CSOI 4HGUA 2ERWA 1CGJI 2N17A 2V53A 2GKTI 1YTPA 2NU1I 2LEOA 1CT0I 1SGEI 2SGEI 1FYBA 1CGII 1KMAA 1TIHA 2SGFI 2JXDA 1TURA 2B0UC 1BMOA 4SGBI 1IY6A 2QQDA 1UVFA 2XRCA 1OMTA 2NU2I 1HDLA 3TJQA
chains in the Genus database with same CATH superfamily
2J87A 2LB7A 3D00A 1ULKA 1X74A 2ENZA 2OU2A 1TBNA 1M8BA 4UXHA 5HQ8A 1H0ZA 1LR7A 1V1HA 2KMOA 2Y0MA 1YU6C 1MJAA 3UOEA 1FY7A 1WGCA 4MPIA 2A20A 5JHWC 3VDPA 4OVOA 3UEYA 1R79A 2CWHA 1M8CA 1OYVI 1SGPI 2DIPA 3KY9A 2CWGA 1K7UA 2DB6A 2QQ0A 2YQPA 2GIVA 3UFFA 1LR8A 2ODDA 3TO9A 5FUWA 2SGDI 3OXLA 1KBFA 1TBOA 5DAEA 1Y1CA 1OMUA 1XA6A 5EX0A 1IY5A 4L9MA 2GKVA 2FNFX 2JZMA 1DS2I 1P9ZA 3FC3A 1SGNI 1W4RA 1Y1BA 2KMRA 2V1CC 2OZUA 4UXIA 2KMQA 1MJBA 4DNCA 2UZ3A 1XBTA 1SGYI 2ROWA 1NXUA 1R0RI 1CT4I 1OVOA 2WCYA 1UUCA 1K7TA 2ELIA 1SGQI 5FUVA 1TOTA 3SGBI 9WGAA 2N71A 2GKRI 1WKXA 3QWPA 2ORWA 2PQ8A 3FSXA 5CCMA 1HPTA 2ARPF 2KCXA 1HJAI 1ULNA 3OVOA 4E1PA 1U5KA 2SGQI 1PJUA 2VRWB 1PTRA 1V1IA 3UGIA 2NU3I 3E2IA 2B8TA 2W0TA 5FUXA 3QTLD 3SEKC 1TBQR 1VDDA 2F3CI 3R5DA 4WP4A 1CHOI 3HH2C 1SGRI 5EX3A 1MJ9A 2JW6A 4GI3C 5FUYA 1FARA 1DS3I 2E5RA 1TBRR 2OD1A 1X4SA 2UVOA 1CE3A 1TGSI 2QQEA 3SGQI 3UEJA 2L7XA 1Y8FA 2RC4A 2N52A 2CWFA 3CXLA 3MEKA 1CT2I 3OXGA 3TO7A 1WGTA 1IW4A 2M5XA 1Z2IA 3BJIA 5HI7A 2BUSA 1N13A 1NUBA 1AN1I 7WGAA 2QQCA 3RU0A 1PCEA 3TOAA 1UVGA 1BUSA 1UHAA 1Q9BA 5J8CA 1P9GA 5J8FA 3VE5A 2X3TA 2WGCA 3UGDA 1TUSA 1PPFI 5E3QA 1K7VA 1ULMA 3R5BA 2P6AC 2K9HA 3TO6A 1FAQA 1LR9A 1Z7KB 2NU0I 1SGDI 3R5AA 2OVOA 2JYYA 3B4VC 1MT1A 2SGPI 3PDNA 3VDUA 2KMPA 2NU4I 4A24A 1HEVA 1CSOI 2V1CA 2DKVA 2JA1A 3FSYA 2ERWA 1CGJI 2N17A 2V53A 2GKTI 1YTPA 2RIJA 4HGUA 4E1RA 2N1AB 2NU1I 2LEOA 2WVJA 4JCVE 1CT0I 1SGEI 2SGEI 3UGLA 2X52A 1RFHA 2ORVA 1FYBA 5E3PA 1CGII 1KMAA 2ENNA 3E59A 1TIHA 4FKDA 1PTQA 3QAHA 3GOXA 4B6DA 2SGFI 2J9RA 2JXDA 4UXJA 1TURA 2B0UC 5CCLA 2CJSC 1BMOA 3OL0A 4SGBI 1IY6A 1WTJA 2LUYA 2QQDA 4AMLA 1XX6A 2E73A 1W3SA 1KBEA 1UVFA 2GVIA 2XRCA 3OXFA 3R5CA 1S20A 1OMTA 5E3RA 2NU2I 2YUUA 2L8EA 1HDLA 3TOBA 2QPOA 3TJQA
chains in the Genus database with same CATH topology
2J87A 3D00A 1X74A 2ENZA 4UXHA 5HQ8A 1TBNA 1M8BA 1H0ZA 1LR7A 1V1HA 2KMOA 1YU6C 2A20A 5JHWC 3VDPA 4OVOA 3UEYA 1R79A 1M8CA 1OYVI 1SGPI 2DIPA 3KY9A 2DB6A 2QQ0A 2YQPA 3UFFA 1LR8A 2ODDA 5FUWA 2SGDI 3OXLA 1KBFA 1TBOA 5DAEA 1Y1CA 1OMUA 1XA6A 5EX0A 1IY5A 4L9MA 2GKVA 2FNFX 2JZMA 1DS2I 3FC3A 1SGNI 1W4RA 1Y1BA 2KMRA 2V1CC 4UXIA 2KMQA 2UZ3A 1XBTA 1SGYI 2ROWA 1R0RI 1CT4I 1OVOA 2WCYA 1UUCA 2ELIA 1SGQI 5FUVA 1TOTA 3SGBI 2N71A 2GKRI 3QWPA 2ORWA 5CCMA 1HPTA 2ARPF 2KCXA 1HJAI 3OVOA 4E1PA 1U5KA 2SGQI 1PJUA 2VRWB 1PTRA 1V1IA 3UGIA 2NU3I 3E2IA 2B8TA 2W0TA 5FUXA 3QTLD 3SEKC 1TBQR 1VDDA 2F3CI 5EX3A 1CHOI 3HH2C 1SGRI 5FUYA 2JW6A 4GI3C 1FARA 1DS3I 2E5RA 1TBRR 2OD1A 1X4SA 1CE3A 1TGSI 2QQEA 3SGQI 3UEJA 2L7XA 1Y8FA 2N52A 3CXLA 3MEKA 3OXGA 1CT2I 1IW4A 2M5XA 3BJIA 5HI7A 2BUSA 1N13A 1NUBA 1AN1I 2QQCA 3RU0A 1PCEA 1UVGA 1BUSA 3VE5A 3UGDA 1TUSA 1PPFI 2P6AC 2K9HA 1FAQA 1LR9A 1Z7KB 2NU0I 1SGDI 2OVOA 2JYYA 3B4VC 1MT1A 2SGPI 3PDNA 3VDUA 2KMPA 2NU4I 4A24A 1CSOI 2V1CA 2JA1A 4HGUA 2ERWA 1CGJI 2N17A 2V53A 2GKTI 1YTPA 4E1RA 2N1AB 2NU1I 2LEOA 2WVJA 4JCVE 1CT0I 1SGEI 2SGEI 3UGLA 1RFHA 2ORVA 1FYBA 1CGII 1KMAA 2ENNA 3E59A 1TIHA 4FKDA 1PTQA 3GOXA 4B6DA 2SGFI 2J9RA 2JXDA 4UXJA 1TURA 2B0UC 5CCLA 2CJSC 1BMOA 3OL0A 4SGBI 1IY6A 2LUYA 2QQDA 1XX6A 2E73A 1W3SA 1KBEA 1UVFA 2GVIA 2XRCA 3OXFA 1OMTA 2NU2I 2YUUA 2L8EA 1HDLA 2QPOA 3TJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8B A;  1H0Z A;  1LR7 A;  2KMO A;  1YU6 C;  5JHW C;  4OVO A;  1M8C A;  1OYV I;  1SGP I;  1LR8 A;  2SGD I;  5DAE A;  1Y1C A;  1OMU A;  1IY5 A;  2GKV A;  2JZM A;  1DS2 I;  1SGN I;  1Y1B A;  2KMR A;  2KMQ A;  1SGY I;  1R0R I;  1CT4 I;  1OVO A;  2WCY A;  1UUC A;  1SGQ I;  3SGB I;  2N71 A;  2GKR I;  1HPT A;  2ARP F;  2KCX A;  1HJA I;  3OVO A;  2SGQ I;  1PJU A;  2NU3 I;  3QTL D;  3SEK C;  1TBQ R;  2F3C I;  1CHO I;  3HH2 C;  1SGR I;  4GI3 C;  1DS3 I;  1TBR R;  1CE3 A;  1TGS I;  3SGQ I;  2N52 A;  1CT2 I;  1IW4 A;  2M5X A;  2BUS A;  1N13 A;  1NUB A;  1AN1 I;  2QQC A;  1PCE A;  1UVG A;  1BUS A;  1TUS A;  1PPF I;  2P6A C;  1LR9 A;  1Z7K B;  2NU0 I;  1SGD I;  2OVO A;  2JYY A;  3B4V C;  1MT1 A;  2SGP I;  2KMP A;  2NU4 I;  1CSO I;  4HGU A;  2ERW A;  1CGJ I;  2N17 A;  2V53 A;  2GKT I;  1YTP A;  2NU1 I;  2LEO A;  1CT0 I;  1SGE I;  2SGE I;  1FYB A;  1CGI I;  1KMA A;  1TIH A;  2SGF I;  2JXD A;  1TUR A;  2B0U C;  1BMO A;  4SGB I;  1IY6 A;  2QQD A;  1UVF A;  2XRC A;  1OMT A;  2NU2 I;  1HDL A;  3TJQ A; 
#chains in the Genus database with same CATH topology
 2J87 A;  2LB7 A;  3D00 A;  1ULK A;  1X74 A;  2ENZ A;  2OU2 A;  1TBN A;  1M8B A;  4UXH A;  5HQ8 A;  1H0Z A;  1LR7 A;  1V1H A;  2KMO A;  2Y0M A;  1YU6 C;  1MJA A;  3UOE A;  1FY7 A;  1WGC A;  4MPI A;  2A20 A;  5JHW C;  3VDP A;  4OVO A;  3UEY A;  1R79 A;  2CWH A;  1M8C A;  1OYV I;  1SGP I;  2DIP A;  3KY9 A;  2CWG A;  1K7U A;  2DB6 A;  2QQ0 A;  2YQP A;  2GIV A;  3UFF A;  1LR8 A;  2ODD A;  3TO9 A;  5FUW A;  2SGD I;  3OXL A;  1KBF A;  1TBO A;  5DAE A;  1Y1C A;  1OMU A;  1XA6 A;  5EX0 A;  1IY5 A;  4L9M A;  2GKV A;  2FNF X;  2JZM A;  1DS2 I;  1P9Z A;  3FC3 A;  1SGN I;  1W4R A;  1Y1B A;  2KMR A;  2V1C C;  2OZU A;  4UXI A;  2KMQ A;  1MJB A;  4DNC A;  2UZ3 A;  1XBT A;  1SGY I;  2ROW A;  1NXU A;  1R0R I;  1CT4 I;  1OVO A;  2WCY A;  1UUC A;  1K7T A;  2ELI A;  1SGQ I;  5FUV A;  1TOT A;  3SGB I;  9WGA A;  2N71 A;  2GKR I;  1WKX A;  3QWP A;  2ORW A;  2PQ8 A;  3FSX A;  5CCM A;  1HPT A;  2ARP F;  2KCX A;  1HJA I;  1ULN A;  3OVO A;  4E1P A;  1U5K A;  2SGQ I;  1PJU A;  2VRW B;  1PTR A;  1V1I A;  3UGI A;  2NU3 I;  3E2I A;  2B8T A;  2W0T A;  5FUX A;  3QTL D;  3SEK C;  1TBQ R;  1VDD A;  2F3C I;  3R5D A;  4WP4 A;  1CHO I;  3HH2 C;  1SGR I;  5EX3 A;  1MJ9 A;  2JW6 A;  4GI3 C;  5FUY A;  1FAR A;  1DS3 I;  2E5R A;  1TBR R;  2OD1 A;  1X4S A;  2UVO A;  1CE3 A;  1TGS I;  2QQE A;  3SGQ I;  3UEJ A;  2L7X A;  1Y8F A;  2RC4 A;  2N52 A;  2CWF A;  3CXL A;  3MEK A;  1CT2 I;  3OXG A;  3TO7 A;  1WGT A;  1IW4 A;  2M5X A;  1Z2I A;  3BJI A;  5HI7 A;  2BUS A;  1N13 A;  1NUB A;  1AN1 I;  7WGA A;  2QQC A;  3RU0 A;  1PCE A;  3TOA A;  1UVG A;  1BUS A;  1UHA A;  1Q9B A;  5J8C A;  1P9G A;  5J8F A;  3VE5 A;  2X3T A;  2WGC A;  3UGD A;  1TUS A;  1PPF I;  5E3Q A;  1K7V A;  1ULM A;  3R5B A;  2P6A C;  2K9H A;  3TO6 A;  1FAQ A;  1LR9 A;  1Z7K B;  2NU0 I;  1SGD I;  3R5A A;  2OVO A;  2JYY A;  3B4V C;  1MT1 A;  2SGP I;  3PDN A;  3VDU A;  2KMP A;  2NU4 I;  4A24 A;  1HEV A;  1CSO I;  2V1C A;  2DKV A;  2JA1 A;  3FSY A;  2ERW A;  1CGJ I;  2N17 A;  2V53 A;  2GKT I;  1YTP A;  2RIJ A;  4HGU A;  4E1R A;  2N1A B;  2NU1 I;  2LEO A;  2WVJ A;  4JCV E;  1CT0 I;  1SGE I;  2SGE I;  3UGL A;  2X52 A;  1RFH A;  2ORV A;  1FYB A;  5E3P A;  1CGI I;  1KMA A;  2ENN A;  3E59 A;  1TIH A;  4FKD A;  1PTQ A;  3QAH A;  3GOX A;  4B6D A;  2SGF I;  2J9R A;  2JXD A;  4UXJ A;  1TUR A;  2B0U C;  5CCL A;  2CJS C;  1BMO A;  3OL0 A;  4SGB I;  1IY6 A;  1WTJ A;  2LUY A;  2QQD A;  4AML A;  1XX6 A;  2E73 A;  1W3S A;  1KBE A;  1UVF A;  2GVI A;  2XRC A;  3OXF A;  3R5C A;  1S20 A;  1OMT A;  5E3R A;  2NU2 I;  2YUU A;  2L8E A;  1HDL A;  3TOB A;  2QPO A;  3TJQ A; 
#chains in the Genus database with same CATH homology
 2J87 A;  3D00 A;  1X74 A;  2ENZ A;  4UXH A;  5HQ8 A;  1TBN A;  1M8B A;  1H0Z A;  1LR7 A;  1V1H A;  2KMO A;  1YU6 C;  2A20 A;  5JHW C;  3VDP A;  4OVO A;  3UEY A;  1R79 A;  1M8C A;  1OYV I;  1SGP I;  2DIP A;  3KY9 A;  2DB6 A;  2QQ0 A;  2YQP A;  3UFF A;  1LR8 A;  2ODD A;  5FUW A;  2SGD I;  3OXL A;  1KBF A;  1TBO A;  5DAE A;  1Y1C A;  1OMU A;  1XA6 A;  5EX0 A;  1IY5 A;  4L9M A;  2GKV A;  2FNF X;  2JZM A;  1DS2 I;  3FC3 A;  1SGN I;  1W4R A;  1Y1B A;  2KMR A;  2V1C C;  4UXI A;  2KMQ A;  2UZ3 A;  1XBT A;  1SGY I;  2ROW A;  1R0R I;  1CT4 I;  1OVO A;  2WCY A;  1UUC A;  2ELI A;  1SGQ I;  5FUV A;  1TOT A;  3SGB I;  2N71 A;  2GKR I;  3QWP A;  2ORW A;  5CCM A;  1HPT A;  2ARP F;  2KCX A;  1HJA I;  3OVO A;  4E1P A;  1U5K A;  2SGQ I;  1PJU A;  2VRW B;  1PTR A;  1V1I A;  3UGI A;  2NU3 I;  3E2I A;  2B8T A;  2W0T A;  5FUX A;  3QTL D;  3SEK C;  1TBQ R;  1VDD A;  2F3C I;  5EX3 A;  1CHO I;  3HH2 C;  1SGR I;  5FUY A;  2JW6 A;  4GI3 C;  1FAR A;  1DS3 I;  2E5R A;  1TBR R;  2OD1 A;  1X4S A;  1CE3 A;  1TGS I;  2QQE A;  3SGQ I;  3UEJ A;  2L7X A;  1Y8F A;  2N52 A;  3CXL A;  3MEK A;  3OXG A;  1CT2 I;  1IW4 A;  2M5X A;  3BJI A;  5HI7 A;  2BUS A;  1N13 A;  1NUB A;  1AN1 I;  2QQC A;  3RU0 A;  1PCE A;  1UVG A;  1BUS A;  3VE5 A;  3UGD A;  1TUS A;  1PPF I;  2P6A C;  2K9H A;  1FAQ A;  1LR9 A;  1Z7K B;  2NU0 I;  1SGD I;  2OVO A;  2JYY A;  3B4V C;  1MT1 A;  2SGP I;  3PDN A;  3VDU A;  2KMP A;  2NU4 I;  4A24 A;  1CSO I;  2V1C A;  2JA1 A;  4HGU A;  2ERW A;  1CGJ I;  2N17 A;  2V53 A;  2GKT I;  1YTP A;  4E1R A;  2N1A B;  2NU1 I;  2LEO A;  2WVJ A;  4JCV E;  1CT0 I;  1SGE I;  2SGE I;  3UGL A;  1RFH A;  2ORV A;  1FYB A;  1CGI I;  1KMA A;  2ENN A;  3E59 A;  1TIH A;  4FKD A;  1PTQ A;  3GOX A;  4B6D A;  2SGF I;  2J9R A;  2JXD A;  4UXJ A;  1TUR A;  2B0U C;  5CCL A;  2CJS C;  1BMO A;  3OL0 A;  4SGB I;  1IY6 A;  2LUY A;  2QQD A;  1XX6 A;  2E73 A;  1W3S A;  1KBE A;  1UVF A;  2GVI A;  2XRC A;  3OXF A;  1OMT A;  2NU2 I;  2YUU A;  2L8E A;  1HDL A;  2QPO A;  3TJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...