1ZR4A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
molecule keywords TCAGTGTCCGATAATTTAT
molecule tags Recombination/dna
source organism Escherichia coli
total genus 52
structure length 183
sequence length 183
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr4A01
1ZGWA 2CU7A 2DA6A 3JRDA 3MVPA 3ZQFA 3FISA 2JMWA 5FJ8J 5FLVA 5E3OA 2M34A 1IDYA 2HXOA 3MN2A 4D5CA 3TP3A 1IG7A 1CQTA 4JP0A 4M6VA 1GDTA 1IDZA 3HOVJ 3Q0WA 3JREA 3GTKJ 4FCYA 1ZKGA 3L1PA 1VI0A 2D5VA 1APLC 1I50J 5EYRA 1R9TJ 4CYCB 2LLKA 2OPTA 4UUSB 3FIWA 5IP9J 1SANA 1MBKA 3HOWJ 4V2FA 1IRZA 4BQQA 2G0EA 3Q3SA 1LE8B 2ME0A 1H8AC 2HOAA 2LFBA 5M5YJ 5F27A 1HDPA 1IGNA 1X2NA 4CYCA 2JA8J 1OCTC 2YUSA 3OSGA 1FJLA 2RSLA 2L7FP 1BL0A 1WI3A 4UUSA 4JX5A 3CDLA 3RKQA 2TCTA 2DA1A 4DW6A 5GPAA 3GUVA 2AO9A 2XB0X 2M0CA 4D5FA 2DA2A 2WB1N 1NK3P 3ILXA 2XPWA 1B72B 1HOMA 1WGXA 4C3HJ 1LE8A 2GLOA 5IYCJ 3IV5A 1MSFC 4XIDA 5K7FA 5M3FJ 1QVUA 1JUSA 2HI3A 4NDLA 1QPIA 3H3VK 2L7MP 2MW8A 2M2EA 3S16J 4A3MJ 1MBFA 3GTJJ 1F43A 1JTYA 3ZQCA 2O7OA 2JA5J 1B8IB 2YU9J 1RPWA 2CUEA 4BY1J 3GTPJ 1B72A 3HOUJ 2LKXA 4A3EJ 2ECBA 5FKKA 3DCFA 1H88C 1JJ8C 4HNVA 2MG4A 1BW5A 1YRNB 2ME6A 5EEAA 4X6AJ 2FQ4A 1MNMC 3HBLA 1ETQA 1X58A 4QSHA 1P7IA 4FTHA 1BA5A 1PUFB 4JX4A 1B8IA 2E2IJ 2CRGA 2NOGA 3O8GA 2EZLA 2XGEA 5F04A 2R5YB 2XGCA 3UKGA 3HOXJ 3G1MA 1JGGA 5DS9A 4QIWN 1GHTA 2DMPA 2HDDA 3QQAA 4A3DJ 2PMZN 4MIMA 1FEXA 3F0CA 1T56A 1U78A 3RZOJ 4IHXA 2LD5A 1ITYA 3IH4A 1WH7A 5C35A 3C2BA 3S1QJ 3CQZJ 1DU0A 3G13A 2R5YA 2YS9A 3HOZJ 5M3MJ 3Q0VA 3BT9A 3LSGA 1ZTRA 1TWHJ 5F0HA 2R92J 3S1RJ 4XRSG 5F08A 4J19A 5IP7J 3RZDJ 1IV6A 1EF4A 3BR1A 1FTTA 4D7NA 4BBSJ 3UJ3X 4DYQA 5J1UA 2M8GX 3G1LA 4D7MA 5EG0B 2Y0SN 4BY7J 2EZKA 1JT0A 3JRGA 1D5YA 1BJZA 3BR3A 5IP6A 3SJMA 1O4XA 2R7ZJ 3QPLA 2ID3A 3LSJA 4W1UA 3G1OA 4M3FA 3HGGA 3HOYJ 3ZQGA 2L7ZA 4A3IJ 3M3YJ 4A3CJ 2ECCA 4I76A 3S15J 5EG0A 4I6ZA 4QTRA 3B6CA 1U8BA 2DMTA 4C3JJ 3HGYA 1ZR2A 1AKHA 2GBYA 2Y30A 2K9SA 2JN6A 1GV5A 4XICA 3M4OJ 4X1EA 5HODA 1VFCA 2O9LA 4ABZA 2VKVA 1ETVA 5C34B 2X6OA 3W6VA 2K40A 3BQZA 1MH3A 1HDDC 2NVQJ 3I4NJ 3CMYA 3PO2J 1Y1VJ 2IEKA 2XRLA 1Z0XA 2CQQA 2HXIA 4XRMA 3BVPA 3LHKA 3VPRA 2NS8A 1MSEC 5IYBJ 3FK6A 1Y1WJ 1RKTA 1BW6A 1NTCA 2XB5A 3FKIJ 1IJWC 3BG3A 3LOCA 1OFCX 2IBDA 4MFEA 1I3QJ 4Y7NJ 1OCPA 2CJJA 2B63J 2N8GA 4A3GJ 4AUXA 4FE4A 3ZQHA 2WV1A 3WHBA 5JLWA 4A3FJ 3A03A 5F1JA 2VI6A 4A3LJ 5M5XJ 1VNDA 4A3JJ 3PM1A 4GFBA 1UHSA 1G2HA 1ETWA 1ETKA 5JLXA 5J1RA 1FIPA 1W0UA 1MBJA 2CUFA 2XGDA 3GTMJ 2I10A 1JUMA 1K61A 5C4JJ 2R0QC 3NAUA 1WPKA 4JX6A 2VPRA 4M3GA 1ETOA 5C44J 5C4XJ 2P81A 4MFDA 4Y52J 4BXXJ 4M3DA 2HQ5A 5FKOA 1MBEA 1AU7A 3BR2A 2NVTJ 1IUFA 2EZIA 4BBRJ 2K9NA 2MSYA 2ZB9A 3JRIA 2ELKA 1Q1VA 5EGOB 1JKPC 1X2MA 3BG5A 3BTLA 3TW7A 2X48A 2DA7A 4L5EA 4M3EA 4BKXA 3WHCA 2FX0A 1ENHA 5EZGA 1K83J 3TP0A 2KT0A 1A6IA 2Y2ZA 1U9NA 2JA6J 1IC8A 1WCMJ 4RBOA 3LSPA 2E19A 2H8RA 3K7AJ 5FLMJ 5EGOA 3GTOJ 2VKEA 3OOUA 2QCOA 2DN0A 2EZHA 3OSFA 4DZJA 3BQYA 2COBA 4IHWA 1ORKA 2DJNA 2VUMJ 3BR6A 2KDZA 1AKHB 2O8KA 2JJ7A 4W97A 2LR8A 5EDNA 3HEFA 3LNQA 3Q0UA 2NVXJ 1P7JA 4IEJA 2QF7A 4IHVA 1OJLA 2W48A 5C31A 3BTJA 1GT0C 3A02A 1TWFJ 3IH3A 2FD5A 2DA4A 3S2DJ 5IYDJ 4MO7A 2JWTA 1TWGJ 3HKZN 5FKMA 1Z77A 2L9RA 5DTDA 2XPVA 1UMQA 2L0KA 5K7ZA 2H1KA 2EBIA 2XPUA 3PKZA 2OF7A 4FISA 1ZQ3P 2GM5A 4MLOA 2DA5A 5K7HA 2LK2A 3JRBA 3I4MJ 3DEWA 4FE7A 2Y9YA 1W0TA 1HX7A 2MHCA 1JTXA 2Y9ZA 1JKOC 2DMNA 2E2HJ 1MBGA 2E1OA 2FJ1A 2NS7A 3ZOBA 1F36A 3QPSA 3TEDA 3H0GJ 1U9OA 3JR9A 3BR0A 1XC5A 1SFOJ 2R93J 1A5JA 4AC0A 2M9HA 1QVTA 4A69C 1JKQC 2DTZA 5IPAA 3E7LA 3S1NJ 1UG2A 1MH4A 3SFIA 1RR7A 3IH2A 4M3BA 1H89C 2HYJA 4B1RA 4DZPA 4C3IJ 5IOZA 1RESA 5F0FA 3RQIA 3A01B 1WH5A 3GTQJ 2NVYJ 1HF0A 4A3BJ 1AHDP 2K9QA 5EZHA 2DMUA 1T33A 2LY9A 3PO3J 5FKNA 4XK4A 3B6AA 3K2AA 3ZQLA 4B4CA 3MKLA 1FIAA 1LFUP 2JK3A 1TWAJ 2R5ZB 2LP0A 4EEFG 1TC3C 2HOTA 3JRCA 3JRHA 5FKLA 5C32A 3A01A 2MGQA 3SDGA 1GV2A 3GBGA 4C2MJ 3O8HA 3CCYA 1NK2P 9ANTA 4DYRA 3LHFA 1RKWA 5F0CA 3S17J 1ZK8A 2WAQN 1POGA 1ZR4A 3BR5A 4IHYA 1S7EA 1JT6A 2ID6A 4S0HB 3FK7A 3NARA 3JRAA 2JA7J 4LOCA 1HCRA 2R5ZA 2EH3A 1E3OC 5BNGA 3BG9A 1ETXA 4UUTA 4XRSA 2LVSA 2IAIA 5J1YA 2GM4A 2EQRA 3S2HJ 2XSDC 1TWCJ 5C3EJ 3GTLJ 2DA3A 1LFBA 1YRNA 2HOSA 5J3LA 1GUUA 2RAEA 2Y31A 1RETA 4A93J 1I6HJ 2E2JJ 2TRTA 1FTZA 4V2GA 3HDDA 4B3AA 1QRYA 3D1NI 1PUFA 2AHQA 1DU6A 3HB9A 3BTIA 3HM5A 5GPCA 5EF6A 1JKRC 2CQXA 1VF9A 5E3MA 3JRFA 1MBHA 3S14J 5E3LA 4A3KJ 4JYKA 3S1MJ 5E3NA 2LTPA 1XS9A 2X9DA 1ETYA 4AYBN 5GP9A 4RDUA 1JJ6C 5M5WJ 3OIOA 1JUPA 5IOYA 2DMQA 3ZQIA 4G12A 3GTGJ 3TW6A 4DYCA 3LSRA 1GVDA 1XG1A 3BTCA 1HLVA
chains in the Genus database with same CATH superfamily
4U8GA 2JMWA 3G2PA 3OLYA 1N2DC 1X7XB 2BE7A 1FTWA 3RTAA 5A9RA 1Q7GA 3ZEIA 4TV8B 4KPFC 4NESA 2CUNA 1JA1A 1DZ3A 3ZK7A 3VO2A 4Q3LA 2DLDA 4RB2C 2GOYA 1BI1A 2CFRA 3OMWA 1KI6B 1MMFB 2P7VB 2PKQO 5AJTA 3IS3A 4Y99C 5EP1A 3GBPA 1CHNA 1KZ6A 3UM9A 3DDSA 3MTGA 5L3QB 1S3IA 1MBZA 4DA6A 1M34A 4KN6A 5A0TA 1A7JA 4NOKA 3SVTA 5AM1A 2E4XA 4MUEA 5BXQC 4R16A 4MQ9F 3WNCA 4IOAF 5LA6F 3W90A 1T35A 2VQHA 1F20A 1T5DX 1SOUA 4YRAA 4W5RA 1BA5A 5IAGA 1PK7A 3VR4A 3O8GA 2FMFA 2FW9A 5E1WA 3ZHCA 4CMCA 4Z86A 2PG3A 2X0FA 3SVZA 1FJXA 4HVLA 4JI8B 2M32A 3BWBA 1ODLA 3K8ZA 2GAUA 2DFIA 4B3MB 3I59B 1QS0B 3TAUA 2P7CB 1RI4A 2ZSJA 2P62A 2I34A 2I2WA 4W99A 1XJCA 1LDMA 2X51A 3L41A 1K06A 3NNNA 3HOTA 2VRCD 3QKRA 3L0CA 3VC7A 1U99A 3V4FA 4W1UA 1QM5A 2J7KA 1FZAA 4HGZA 3RS0A 4P0PB 4YIFA 2BBYA 2XUIA 5E1BA 3OWXA 3ZQ6A 3HGYA 3L73E 3D5SC 1A27A 3JQ9A 4O5VA 4RZHA 4Q9NA 2EV9A 2QQAA 3QKSA 4JXJA 5JAQA 2HFJA 3FWKA 2CQQA 2RC4A 5AW3B 1RHUA 3VM6A 2ZWMA 3OR2C 2IHJA 3AAFA 4ARUA 4YV1A 5ENDA 1OCPA 4M55A 2HMAA 1MJ5A 5LQUA 3H2IA 5IUKC 1G64A 2PBFA 4HFMA 1JIQA 1W47A 1VRWA 3QPVA 2M1XA 3K4HA 2QZ9A 2PJRA 2C4UA 2WLTA 3OPNA 4GYGA 4F55A 1J9GA 4YR9A 3LHSA 1V8PA 3QSGA 3O9ZA 4E03A 1PR5A 4MO9A 1ODSA 1QKJA 4OQZA 4R6XA 4UFNA 4M3DA 2JIOA 4E5MA 3KZZA 2C5HA 3LW5J 1EP1B 4JGBA 3QLVC 3CUKA 2G04A 2POCA 4RL4A 1ND5A 4M6WA 3IBGA 4Y1GA 3DE2X 1MHPA 4HSEA 1PGPA 4PY2A 1ENHA 2XITA 1EXWA 3VZPA 3WICA 2AS5F 1CIPA 4IXWA 3K1AB 3QOXA 4YJGA 3CZRA 1E9AA 2DN0A 5AW9A 4QX6A 5DHRA 2QRZA 3PTAA 4PYOA 4F7ZA 4YLEA 1LJUA 3ELUA 2AOTA 5CYFA 3JASB 1E8NA 3A9TA 4XYLA 3ZV6A 3THYA 3T5MA 4Z1OA 4D7AA 5AVUA 4X20B 1Y5LA 3LOQA 3Q88A 3AHFA 1Z15A 4OEHA 1R5LA 1T8TA 3WV5A 1QRUA 4ZYHA 1K4YA 4JY7A 2F3SA 4FDAA 4YG2F 1DC3A 1QE3A 2QRGA 3U44A 3R3VA 3ESQA 3OKAA 5IPAA 1OX4A 4BNVA 4B3DA 4TKVB 1VQ4I 5L3FA 1KI4A 3TE7A 3AEKA 1ZREA 5LP6A 1II9A 3GAFA 5FL3A 3DMGA 2MD5A 3DMNA 3HUGA 3F6CA 5EIFA 1E1QD 3BJMA 3CC7P 5F0CA 5D4SA 2XA2A 4N01A 2D0OB 1FMVA 5EZQA 2ELHA 1TIPA 5AI9A 1TL7C 4US2R 1VE3A 2Z09A 2FF4A 2GZAA 3JR3A 4OXNA 1CRQA 5IKXA 3BJRA 2AQ8A 4JJKA 1W4LA 4O3FA 4D3XA 1G1JA 5FOVA 1VLHA 1VZ2A 4C0HA 4QFDA 3NQ41 1WR8A 2VCHA 5CB4A 4O6JA 4JP5A 3KYCA 4LOHA 2X0DA 2AMJA 1KQ0A 4Z8YA 1KZ9A 1U0FA 1M7HA 1Z13A 1JO5A 3MHVA 3O8RA 3ZH2A 3ZTTA 2IFMA 1KXJA 2NO5A 2IH5A 2Z5IA 4CMEC 2EA2A 4E2WA 3EUEA 3GGPA 3OX2A 4Q9AA 3KKPA 4MAFA 3KVOA 2EIMH 2CGEA 2QU8A 3I5AA 1G20E 3D5QA 1QJCA 4CCSA 4OHOA 3M3DA 4QPNA 4BQQA 5AM4A 2JVJA 1B16A 1KKMA 1IB6A 5E6SA 3WK6A 2Z3ZA 5DZSA 4OA8A 4INPA 5EJMA 3FH0A 4IDHA 4I55A 3HL0A 2C5AA 4WESA 1U1GA 2CMPA 1C9DB 5D01A 2OKGA 2I33A 3SX2A 1GXSA 3IEXA 2DK5A 4BGDA 1SCNE 1XMXA 3AC0A 4PHFA 3EX7C 1USWA 4U2KA 1GAJA 1KY4A 2C94A 1UXKA 5IYZB 3WL6A 4JL8A 3FRHA 1YR9A 1X9IA 4YCAA 1CTQA 2H1SA 1OFTA 3RK3C 4E0BA 3OT1B 1CF9A 5DM0A 3A28A 3BJ6A 2FXAA 2VKHA 2MYTA 4Z0HO 1OT3A 2OGZA 3TQOA 2V3WA 5KYGA 3NNSA 1UEXC 4IILA 1JGGA 1JI3A 2XUDA 1WLYA 1Z0SA 1MVNA 1CF2O 4RDHA 1K0FA 3E82A 1QE5A 1U11A 1U94A 3L00A 4EHJA 3RBXA 4FFBB 2YASA 2XZTA 2IV7A 4FR2A 5IK2D 2B7LA 2HO5A 2QL9A 1JEDA 2VRCA 4HMQA 3WBFA 4DC9A 1HF9A 2JFWA 2YKPA 1Z29A 4CMIB 1Y48E 2E60A 3HXPA 4P4GA 4CQLA 4XOUA 3HE4A 4IIBA 3HEMA 1JWAB 5HWSA 5KLVE 1WXWA 4LGWA 5AVZB 3DT8A 5A3VA 5KDOA 1RWWA 2OCIA 3EGOA 4OQLA 1EPUA 2XGGA 1VZ0A 2PX6A 1B6AA 1YNOA 1ETVA 5A6VA 2AG6A 3DDHA 4CQMD 4FWTA 2W6JH 1NR7A 1K6IA 1RE0A 4PLYA 5LC1A 3VH4A 1OH6A 3INTA 2XT0A 1HY3A 1P1KA 1NN0A 2OOSA 3GGOA 1OWLA 5EIEA 2F5DA 3S3NA 1KJ8A 3PFWO 3CGWA 3HRSA 3R0ZA 2IS2A 4KV9A 3U2QA 1XF9A 1SQQE 4ICIA 4IR7A 1TYZA 4JFRA 2ORWA 4AX4A 3I5YA 2QQ9A 2ID4A 3AI2A 4X7RA 5JC8A 1NTMD 3CONA 2QSHX 3T7RA 3JTHA 4BNDB 1K6MA 1BX1A 2ODPA 4P32A 1I94B 4C03A 1LH0A 2KIQA 1JEKA 1O96B 2V74B 5IZCC 1XHFA 4LJ6A 1YZUA 3QV1A 4UTOA 1XD2A 2P90A 3OM9A 3P5BA 3C16C 1IEQA 4XVRA 4XA4A 4WWCA 1JVSA 4WNYA 4BNGA 1LDYA 1PFGA 2IZZA 2P3LA 3TGLA 1KJWA 1R66A 4XTCS 2ZTVA 1NVMB 3WMM0 2G5TA 2MT9A 3CSUA 1U1CA 2QTAA 3BZKA 5EIAA 2FN4A 2ACWA 2GFHA 3IUQA 4OYHA 1N6RA 1WJAA 1GZVA 1ZUNB 5BSMA 3RT7A 1VBFA 2M3EA 5G40A 1T43A 2L0XA 3E7FA 4ONEA 3VU3A 1I4EB 4M8KA 5AR1A 3ZNPA 1M8OB 3ZQQA 2FSPA 3RJMA 2WU8A 3QKUA 2JGJA 3SFIA 3P4UA 2GPAA 3BDAA 3WDKA 4ER0A 1A50B 2HKOA 3OQ1A 3A2AA 3CCSP 1JHFA 1E1QA 3L6RA 5C4MA 1RKUA 3MQ2A 3DZDA 4E4RA 5BQPA 4TKLA 2D2IA 2R5ZB 4D6TD 3CCSI 1AD2A 1YIOA 5KYUA 2QZ4A 1RYHA 2OYHA 1DRWA 1J59A 2ZMEB 5AONA 4AZWA 1KRXA 1YS4A 1PQUA 4HFRA 2CXRA 1J8MF 1KQ3A 3F2VA 4BX8A 1PS8A 3V8EA 4FOPA 3IP6A 2LVSA 4XA8A 4LHWA 1YYCA 4UTXA 5BU5A 1OVMA 3GTLJ 3P7MA 1SG6A 5J4YA 4UU7A 5ALMA 3EGIA 3O6VA 3PNKA 5TMEA 3MD9A 2BY1A 3S3MA 2VUSA 2GMWA 2I8AA 3V6LA 2O8NA 8ADHA 3K0LA 1UKAA 3FZEA 1PTJA 5KU1A 1KK0A 5IJ9B 2XMQA 3AETA 1YONA 1NRIA 1UBTS 3ZR4B 5CPRB 3EXFB 1SFCC 1KB9I 2RC5A 5D1HA 3T54A 2FPUA 1KO8A 1KERA 1CG6A 5LQKA 5A05A 2CEAA 1A04A 2XVMA 3B8EA 2VSNA 2P2CA 3AINA 4U6SA 4UDNA 2BCJQ 4Y9RA 1CQPA 5I7AA 2CYAA 1YDWA 1F0PA 1F12A 1DIBA 2VNAA 1L5ZA 3VHRA 3GJ7A 3GUHA 5CH3A 4UE3S 4D4IA 4LIPD 4H35A 1AUOA 4YRQA 5BQ3A 3OESA 1LJLA 1FZPB 4HB3A 1MSFC 5DP1A 4ALKA 3KPHA 4G8DA 3IHWA 4GGPA 4DV0B 1S2IA 3H3VK 3TG8A 1QPIA 2GUVA 1H3EA 4H0CA 3B73A 2XDQB 5K0GA 4ASNA 5CVUA 1PV3A 2C2XA 5H80A 4AJ1A 1YZVA 1JYSA 5FI1B 2KDOA 3VMXA 3KO8A 1KQ8A 5AW5B 2FPIA 3JSXA 1N2CB 3AJAA 3PFKA 5FNVF 2REOA 5A1JA 3K72B 5IMSA 2PZEA 1Q90D 4C08A 5IK2A 4UNQA 5E7JA 2QN2A 4IGFA 4INOA 3MIIA 2MSWA 3S1QJ 4LGMA 3RK3D 3L0DA 3TZBA 1JW9B 2F67A 3GFLA 3AE8C 4XJSA 1NVGA 5M04A 3FHZA 3C70A 5EIWA 1BVYF 2UVPA 4ZODA 3UVEA 4X7PA 4AMVA 4TZKA 1IULA 4DYQA 4Q7JB 1TEZA 1D5YA 5CVRA 4TWIA 4ZREA 2R7ZJ 1M54A 2RGRA 3I73A 1FC3A 2QTMA 2BFFA 1JH9A 2AC4A 1YS1X 4WXPA 2YXDA 4CQMA 4JFAA 4XCVA 3RPEA 3H84A 4GIBA 4V24A 3K70B 2PQ6A 2VBXA 3JATA 1YQEA 1RKTA 3TD9A 4E3ZA 1ZVVA 2IBDA 1CERA 3DGFC 5P8WA 3ITNA 4HLDA 4WZAA 2LR0A 4IIYA 4XJVA 5L51A 4OU0A 3A1UA 1J8YF 1O3SA 2CL7X 2W2QA 2RGBA 3RIGA 1LRKA 4YMTA 4EB0A 1CI6B 2V98A 1U90A 2FK8A 1Y5NA 3W6PA 1JV2B 4FSXA 3MGNA 1Z16A 3L1HA 3OOHA 5AVKA 2WQ7A 2VONA 2GUWA 1MQSA 1KS9A 4RA9A 2FUEA 4TXMA 5E6UA 3PRYA 3H2GA 3MQFA 1JXAA 3M0AA 3FFTA 1HT3A 3RABA 1U02A 4XPZA 3QLVA 4FX0A 3H3XA 4YFXF 1JAYA 2J45A 1C1XA 2BHNA 5L3VA 3GLLA 3UJPA 2AQFA 4JB3A 3PUYA 2COBA 5KTPA 1Z4OA 1NU1D 4TN5A 4B4UA 3MMPA 2GCOB 4F6RB 3ET4A 4Z1MD 4HOYA 1PGQA 4C4TA 4LNHA 1E4OA 1QCZA 1LB2A 2IHZA 6ABPA 4I8XA 2E21A 3WY9A 1AOYA 5IDYA 2XUOA 2Q8NA 2GPBA 1EVZA 3GVHA 4DJGA 4WXMA 2QG4A 1Y4DE 1W1WA 2MD0A 3SCZA 3EQ9A 1KMIZ 3CE9A 5HYVA 3EDOA 3RDIA 3MJEA 3W5DA 2H51A 1SHZA 2JWDA 4O02B 1XR3A 3U09A 3IGFA 2GEKA 2C7OA 1ABFA 1KHHA 1JQ3A 3HDYA 4XOIA 5B4UA 2PZ8A 3H1JD 4KG7A 2P4EA 1UZCA 1FFHA 4NRDA 2A2ZA 4NQZA 2KMUA 4IYRA 4R3NA 3OPMA 4IXDA 2NXCA 5BSHA 2XB8A 1PE0A 4NU5A 4OI2A 1EIZA 3JRHA 4JLPA 2WAAA 2HU5A 1Q2XA 2Z30A 3HC7A 1Q22A 2PA3A 1TT7A 3GHGC 5KTOA 4LBVA 1C30B 2LY2A 1QBGA 3OJCA 2IOHA 5EE5B 5CA0F 5F64A 1E5QA 3OL4A 3STTA 3C41J 1FTZA 2AHQA 4A5MA 4UBLA 2YHUA 3TNYA 1KU7A 1HH0A 3H1LD 4CCWA 1BU5A 1Y0BA 4IZHA 4OWFA 3KPYA 2C4TA 4QG3A 3TI9A 3ZHBA 3SM3A 2J0UA 3ZWOA 3RNLA 4YNBA 2M45A 3CUYA 5AKIA 1EHCA 4JP0A 4IWNA 2CBXA 2CSXA 2FMHA 3I9LA 2YX4A 4CMEA 1DJNA 1XJQA 5IP9J 4BWGA 5K5RA 3USCS 4RE5A 1SFCD 2PUTA 3BRQA 4X3CA 3HE3A 4ARAA 3RSGA 2BV3A 2Z56A 2KFDA 2FPPA 5ALSA 3C8DA 2ZSHB 3DU6A 5NLLA 1HMPA 1OXXK 1DC6A 1G2CB 3OICA 1O7JA 1KA8A 1Q5PA 1G8FA 2HIMA 3MGKA 4NDLA 2H1IA 4MK4A 4MYRA 1LTKA 4P7GA 1QHFA 4W9NC 5MF6A 3GVCA 4AKIA 1VQKI 1DI0A 4XVHA 5D5UB 3GEBA 3GGDA 3VA7A 1QVZA 1XGSA 1ZG5A 3ADCA 2Y68A 4WINA 2HU9A 3EDQA 1J33A 1KSHA 3FDZB 1K8QA 4CTOA 1SUEA 4RA6B 3TGUD 3EA4A 4XN0A 1HFJA 3JWIA 2ZTUA 4CDGA 1SULA 1TOAA 1GCUA 1TM7E 4YV7A 3QYFA 3CT6A 2O3RA 5LP1A 4O1IA 4ZYZA 2BMEA 1JDBB 3QUAA 4MARA 3O3KA 3LSGA 4WY2A 5HFNA 5AFSA 4PR0A 3OETA 3WXBA 1YQXA 4P58A 1PL0A 2ZRAA 3RKYA 5EG0B 1LT9C 4CYMA 1CV2A 1QHSA 2ZUCA 1PEYA 5AVVB 1J0RA 5ARBA 4Z1MH 1GL7A 3JU3A 5D1NA 3PQ2A 1DKUA 1FTGA 1PT7A 2VRBA 1UKZA 2HA0A 4ASWA 4ZDWA 3SEFA 4CT5A 4RS8A 4A36A 2MR6A 3EEQA 1DEXA 2QT9A 3O4HA 3ZGVA 1HBJA 3KB6A 1RZ4A 3GBVA 1NJFA 4B6JA 1I30A 2V7QJ 4DJ5X 4Y6GB 5T3UA 4ZTJA 2I2FA 4K28A 4N5NA 3M6FA 3L2OB 3K0CC 2OCBA 2J41A 3PZRA 5BV8A 5BNFA 2VBCA 5CQGA 1H4QA 1T98A 3SSMA 1NMXA 3CLRC 3C5HA 1IZ7A 3SC6A 4QUBA 2A58A 3GJSA 1TADA 2PX8A 4X7BA 1P84D 2NS0A 1O87A 4G6DA 1A8IA 5B66C 1BGWA 4CPGA 4P3OA 4KJZA 1RDFA 2OHXA 3P1JA 4UNSA 3IJ5A 1NT4A 1JG2A 2E5FA 2NU7A 5CH5A 3V8VA 2DCUA 4X60A 5FUXA 5CDSA 2C2OA 3STHA 3WAKA 2NGRA 1T6YA 3MCWA 3ZE2B 3CGGA 4RPKA 3X2QH 4N8DA 3ECSA 4QHTA 1D07A 3MWGA 1I7DA 2GZ3A 2XT6A 2DT5A 5ECDA 3D02A 2BXYA 4P1ZA 2MKVA 1HDOA 4LRSB 4KQWA 3HM2A 5C18A 1LS6A 3T99A 1RFGE 4UEWA 3QH9A 1X0XA 4Z1MA 1T1EA 3DOIA 1ZSYA 3KP3A 2DUNA 2O1SA 4MKHA 5J2TB 2NUBA 2R4QA 3IOBA 4X61A 4E2YA 3RYFA 5KSWB 1C4WA 2E37A 2J6HA 2XHZA 2JASA 3IAS1 3G0GA 2WE7A 5A3QA 3GPDG 2WM2A 5JSYA 3KKMA 3WRXC 2OUKA 5F73A 2GBFA 2C99A 2H6EA 1QLED 4JP8A 4JIMA 3U48A 3OH8A 5E0KB 1YMUA 4ZAFA 4H6WA 3AF4A 4UDYX 3CO5A 5AD1A 3E9NA 3DS8A 5AK6A 3NH6A 1ZZGA 4WZZA 4IRUB 4I5EA 5INTA 1XTSA 1B0PA 1IC6A 1E7SA 1OLSB 4P6VF 2P5UA 4UD2A 1V9LA 3N2GB 1TVMA 2PSHA 1G0OA 1P7ZA 5CDFE 1JTFA 2WA0A 3GCMA 4XM2A 1TT5B 2QT0A 3N5CA 3R9IA 5ILVA 5HM8A 3QIVA 3FUUA 4LF7B 3NIGB 1DJOA 3A1FA 4G4GA 3AEQB 3LY8A 3DHWC 4JYKA 1PZQA 2QG6A 3SIWA 2VTBA 4JZKA 5KVAA 4JXZA 5IOYA 4AQDA 4H6XA 4MUMA 3K20A 1FAVA 1OLUB 5FUWA 3QGMA 1JMYA 2PGDA 3I5UA 4ABTA 1SFCA 1L3CA 1VLMA 4KPUA 4CG3A 1L5HB 4NYIQ 3AF1A 2QZJA 5KNLA 3HU3A 2MINA 1J23A 4ON9A 5GPAA 4RJKA 3WGQA 1NQOA 4LFCB 1PJAA 4TVSA 4P3PA 4DQDA 4MRMB 5BWMA 3S28A 3Q41A 3M6AA 2VASA 2SECE 1IY9A 1MX5A 4FS8A 4TYQA 3MWJA 3ANLA 2O8EB 3U3XA 2KYVA 2XYHA 2F2EA 1GIAA 1RPWA 3MT9A 5HF9A 2I3ZA 1VIAA 4ENUA 1G20B 3ZU2A 4HFNA 4WTOA 1EJ6A 1SS1A 3V8QA 2O2EA 3VPDA 4L9NA 4K5QA 5THXA 1XTTA 5JSFA 4Z49A 2Y69H 4C05A 2IZ0A 4EG0A 4G7OF 1BE6A 3DT9A 3K1JA 3N05A 2JC3A 2D1FA 4NYMR 3D4PA 5KOHB 1ITYA 3C2BA 2FMIA 3JZIA 1L0LJ 3OLVA 4RGQA 2PDAA 4K6FA 5AVRB 2ZUDA 2OHVA 3WNBA 4KIWA 1T3SA 4UD6A 4TPKA 2CFSA 3LG2A 3IHTA 2OMEA 1HKUA 2OXCA 4RAYA 3JR7A 1FUYB 3PHCA 2R4GA 2BFMA 3HKEA 4FW9A 2RVCA 2O2XA 2LW7A 5IT9A 3M2PA 3S15J 2I03A 5AK4A 3FCCA 3WSTA 2PUVA 3LO5A 4WXEA 4M1KA 2K86A 2XAAA 1FJGB 1KEKA 4QDZA 5D8DA 3GVAA 2CE7A 3DKKA 3G23A 1OYYA 3LHKA 3VPRA 2MSEB 3B82A 3P45A 2Y9PB 1XCGB 5K3OA 2OZPA 4K9NA 2PUFA 1N6OA 2I8DA 4LRQA 5KC9A 1YMVA 4RS4A 5E4FA 3C48A 1WZ2A 1P6UA 3TI7A 4TLEA 3WK8A 3LWNA 1N3LA 4C0SA 3I6BA 4Q0MA 1JTVA 3GA7A 1IIRA 1HFWA 4CKBA 3FNFA 5EESA 1GL2C 5JJIA 3ZCSA 3K9TA 4FM9A 2G4CA 1O94C 3EXHB 3CLRD 4D25A 4JSTA 4ME6A 4H60A 1Z05A 2EZIA 4K9RA 2G7ZA 1U3TA 1WHUA 3IOCA 1JR3E 1P18A 2FRHA 1OBOA 3IRRA 3JVIA 2PSSA 2ZE6A 3JV7A 3RVQA 2J8ZA 3GTOJ 4B3FX 2IIPA 4C21A 4RTNA 2PBIA 1BKDR 1YK0A 1WBJB 4EJSA 5IVPA 4EO4A 3HO1A 1BVRA 1ZM4A 2KE5A 1NZDA 3VYSB 1NX9A 3W7AA 3TXYA 2BGIA 2VPPA 4OUDA 3UENA 3H2HA 1IN7A 4DCJA 1E5DA 1A02J 1BXRB 2ZU6A 3PC6A 4ZZ0A 2R25B 4PGMA 1JIJA 2ZVJA 3NIDB 2Q2QA 2FJ1A 3QI7A 1ZRFA 4BJ5C 5EIXA 1VLVA 4K9MA 2N9BA 2IW3A 1D2RA 4LPKA 2VAXA 4X66B 1RP7A 4G5QA 2YV3A 1QVAA 4PD4E 4N5IX 5JZVA 2EWVA 1JFLA 1QGYA 2X41A 3ANYB 1JDSA 3ZQLA 1Q0SA 3CXUA 2RIRA 1YRAA 5ELXA 2YKGA 4BJ6C 2ZUWA 3B53X 4CDNA 2X7HA 4H0EA 1ZR4A 2PBLA 2VDNB 4KOAA 4S1NA 3GMEA 4LVCA 3N4XA 5AJHA 1F2TA 4DXAA 3KCCA 3RTCA 2HNBA 1N3BA 1RXCA 1JEAA 4BAZA 3FJYA 3EQ8A 4PS1A 1PGNA 1SY7A 1YRNA 4I1IA 3GHGA 3NALA 1TX4B 2NSYA 1S0UA 3WRWA 4LSGA 2E43A 4PAOA 1AUPA 3HM5A 2Z8YM 1VMAA 3F8BA 3C9IA 4BLTA 3U4QB 3O94A 5H9VA 1GZ6A 2IUYA 5D3MA 4RQBA 1XN7A 2JSPA 1Y8QB 2H1RA 1SIBE 3L1UA 2NSLA 1OTYA 4L4SA 2D5VA 3FTPA 2PEXA 3KJFA 3HYSA 2YNYA 4NH4A 1U6GA 2HT1A 2W11A 1VPTA 3WDLA 1KYYA 5DKFA 4IMIB 3EBOA 3HB0A 2LFBA 1XC7A 2E1PA 3E35A 3GEHA 3IP5A 4DDUA 4PV1D 4DARA 2Z6QA 1K6EA 3M8FA 1F5TA 1UBEA 2XAGA 2DA1A 1Y6RA 2XB0X 5BXYA 3QF7A 5LQSA 4EWLA 4MQEB 2OFPA 1HBWA 2FR8A 3G7UA 4UFPA 4MKRA 3CUSA 1BKSB 2BEUA 2QEQA 4ZDPA 1N8KA 2EGGA 1JSZA 2PFBA 4OU5A 1ECBA 1VQNP 1SQVE 2WWTA 3EWIA 5F7JA 4RELA 1N7HA 1P7IA 5JD5A 4WQMA 1MXFA 3RK2D 4OBXA 3EWNA 3E48A 2FF5A 3VZCA 3F98A 2GEFA 1FE8A 4LXTA 1ACMA 3V1TC 1MO4A 2Y0MA 3I54A 5JFGA 5F23A 1PPJG 3O95A 2RNJA 5EZYF 2PANA 3DOHA 4HH3C 3UCXA 3TLMA 3S1RJ 3OAAD 3LVFO 4G65A 4IG4A 3GRUA 2WWVD 2WFLA 5KVSA 3QI2A 4JKOA 1T29A 3SFDC 4FHEA 5C53B 2HVSA 3PC2A 4E33A 2HA6A 1UUFA 4YRCA 3O91A 3GRAA 1M6NA 2GPJA 4UTRA 2Z5HA 3ZDFA 2QQ0A 1JH8A 1LT9A 1L9KA 3VEPA 3WLRA 4L0ZB 1E3DA 3D3KA 1ZG1A 2FFJA 3HOSA 1MG5A 2JSCA 1Q0RA 1GNSA 1Z26A 1ZLJA 1DX6A 4FFWA 3LW8A 2BGLA 1KEEA 4EA8A 3W6VA 3ZDMA 4AIRA 4YAKA 4RAGA 1DFIA 1UKCA 1FX1A 5AJWA 2EIXA 1KMMA 4DUYB 1WUYA 4BPBA 1Z83A 5DBFA 5LP6C 3U3JA 3MTAA 1KDPA 2HWYA 4PIVA 2CFOA 1VE9A 3ZJ4A 4GOND 3K0CA 4QUDA 3TDZC 1U57A 5C8YB 2H7VA 1LXCA 3WHPA 5DW3A 1ZJZA 2XLCA 3HJRA 3F9KA 2JK1A 1AOXA 3U4DA 5K8LA 1NVBA 1FFBA 1X15A 1IW7F 1JJVA 4O4HB 1W4MA 1QA6A 1TQDA 1NI5A 4WKGA 2GCNA 4CEIA 2ASVA 3NBAA 2JGDB 4CQNA 3RHZA 3BZCA 4RTSA 5JJKA 4BQNA 1ZRHA 1VKZA 5BQOA 3PFBA 4WDQA 4DWJA 4LZOA 4XFDA 3DZKA 2IZOA 1E94E 1NVVR 2H8RA 4EJ6A 3H3JA 3E15A 3OOUA 1BSHA 3AZPA 4R7ZA 3R60A 1OB5A 3W8NA 1T9CA 4LZWA 1YDHA 3PF9A 1PFQA 1IB0A 1D1PA 2QF7A 2HHAA 4YGYA 3NHUA 3UV3A 3A1EA 5JG7A 3ZNOA 1E6MA 4IICA 4Q1AA 4H1UA 2Y3IA 1JFTA 2ZNZA 2EDAA 2QL7A 1EFTA 2D1QA 2NZVG 3IAFA 2IV2X 3M5CA 3V4LA 3PQ4A 3E6BA 2EX0A 3CPHA 2ZAEB 3IPYA 3IP9A 2Y9ZA 1N5RA 1JKOC 1FTQA 2P1RA 2X0KA 3HXTA 1MR3F 5CW2A 1Q1AA 1OH5A 1QRAA 4LG3A 1G98A 3GLFE 1O08A 2QZPA 4LCEA 5LYJA 4NK5A 2J46A 3RAEC 4PVDA 3A01B 2K9JA 2CV2A 1YTYA 4BUCA 3PF8A 3RJZA 4ZD6A 5ER9A 1DBSA 4UCQA 3A6HA 2IY8A 2XF7A 2QSJA 5KQLA 3KTAB 1NK2P 3W68A 5J4LA 3QU9A 4ZGBA 3MTBA 1UBSB 2ABWA 5DTQA 5KMGB 3IJPA 1I6LA 4PSKA 1HPLA 3MFYA 3UCFA 3VHQA 1NVTA 3DEAA 2R7NA 1N77A 3IT2A 4YDRA 1PO7A 2QTNA 1EQUA 4OHMA 3K0HA 2Y31A 2GNAA 3RCBA 3E9YA 3V8NA 4YV2A 4ZVRA 2QORA 1B73A 1HLDA 3DKIA 1A1SA 4D0GA 2FBKA 2DBVO 2PMKA 1VF5B 4IEFB 3G5UA 1UFOA 3NC0C 4M0PA 4YONB 1U3FA 2OAGA 1WO8A 1CUVA 2LE0A 3Q5DA 2QJYC 1WJ5A 2F1KA 4IIFA 2QR2A 2M6SA 4TV9F 5LLSA 4N65A 4BB9A 2J9XB 2V9VA 2IVFA 2VKTA 5CLLA 5CFPA 5TE9A 3PGJA 5HVNA 2KMLA 4JB0A 3U7QA 2Q1KA 1R5OA 3B1JA 2O01H 4BO3A 1ZIDA 3G0BA 4CCAA 5BYAA 1Y33E 1NVUQ 1QHIA 3G0OA 2GLOA 3IQXA 1EE1A 3GG9A 1SCUB 4EKYA 1BYUA 3TLXA 3K9BA 3L72J 3QEMB 1I3NA 3OYLA 1XRMA 4BY9E 3CX5I 1RQLA 1GV0A 1H88C 3HZZA 3FNEA 1UDBA 2HCFA 5AI0A 3A7OA 2GJ4A 4QJBA 3OQIA 1LPQA 4Q7LA 3TB4A 1Z2AA 2BCCE 4I1UA 4D9JA 1AURA 4BLRA 2XGEA 3SLGA 2YV5A 3A70A 1J20A 4A6DA 4IHXA 1J99A 5KQMA 3OAAA 2WB2A 2OP0A 1MC1A 1D2EA 2K5UA 2HFKA 1UMBB 2OTKE 3CZMA 1JFRA 4XQGA 2PZAA 5LZ9A 3CUWA 2AYYA 5KAIE 4EKIA 4P53A 2IF2A 2COMA 1JMKC 4IYJA 4KREA 4ZC8A 2QL5A 3NZEA 3THSA 1ZN5A 1JEQA 4C22A 4RNDB 2J08A 1N1DA 2VSFA 3AILA 2E18A 4A2WA 2D2XA 5ESXA 3V7NA 3GN2A 1X77A 3SWWA 3KOYA 1B8UA 2PSDA 2V6IA 3HB7A 1QZXA 3ZRGA 3FX0A 3TIXB 4B35A 1TEVA 4D3SA 4HZGA 1DQNA 1Z17A 4BDSA 4CLOB 4HQKA 4N49A 2EQBA 5CT6A 3HVJA 5FADA 3L8EA 5HZGA 1JKMA 1KIAA 2HZ7A 1MXHA 1XUOA 1KU0A 2VK8A 1E8MA 2PRSA 4RSHA 1TXGA 5A2GA 4HQEA 2QAJA 2F3RA 4HAOA 1GL3A 1YB5A 3SC3A 3UQZA 4WASA 4V1CB 4ZQBA 1TRHA 1ETWA 3M91A 1HC7A 5JLXA 1Y4ZA 4MWBA 3I3LA 3I9FA 2CCJA 2BUBA 5G0WA 2OYHC 4PX5A 3V34A 3T61A 4HN4B 4GBJA 1V43A 2WYUA 4O1MA 1HE2A 2AEJA 1PUJA 3BD7A 5HR5A 3KU4A 2NU8B 3TK1A 1JY2O 3RAPR 4QQNA 4BLSA 1EK5A 4PGHA 4FGJA 1XXLA 3C2QA 4WLVA 3LLMA 1NUUA 5DCWA 3GA5A 1NU1J 3R09A 4PNZA 3ZMVA 1S89A 5KWVA 1H69A 4ZYVA 2F7SA 2O7RA 1N7LA 3I0ZA 4O29A 4CW7A 5JSQA 3FUXA 3CHYA 2MA3A 3PKIA 1RLJA 1DOZA 3Q8LA 1CUFA 5EDNA 4CMGA 1J56A 1F2UB 1KYIA 4ECEA 1DINA 3NTUA 4WX2B 4NIMA 4Q9JA 1J7JA 1JU9A 4RHFA 1V7CA 1CEQA 4PYQA 2C9YA 3BMCB 1QGUA 3FZQA 4MYTA 5B58C 5CBPB 1V3FA 4HAWA 4FOSA 4RVCA 4GEKA 4KISA 5L7YA 4DMGA 1RXVA 2JT1A 3TEDA 1P5JA 1VBNA 1P9QC 1DC8A 4O2BF 1VL1A 2FZWA 3GRVA 4A69C 4L75A 3FWPA 3S40A 1T3JA 4BJ5A 2E74B 2EDCA 3ABOB 4IO9F 1LDBA 2GAJA 3QFCA 3KYLA 1QO0D 2JS7A 5HBRA 3ZWPA 3AY3A 3QHPA 3K16A 5BPHA 4QJ4A 5DUIA 3A6GA 3UKJA 2WT7B 3BR5A 5B1SA 1RLTA 3GJ5A 1BFUA 4BJ6A 1DEHA 3W2AA 5TJ9A 3QQPA 4PZUA 3TBIA 4P55A 1PSZA 3C7AA 4X3OA 4JUDX 5BURA 1XT6A 4P1WA 1P7YA 1LBIA 3D7SA 2ONCA 4F86A 2ZTHA 1YZYA 4HK4A 2EW8A 3S32A 3TIGA 1PL6A 3EBPA 1PT8A 1A9SA 4XUDA 4CG0A 3K9GA 1CY1A 4HF2A 2NU9A 2ISSD 2A5FA 5JAOA 1UXIA 4RKQA 1R5NA 1FYWA 2FYNC 2YIUB 3GP8A 1JHRA 2DF8A 5CR9A 2VZLA 3C1AA 3NHRA 4EW2A 4O4IA 2FVYA 1BGYJ 3TQIA 4GOFA 5FBRB 1FFDA 2B21A 3T7SA 1P0CA 4L5CA 4LI0A 2V7UA 3MBIA 1YUMA 3PC3A 4DQXA 5SZKB 4XE5B 3VNQA 5M2QA 1Y89A 3MQ0A 3T3DA 4NFSA 2DX7A 2OZVA 2UUAB 2RAVA 2YIJA 2G9RA 3Q7SA 4NQWA 4BO8A 4IPTA 5DXJA 2VUUA 4NCKA 1TKCA 4DIKA 4EL0A 4BYMA 2XEXA 2OFXA 5KB3A 3REGA 2JAWA 4CL2A 3R2PA 5SY9A 1CY0A 3RS3A 2A33A 4W7IA 1GUYA 1ETQA 4IQGA 2XOXA 4WCDA 3PFGA 4LMBA 3EFEA 4AJOA 1DAMA 5DS9A 1GK4A 3B85A 3FOCA 1DIGA 1HTBA 1VHLA 5KYVA 2NNYA 3CMCO 3IIMA 3K1PA 1QK3A 3FWYA 2A06E 1R49A 1VJRA 4MWZA 4IIUA 3HCDA 2R7SA 3TMKA 4IOIH 3TFQA 1URPA 3EC7A 1HZZA 4ZT6A 3LGAA 2ZT7A 3KZIH 1Y7TA 3T0FA 4N0MA 1RIFA 1V3QE 2X3UA 4HDKA 3ZIAD 4TTSA 1VHQA 3DVQX 2FYUD 3BHNA 4I6ZA 3E3LA 2NV2B 3K31A 1WXXA 2PRRA 1ST3A 4UBOA 4GX1A 5DHAA 5LN1A 4U9UA 3GLXA 1SUWA 2ANCA 1DPRA 4EA6A 1R8SA 3BWYA 3U7FB 1CJBA 4AXXA 3FTDA 2W6JD 1YVRA 3BG3A 4RD0A 1VQ4P 5BVHA 2WUWE 4PZEA 3VOEA 2I2CA 1IL0A 4IUDS 1FBQA 5FDFA 1L7XA 2R8XA 3BMQA 3K0AB 3PS9A 5E3JA 2HWXA 1Y1PA 5ALGA 2XZLA 1E9RA 2HDWA 1C0KA 1X86B 4NG5A 1FW8A 4BQEA 2XWJI 1P0QA 4G2TA 4DADA 4A0GA 4M1QA 2LDUA 5DCYA 4F45A 2J4CA 4FFNA 4EY8A 5D5VB 1WV0A 1JXOA 4D8UA 1E9DA 3SNKA 5APWA 3H6HA 5GAGJ 3NT2A 4G86A 4C7JA 1RACA 4QU0A 1D09A 1L5OA 2P7IA 3VOSA 3G2MA 1VCNA 2OO5C 2SBTA 1T1SA 4M0UA 1JXQA 1AKYA 1KAGA 4XDHA 3R5XA 2K87A 2O59A 4RWEA 3LNQA 1Z4LA 3THXB 4IX7A 3QUQA 1IEVA 1CRWG 4XH9B 3NI2A 4OMFG 3HCFA 2VLAA 4AQRD 1G8SA 4M37A 1DXYA 1DO0A 4WKCA 3CBGA 1G8JA 1DCTA 2L9RA 1XVIA 5DTDA 1AE1A 4P96A 1L4HA 3U60B 2IHUA 1CB0A 3OZBA 4H1HA 3AF0A 1ATZA 1H0TA 3N8GA 4M38A 1PBNA 4X92A 1FS6A 5AJYA 1NL3A 3IPXA 1E1CA 1E61A 1GTL1 2WTXA 5BPIA 3NBKA 2ZCVA 3T94A 1JSRA 1JKQC 2HH9A 4RFSA 3H9GA 1QO0A 2XXAB 2FWRA 4HO1X 4RZ2A 5FOXA 10MHA 1QYRA 4DZPA 2RGWA 3PK0A 3LNTA 3O4VA 3N0VA 5HJ7A 2HMYB 5HF6A 5EWJB 4JLVA 4F91B 3OL3A 3Q85A 4MI9A 4KZPA 3FNGA 3LX4A 3DTTA 2F4MB 3KDPB 4L02A 3IVMA 2GUGA 3V7CA 4QQRA 4NC6A 2E75B 9ANTA 5C7OO 4JZYA 1GILA 3ZJUA 3D8SA 2CLIB 2E76C 1JT6A 1SIOA 1D1QA 4BRUA 3PQCA 3DKWA 5C5DA 1JUDA 1U8AA 4GYWA 5AUPB 1NASA 4C5BA 4BE7B 4QJIA 4Y2SA 4HUTA 1LNZA 3A4CA 4CM8B 1OROA 5CT9A 4JLJA 3HDDA 4B3AA 3LX5A 2GXBA 2IY9A 1VF9A 1Y3FE 1K75A 3TTVA 3L0SA 3S1MJ 1A5SB 1L0LG 1QGPA 3ZI4A 4P5EA 1GGEA 3OIFA 4M53A 1UFKA 1DKPA 3VPXA 4ZJYA 5BN5B 1NG6A 1I6MA 4CKYA 4PO9A 4YHHB 4DV7B 2O52A 3OYBA 1TNSA 3JRDA 1ZH5A 3IQFA 4YMGA 4YQEA 4RMNA 2YVUA 1KARA 4FFSA 1XLWA 1KQGA 1TNDA 4D5GA 4ZXPA 1X7HA 4MEBA 1BOAA 4CO8A 5DM60 5BW5A 1G66A 2ODEA 1VIYA 5FLXK 2Z2KA 1XQWA 2GJ8A 2WSCH 4NB5A 3G8AA 3IQGX 4PSVA 1PP9G 1WABA 2NUTA 1SELA 5IFKA 1JGSA 1SAXA 4FT4A 4BQAA 4KFCA 4U5QA 1D5VA 4PIMA 2E89A 4MV4A 1LE8A 1E17A 1SU8A 2BKVA 2X4DA 2V9CA 3VR2A 3CKMA 1OSNA 1IO4A 3GHYA 4DLTA 1XEAA 1HEUA 3PKJA 4Y2GA 1UM8A 4CTNA 4MI3A 1V11A 1K7EB 4KC0A 4K6KA 4FUQA 1N33B 1VE5A 4DHWA 4XIGS 1H88A 1NTKD 1VXRA 3J7AO 2FEOA 1NBHA 1AUVA 2X3FA 2C00A 5BW4A 2I80A 5KTTA 4UKDA 2XAQA 3CNHA 3UWPA 1GU4A 1Y6JA 3WQRA 2YMQA 1N9GB 4R01A 4FCCA 5HCNA 5A6SA 3OIGA 3QEKA 3ZMDA 2KNCB 1WSBA 5FUQA 3AUSA 2XVXA 4X90A 1CEXA 3ZIAA 1XGKA 4P5DA 2O5RA 5KAMA 4MPDA 1UPFA 2R7LA 4RHYA 1GUBA 3R23A 3L8HA 1E79D 2EAUA 4TTIA 3WIEA 1ONBA 1LJ2A 3VR3D 3CESA 4BTLA 4F4FA 2HDCA 3TL2A 4HMOA 4JQCA 1KBQA 4PAWA 4FXPA 2W83C 4B8WA 3WA7A 2XMDA 4RMJA 4QFCA 5D5XB 4ZYAA 2W6JA 1BWQA 1ONNA 3DW1X 2PJPA 4MQBA 4PGAA 1Y1VJ 2JIMA 1G6OA 4RF3A 3AE3C 4HH1A 2QJTA 1KVQA 5HDBB 2GBCA 3QWAA 4MYHA 4DR1B 1DC5A 1ZARA 3B4SA 1ZOOA 4PF1A 3Q2KA 5K3FB 5M29A 4JX9A 4E5VA 2ZR0A 3H9QA 4PPFA 2I1WA 5JJBA 3AR7A 4Q4DA 2Y2VA 2LXNA 4IPAA 1YGYA 3PBKA 4BE1A 4C7OA 1G3MA 3FOBA 4J4TA 1AS3A 4NZOA 1K6OA 3B6ZA 3RIMA 5BSGA 4LBWA 2HK6A 1OX3A 3MOGA 3W3ZB 2V55B 4GXRA 3RU7A 3NASA 3T6KA 3BG5A 4Y2QA 1TAUA 3CZ5A 3JCUE 2ZYSA 2NN3C 3ABQB 2B34A 2C0WA 1EZVE 2F00A 3JQGB 2Q6QA 3A3OA 1VA5A 2CEKA 4N54A 3KJZA 5EGOA 5E9WA 1KXZA 3UNGC 3NKVA 3AI1A 2FY8A 5G3ZA 4JJ8A 3WGOA 4GLOA 4Q48A 1G16A 3EIHA 4L9AA 4N5HX 7AT1A 3Q11A 1XN1A 2JI9A 3TX2A 1LX7A 2BY3A 1K9MQ 3U6BA 1W1IA 4EYSA 3OURA 3O92A 3KCQA 2Y9YA 1XXHA 3UIAA 1WRBA 2QN6A 2PUBA 3NVMB 4GOXA 3PHLA 3QXCA 1OBHA 4KKVA 3AM3A 4ZEVA 4RUKA 3T1HB 2KBFA 5K7SA 3W2HA 3HCEA 4B2YA 3QG5A 2DZDA 3EUHC 1YF3A 1CNEA 2HWWA 4LRXA 3VKUA 4OUKX 2P6PA 2FE1A 4RD2A 3E3AA 4B32A 4FYIA 4ZALA 2XHKA 3DNPA 4B6OA 3H1TA 4ZYDA 1T8UA 3DEFA 2ZRIA 1ZN9A 4ZDIA 1N7GA 4H7IA 2J3LA 5CITA 1GAEO 1T6AA 4LUCA 1B43A 2NV6A 4HZIA 2P0YA 4XRSA 2IAIA 1CR1A 2C0XA 1NW6A 1Z25A 1J24A 4MV3A 2CHFA 1DJLA 4MA0A 2JVIA 5AHWA 3EPJA 4HDNB 2E76D 2MABA 4C7MA 5JS2A 4DB4A 4L6CA 4DDTA 5B53A 2OGWA 2JLZA 2PMUA 1RKVA 5E3NA 3L43A 5EFZA 2P6TA 1TP4A 4EHLA 3V3KA 1NNI1 4IQ8A 3I8OA 2VRSA 1U81A 1SQVK 1YHYA 5ICEA 3LP8A 2VJMB 1E79H 5E3OA 3OC0A 5JO9A 2IH4A 4QLAA 1T8PA 4NBWA 1GQOA 2W8ZA 1V8BA 4TTRA 1ACJA 3AIKA 5KX5B 1Y5RA 3X1KA 2Q1XA 4L28A 3VC1A 3LQQA 1ULAA 4NARA 2C2GA 5K99A 1IGNA 1A31A 4UMVA 3RIYA 3LY7A 5B2ZA 4D9CA 3L7YA 3VOAA 3L92A 2IX9A 1TK9A 3VSCA 3FCYA 1K0UA 3ROUA 2BISA 4PX3A 4GBGA 2BBOA 1T36B 4GX5A 1CUYA 3OM1A 3RV3A 3IMCA 4KAJA 1QQIA 1TA4A 3G5MA 1EP2B 4EY4A 2GZ2A 4CN9A 1GM5A 2XA1A 3P0EA 3LDUA 2HVRA 4PZLA 4UVEA 1CIJA 1EDZA 3GJRA 1NVFA 4HEHA 1VXOA 3LPMA 2ET6A 1ORHA 1FEXA 2GPWA 3WBKA 4FYWA 2RAUA 3NTLA 1RHRA 4UATA 3TMOA 3PT9A 3SJZA 1H3FA 4NICA 1C4XA 2JFGA 2ZPTX 4G94A 1GITA 5DNDA 4EJSC 2FE4A 1UMCB 1E79A 1FTTA 1E9CA 3O9VA 3VR3A 5SZIA 4A8JB 1GW3A 2AGVA 2P2YA 1OH7A 4B4KA 4AY3A 5D3ZA 5HFJA 3ZDBA 3IEUA 2CHGA 3AM1A 1MGOA 1F6BA 3EFOB 1BMFD 1ZRNA 2Y67A 2WVJA 2ZTLA 2ZSFA 3F3SA 4FLFA 3V3TA 4FMCB 2KBEA 1TIKA 2IGTA 2AOXA 1X1PA 3RASA 2BDEA 3OFJA 3CLHA 4WB4A 1JHOA 3PNTA 3TDMA 4PC1A 4ILKA 5JVGF 3FNBA 1A4UA 4C6TB 4CEJA 1DKRA 4I1LA 4EB6B 4R7TA 5GY7A 1WSAA 1DKOA 3NTXA 1F48A 1OLXA 1E2PA 1R6UA 4UCWA 1Y37A 3MBKA 2NXNB 3GWGA 2W2KB 3P20A 3WKDA 1F1BA 3FPLA 3O8OA 3FWEA 2AFHE 1YTZI 1LTGC 4XGIA 4QARA 1EUZA 3P5SA 4UY8I 4NBSA 5LD2C 5IP5A 3L0YA 4HLUC 1RM5A 3ZWXA 4YX9A 1JXMA 4NMWA 2KT0A 1C8LA 2C77A 2WPNA 1N34B 3G6WA 2DFHA 1K73Q 3R0XA 3CXHH 3C6KA 2MH2A 2QEXP 2X9VA 3A36A 3VC3A 2WSSH 2WSEJ 1G6HA 4ZZ1A 4P31A 1YS9A 4IHKA 2OO5A 2QEXI 3CA8A 2MIIA 1EH5A 1LPSA 4QGSA 3OFKA 4PLWA 5H83A 1L0ND 2ZIEA 4AD9A 3X43A 3F6BX 4QOGA 3DKPA 4NNJA 2XEDA 2L0KA 5TQ0B 5DNWA 4L4ZA 2G09A 4CT0A 3RSLA 4Y2YA 1WG8A 4YCJA 4PM4A 3VZBA 3M89A 5KSYA 4B9EA 2VT2A 4RTOA 2ISZA 3PDJA 3DTVD 3DPSA 1BW9B 5ITSA 1L0BA 3RHFA 2BM8A 3OJAB 5SYAA 2NO1A 1Z7EA 4DCOA 4F4CA 1VCOA 1W48A 2FR8C 4XIIA 4EM6A 1H89C 2YR2A 1EKEA 3DYBA 1XMJA 2IBZG 3MM4A 3PC7A 1KYOE 1VQKP 5B4VA 3HUFA 3LWDA 3BYZA 3TNUB 1ZH2A 1DX7A 2HIHA 1DQPA 1OA1A 3L72G 3P0IA 4MWOA 3IA7A 4QLOA 3HMKA 5G3YA 2H18A 1YR2A 2YXEA 5DX0A 2O6HA 3O73A 2P9ZA 5HIAA 3KCNA 4B80A 3PQ3A 2XCUA 2KI7B 3OIQA 2ZREA 2MU1A 3PE3A 1K05A 1FFCA 3TNDA 1DTWA 4GM1A 2JJ1D 4MULA 2VBGA 5JASA 4DZOA 3EZXA 4KYTA 3BCCE 5JALA 4EMTA 2X9DA 3M70A 2YCLA 4YUAA 1GZUA 2IPLA 4HZUA 4F12A 3ZQFA 3FISA 2F5FA 4MR7B 4KICA 2XQGA 4E11A 2V4JC 4LZZA 4RIFA 2RFLA 1TO2E 2LRHA 2WDPA 2C20A 5CDYA 3AVVA 4NP6A 1G8XA 3VTPC 1FSFA 2PMFA 3CX4A 4PCLA 4FI3F 3L70E 5KPDA 4PZJA 4I5GA 3VUFA 1ST2A 1KE1A 1RPNA 1DSSG 1FNSA 3P94A 4GYJA 5HPYB 1N36B 1SVUA 5M5BA 1TMKA 3BB1A 1K5HA 4NCBA 3OYNA 1KOGA 1A71A 1OFUX 2QX9A 4OHYA 3STYA 1VYTA 2QRVA 4J76A 2EX4A 4Q03A 2JFYA 1F4LA 3IPCA 5AOAA 3ER8A 3EN0A 2ZM6B 2IKQA 4JLKA 2BMWA 4AU1A 2P9TA 1QHEA 5ALVA 2ZAIA 3HJEA 3A5TA 4KNWA 1BH6A 3WADA 4MZDA 3E3NA 3D3WB 3DAYA 2XMRA 2M5AA 1CUAA 2G4VA 2XQJA 2G5PA 4PRZA 3USES 1LUJB 2C9LY 2Y1FA 2RB4A 4PW0A 2B98A 4KIBA 2YJZA 3RTEA 3L2CA 5I7EA 2AN4A 3E5HA 3Q1MA 3A6EA 3MMYB 1P5HA 1P92A 1I2BA 1IVYA 2O7QA 1NYLA 4K3AA 1O6GA 1V5FA 1YHQI 1A8QA 1BMFA 3NDIA 4IJMA 1QMGA 3C74A 1A5AB 2JZCA 1OVUA 1W5TA 1LS1A 4A3CJ 2P3QA 1FNDA 4OXRA 2FR1A 2QMEA 1GQSA 2Q3LA 3AEBC 1W94A 4IFMA 4N6GA 2NT3A 4FLEA 1P7VA 5COQA 4JI7B 5K2OA 3IDQA 2ONJA 2W83A 3FZYA 4LOAA 4EHFA 1NF2A 1PP7U 4GRIA 3RVDA 1CYEA 1BEZA 3RHTA 3WHBA 3QBTA 4L08A 2YZNA 1L3LA 1SXJC 4BNNA 1E4YA 2VHUA 4R1NA 3DLPX 5E38A 2EB7A 4K6HA 3O4GA 3PNSA 4MRVA 2FPRA 4DV2B 2D7DA 5BW8A 1F5NA 4XLHA 4ENKA 1GZ7A 4RVNA 5C7IO 2UUCB 2P4HX 4KGXA 4BVAA 3JSAA 2RARA 1CC1S 1HETA 4ZKEA 5EE9A 5JE8A 2C9BA 1EWYA 4BVLA 4RX1A 4D26A 2QAGB 2ELKA 1CUBA 4M76B 2IVMA 2QQ8A 1VE6A 1LPPA 4W1PA 1Z0AA 3FMVA 4Q1VA 1AQNA 3HV0A 3TZKA 3T5DA 1IPHA 3SLKA 1UCFA 4B4WA 3I1JA 3CLQA 2Q99A 4EW1A 2WU1A 2XMZA 3EQLF 1G5QA 3Q7TA 1LW6E 4X62B 3IPRA 2XDJA 4R5MA 1GCAA 4MQ5A 1PEKE 3AHGA 5FEMA 1JG3A 5J2UA 2B7CA 4OK3A 5LXTB 3RYIB 4MJXA 4HTFB 2I4IA 1LGYA 3ESXA 2WEKA 1JR6A 4XLEA 3CJNA 3DTVA 4PV1C 3ZGYA 1CVLA 1G291 2L02A 3EBLA 1CULC 1BGYG 2FQQA 4HXGA 1ULHA 5CTAA 1IIBA 4OIOF 4ZEMA 1NW9B 2JUCA 1JTHB 3OOJA 5D5QA 3FXMA 2I71A 2K02A 1J39A 1US8B 4J75A 4AK9A 4TL9A 2AR9A 2C2YA 4GVXA 3U1BA 4WECA 4TT8A 1Z56A 1MDFA 3MRSA 2ID8A 4GOOD 4EIJA 4RD4A 1BGVA 1SCKA 1O5TA 2O01N 5LM3A 4FB4A 3RK2C 3MLAA 4HPWA 1ZRDA 3EUHA 3EIEA 3WMFA 1K7XB 3GUZA 3L6CA 4BWYA 2OL4A 1RYYA 1OCZH 2XBMA 3CN7A 3INGA 3U31A 5CT5A 3AY7A 3N0WA 4KB5A 5L3BA 2GETA 2GCPA 4EJTA 1TEXA 4R9SA 4BEHA 3JRAA 1KD1Q 4KH0A 3EXEB 2JJ1A 1S96A 1V45E 2EQRA 1DAOA 4OQQA 4R0NA 3IAM6 1M6VB 1NI3A 4LJKA 1S7OA 3PUWA 5EQDA 3SFZA 2JKYA 5LZ7A 4S1WA 3HABA 3QVKA 2FP4A 3UK0A 2NPOA 3AJRA 1ZOPA 3SR4A 2V7XA 4FSDA 3TZQA 2FN8A 1Z6YA 4M0KA 5THQA 1ETYA 4EW3A 1X1SA 2D00A 1XL0A 3AP2A 1WLSA 2IP1A 4FGKA 1R23A 3FSRA 4BNZA 4ZZDA 3D6AA 1A8UA 4FQ7A 2ODTX 1YLFA 4WBNF 4D2IA 3ID6C 1WA5A 3G73A 1KIFA 4ZRDA 4AYXA 5EPOA 4R51A 4UTVA 1IZNB 2ZVDA 1QCCA 4PG5A 4G26A 3U3OA 1U80A 2DHEA 1ESDA 2ZJRF 3HEAA 4UM8B 2QUFA 2ICAA 3S16J 2O54A 4MGZR 4OO3A 3U4IA 1BOBA 3L7IA 4HDMA 4ZANA 4M6YA 1TMYA 1IAQA 1J2TA 1I51A 1ZEJA 4UARA 1RM3A 3U7RA 1IZ1A 1TQ4A 1ZLLA 5SICE 1OXUA 4F1WA 3A9CA 3MTIA 5F04A 2JHGA 4XSZF 2R5YB 1SJ9A 3VTKA 1WCV1 2GA9A 4MP3A 3VDMA 1T56A 5BOSB 3L74E 1ZIOA 2QKYA 4ND8A 4D0SA 1TCVA 3N97A 5IC6A 3G88A 4OKNA 4HEQA 1JWLA 4BVBA 4D98A 4PBRA 5HNKA 4XLCA 1LWUB 5TF0A 3RZDJ 4CL0A 2F55A 5FA6A 1TPYA 1XMAA 1PN3A 4D7NA 3GLHA 5JUWA 3MBOA 4DLZA 4OAOA 3DBHB 3FFXA 1KR2A 2VDQB 2HEIA 3GO4A 3OX3A 2BGWA 3GG2A 2QMZA 5CDGA 1KGDA 5LOVA 2DYKA 2YW2A 3DD5A 1G8YA 3RJ9A 4PG6A 5BSTA 2EFPA 4R9NA 1JCCA 2UWJE 2H4JA 4GNRA 4RKEA 3LSKA 4BDYA 1UJNA 3IV9A 3L02A 3T7IA 3LC1O 4TLLB 3JRWA 2WUGA 1BWSA 2Z9OA 2XB5A 2F43A 2QXYA 2WM8A 2Q2EB 1LDJA 1JX6A 1KMHA 2QJKC 4D9IA 3RDPA 4LECA 2W6MA 3E2PA 5APXA 3MOIA 1FUKA 4RO0A 1J2EA 2X4IA 4L0DA 4RY0A 4GXOA 2GDZA 4KRXA 1ZRSA 3PQJA 3COPA 3RSOA 2ECPA 3SVLA 1IYZA 2H9AA 4MIKA 4QXPA 3CTMA 1NUHA 1GLVA 3F8FA 1ZK0A 3A0UA 2OO3A 4V0NA 1NVWQ 3DUWA 1KMQA 1CR0A 3PGA1 3Q1LA 1SXJD 3ZGNA 1Y0UA 4ISCA 3PDIB 3JQ7B 2Q8QA 1WXGA 4MGRA 3RM3A 2VJ5A 1JBEA 3SJAA 1N2HA 1FDUA 4F2GA 3W9SA 3D0SA 1MIHA 3CY6A 4YK7A 1P39A 4HLUA 5AW7B 4RK6A 3R61A 1QL1A 3KV3O 3W78A 1QONA 4J16C 2DJNA 2PH3A 3CPWO 3ONWA 2IRFG 2PPVA 1T9BA 2WJ4A 1NG9A 5F77A 3N3BC 2OUIA 4UEOA 1TWFJ 4RAZA 1QLWA 1SQ0A 3GQBB 4L16A 2WIDA 5FPHA 2I6TA 3OD5A 5JSZA 1ZP6A 1VQPP 2EXXA 4K88A 3WBBA 4E07A 1UC5B 1R50A 1MLDA 5IKOA 4FZJA 4CKEB 4K0KB 2CK3H 1N9KA 1VMDA 4DAOA 1UK8A 1ZOYC 3FWNA 2DR3A 2V6BA 1VQPI 4R5HA 1MTOA 3KOUA 2VAWA 2CZGA 4MVXA 3KXKA 4QRIA 4GRAA 4YO7A 2XYVA 4M3BA 3DVRX 3U3MA 1GZ5A 3AFGA 3REQB 1PP4A 1W85A 2QTZA 1PLKA 3UGTA 1YZTA 5TS2A 3C2HA 1H89A 1LFUP 3OJEA 1BD4A 1GPDG 2EV0A 3K53A 2DLLA 2Z2ZA 1NYHA 1A96A 5KLVK 1EM8A 3CMMA 5ECWA 4S0HB 3NARA 2EKQA 4RANA 4GI3A 3MS2A 2VF4X 2DFVA 1ND6A 3D43A 2X2EA 4DLSA 2A5WA 2WVAA 2DA3A 1DLJA 1N5KA 2HDOA 1VTKA 4TMZA 3KXIA 1IJKA 1RPJA 1IY1A 3CLUD 5AVSB 5EF6A 2VZ9A 4KVZA 5BUZA 2QTWB 1VA4A 2R48A 1HZZC 3WL5A 1T8ZA 3BFKA 2FW0A 2E4AA 4S05A 4JOSA 4LB5A 4ZAYA 1SQQK 1ZUHA 2G71A 5ED0A 4L1KA 3SBXA 1A9PA 3C4JA 2Q21A 4A5SA 4KQGA 3H11B 3SEZA 4IIJB 1IG7A 1MFPA 5F2NA 3GTKJ 3QYAA 1M2KA 4CLDA 3ZDXB 2LBFB 4UHCA 3JD0A 1LSSA 2RGVA 1R9TJ 3AIIA 3HGTA 2Q2WA 3VNAA 1KVRA 1JE8A 5IVIA 3X1ZA 3II6A 2RE8A 3ZZ0A 3S2IA 4HLNA 4GYKA 2YC4C 1BC7C 4XLLA 1G63A 3NFRA 1MV8A 1KFMA 2X0EA 3CTAA 1EU1A 2WMYA 3IV5A 1GG2A 1UADA 2V5UA 1GQ2A 4CF7A 4XWWA 1CVIA 3VKFA 4LRUA 4H3KB 1EGVB 1NTMJ 3KE9A 2HZTA 5C51B 4PPGA 5CG1A 4UEQA 2W98A 1Y8RA 1IHUA 5B64A 2JLSA 2Z5VA 2PX5A 2QD4A 3W6OA 4KSYA 1WBBA 4JUBA 4Y1RB 3OZTA 2E34A 4AM3A 3EY9A 1HDIA 5CHXA 1WH7A 5DHPA 4KYIB 1S5LH 5ERIA 2ZCUA 2KB0A 5CKTA 1JPVA 3LECA 3KZIC 3R6TA 4Y3OA 1BTOA 3RADC 1EC5A 1J5PA 1IXCA 4GBMA 3VZDA 4G6ZA 4GQAA 3SF8B 2M8GX 4COKA 2NG1A 1M8KA 5ENZA 1E3IA 3A1DA 3DF8A 4BYGA 1O3TA 4M3FA 2VWPA 4E2XA 5IJWA 4D82A 3D1VA 1PL7A 2OV2A 1XWWA 4C3JJ 2ZJ6A 2PEYA 4URFA 1KQSO 1U7XA 1Q0LA 3MZYA 3SJUA 1T0JB 3VR0A 3EDYA 3AEZA 5IBRA 2PD3A 1NWQA 3KALA 3CZQA 2NVUB 4ID9A 4HXEB 3MIWA 3TR5A 2I66A 4WW0A 1LC3A 5C39A 1L3BA 1PR3A 1QDLB 4I4TB 2C3OA 2CJJA 2VCYA 4FYHA 4GI7A 2P0WA 3JARB 2ZW9A 4UPVA 4D6TJ 1AO3A 1FFSA 2B8WA 3A4YA 3JTEA 3LH5A 4GXTA 1SXJA 4S1OA 1Y1QA 1XZDA 3RD5A 2YKQA 1MAHA 4RGUA 2K9NA 2A35A 3NM4A 1FFXA 4C04A 2ZO4A 3MEXA 2AG1A 2AQIA 5F9HA 2Y2ZA 3AG1H 4WXRA 4QATA 2M7BA 2YC2C 4QYTA 1OVRA 3KRTA 3GOHA 4FQ5A 3R9XA 1FRQA 1TU3A 3C8MA 2GI4A 4IHJB 2VKQA 3BY6A 2IIQA 3BH6A 3I5CA 2MYPA 1GKYA 3SZUA 3FLBA 2XUGA 3N9IA 4XWAA 3U7JA 4ZPJA 4M1EA 3D7RA 3OVMA 4PTLA 5J4VA 3P8MC 1Y1TA 4BO0A 4R8LA 5U1PA 3VU8A 1F36A 2YYYA 4GPTA 4WERA 2HSZA 2ZJPF 1HW5A 1JR2A 1V25A 4A1OA 4DYDA 1AC5A 1PZXA 5EMNA 2KS1A 3KQQA 1VE7A 3SZ3A 1UM9B 4CR7A 1NKVA 4RPCA 4V2UA 3H86A 3PVCA 1QGOA 3TSOA 5GTHE 5DTJA 3PUXA 4JVLA 3ELBA 3EG9B 1SOVA 3H2YA 2GB4A 3KHSA 1PYOA 2GFIA 2HREA 4FGSA 1A7KA 5HMLA 2XKKA 1MT0A 5JTTA 4XUGB 2IYPA 2SCUB 1DJMA 1EWQA 4PXYA 1GEEA 1OW7A 2IYLD 4G3XA 2ZCJA 3H1KD 3A6ZA 4FWBA 1QYCA 4UM9B 4R3UC 5K2MA 2V4MA 4M0LA 4RQAA 2O06A 2IT0A 5AUNB 4HYEA 2PT6A 3WMXA 3KQHA 3AVXA 3QE2A 1U31A 3CISA 1DE0A 3NUQA 3ASUA 2VPLA 4J3JA 4JP2A 4IEEA 4B43A 1BE3E 2XDAA 5CA1B 4QPCA 4HEA1 2HK7A 3R9KA 3AECC 2NW6A 2BW3B 4Q21A 4I7ZC 1IHOA 3LM8A 1LLUA 2GHIA 2R47A 7GPBA 1T8IA 2HBYA 4B87A 2NTYC 5DB4A 1ZONA 2J59M 3QXHA 1S9KE 5A4DA 3KEYA 4MQ4A 4Z4CA 3U21A 1CYDA 1IXKA 3HJCA 2ZBDA 3ENQA 1I1OA 5DV9A 3CDHA 5KSOA 5GQSA 4OLHA 2P2DA 2X5KO 2WPRA 4RF2A 2W6CX 2CUEA 2ZJBA 3VWBA 1UZLA 4M73A 2I7TA 4M0FA 1F8FA 5L3SA 3UEOA 4DBLE 3D8BA 2ZI4A 4TROA 5L6LB 5HRUA 3N28A 3ROQA 2FXVA 1V1JA 4II7A 3OM8A 3HYLA 3UR3C 4BASA 4NV0A 3WOVA 3W2VA 3L6EA 1A97A 5TDHA 5KYWB 1O5IA 4XKWA 3FMIA 1KEVA 4TS4A 1KFBB 5KTNA 1Z3YA 2VRWA 5DCUA 1DQRA 4NONA 3F7TA 1DU0A 1I4LD 3U56A 4RVGA 2JCYA 2L18A 1U2EA 1DD4A 2HX1A 3QVWA 4B4VA 3S2WA 1USTA 2QRXA 2NYUA 1DAHA 3MHTA 5IWAB 2BAGA 2BI8A 1X42A 3UG6A 5CLHA 3ED1A 3WNVA 1A9XB 4LYAA 1V7QA 2EQAA 2LDBA 2HXSA 5CEFA 2UXBB 3DWLE 4WOKA 5B37A 2J09A 3KFWX 2Z6UA 3EPZA 1XP5A 4ABZA 5GP1A 4NJEA 4WEOA 4MRNA 2IEKA 1P2SA 3BVPA 1ZH8A 5HUHA 4R9RA 3LPNA 4YYEA 3H1JJ 3C39A 3PEYA 3ZN0A 4PC2A 1FSZA 3IAXA 4W5OA 4QWQA 1QHHB 4LE1A 1XCBA 4FHCA 1DPGA 2STTA 2CLCX 3VSAA 4ZJUA 3AR6A 4AM8A 3VNUA 2QJRA 4TUYA 3FI0A 1LP1B 3AB7A 1FB5A 3Q3GE 3ZW9A 1BBYA 3F71A 3BBLA 1K61A 1EUDB 1YYVA 3P7NA 1O6FA 4BXFA 1G9SA 3O90A 2R1TB 1KPGA 1KORA 2FPLA 3M3HA 5A3RA 3F72A 1VQMI 2RH9B 2ZPAA 2G1UA 3H1IE 1UJCA 4UMFA 2ZR9A 4EP1A 1T5LA 5EJ5A 2LGJA 3IEMA 4Q5IA 1NSTA 4CMBA 3RSCA 3K7AJ 3H1LJ 1XVAA 4GVLA 3U1AA 3WYEA 2EZHA 3UJ7A 5D7NA 1NI4B 4ARCA 1LQ1A 1VCIA 3D5LA 5M3BA 4JN6B 3TECE 2HLHA 4MV6A 3AFIA 3ZN1A 4J16A 1ZOIA 4Q4AB 1MQAA 1Z4NA 1NC1A 2P7JA 4U3FE 4F2PA 4O4LA 4A15A 2B9SA 1PRYA 5HTOA 2X9LA 3E8SA 1UPTA 3V2QA 3GJ4A 4PJJA 3VO9A 4X8LA 3U3DA 4JCOA 3LGXA 4G0WA 2IU4A 4LIVA 1CUGA 1JAXA 3GFPA 3LKDA 2YYAA 2KQRA 1X7WB 3PJEA 2P0EA 4EM0B 2VXOA 4W7HA 1R4NB 4HADA 3IDSA 4TZTA 2XJ9A 4QYMA 4MS4A 2GD2A 2OFWA 3FUCA 4F8JA 3LTNC 4QQKA 3IULA 4GI1A 4KPEC 3VR2D 3MWFA 3VODA 3WLAA 5LVAA 3DB1A 1M74A 2QOEA 5DSTA 3F2IA 4G8JA 3TGUJ 5BRJA 1K7AA 4LDJA 1PI3A 4LOCA 1B8PA 5EQFA 3NS7A 5TVGA 2GZWA 2DW4A 5JS6A 1PL5A 4FZRA 1XWFA 4URVR 2HWUA 3WYDA 3E5NA 2GRJA 1X3WB 2RHTA 4XWGA 2EU8A 1Z2PX 4KLRA 2IJLA 2WILA 1PFKA 5IAEA 4YMWA 4LF9B 1NPTO 3HDHA 4L15A 1MBHA 2HO4A 1SOMA 3F4LA 5JZBA 2PVCA 2IGNA 2AD1A 4H7EA 1DQZA 4IGEA 2A9OA 3QMVA 4DYHA 2C31A 4BB0A 5CYPA 1WHTB 5GV8A 3CRW1 4JB2A 2BMDA 2EFQA 4LB6B 2OT3B 3MN2A 1GPNA 4F7DA 2WMOB 4W5TA 4IJAA 2SNIE 1C81A 5GONF 4CR8A 3DWFA 2WUFA 1USSA 1K7YA 4JBLA 1YRBA 1O95D 5AYVA 2B8TA 2PZBA 3HKCB 4D4MA 3V9AA 4GP7A 4FFLA 1KJNA 1Z12A 3GF4A 1CY7A 1P7WA 4J6EA 4AJEA 1S01A 2EHJA 4HQRA 1D3YA 2R7WA 3AR4A 4ZTBA 4X24A 3OZGA 2R6GA 4M9SA 4OF4A 5U9CA 3AONB 4DMCA 1HYGA 1MZBA 1Z6TA 1YS7A 1GN9A 2QTBA 4RGVA 4YT4A 4LTNA 4B3SB 3FZVA 4C14A 1VJ1A 2QVGA 1SZCA 1F43A 3J7YJ 2O23A 3HR8A 1NHAA 1XF1A 2ZJ7A 1JNYA 3HBLA 5DWQA 2F8SA 2C9DA 1H0MA 5AXBA 4JROA 4ENTA 5BNIA 1TZMA 1ELOA 3CCUI 3K4LA 1KH1A 2B1RA 1RAIA 4BAYA 1H66A 4AJNA 2YJ5A 3B5EA 5B7QA 3CQZJ 1VDMA 3RVBA 4EM1A 1DKQA 1R5GA 3FA2A 3K5PA 5M3MJ 1CFJA 2G06A 1ICIA 4R1LA 2ZXUA 2GZ1A 2BFPA 2IE8A 4P82A 2D3TA 4D7MA 2MTBA 3VR1A 3QOPA 2RCNA 3BGVA 3LPDA 2V4ZA 2DBZA 3DW3X 2VS1A 1NP6A 3DE5X 2A88A 1TYDE 3AJ9A 5FB3A 1NJ5A 3NUGA 1W25A 1SCAA 5DV5A 1FVXA 1Z37A 1PK8A 1DWOA 1XX5A 5JH7F 4RULA 3AEUB 4J07A 3WGUA 4YMHA 5B2EA 1P4RA 4JUIA 2SPZA 1EVYA 2Z58A 1C4OA 2Q0HA 5IY5H 4K81B 3WZLA 1TUGA 4ZOLF 3HL2A 1D1CA 3COYA 3ZR8X 5KJEA 1WKBA 4NJMB 1R4MA 2XCTB 3GZ6A 3H6GA 5TARA 2CWDA 4HHEA 5GTDA 4V0LA 3FFAA 4C89A 2RKHA 2PUEA 2BFEB 1AK2A 1LSUA 1TZKA 3COWA 4Z6KA 1AVYA 3BDIA 2FVXA 2YWRA 2H1FA 4MFDA 3CJRA 3DQZA 3J7AY 1S2MA 2Q1UA 1KI8A 3PG5A 4Q3EA 4BFTA 4BRSA 3JAWB 3NIWA 1FSGA 2JEZA 4MAMA 4YJ3A 3EZLA 2QK4A 3UAWA 4ALNA 2VZEA 2YHIA 1EP3B 4UU0A 4ZYWA 4WT7A 1MOQA 1W93A 1PKXA 2BV6A 4KI7A 1L1QA 3HB1A 1U0SY 1U0OC 5H3LA 1NV8A 4BUZA 3QFRA 5DO9A 3RGGA 3R3YA 3ZMUA 1BDCA 2YX7A 3LS2A 3R0QA 1HDYA 2H7XA 2BBWA 1J8FA 3LSMA 3O0TA 4HEA6 2GEDA 5BOXA 1X3ZB 2YN4A 2ZAYA 1MMNA 1NVKA 1KIMA 2R7KA 3HCNA 3UFXB 3M4YA 4HNAA 3F3YA 4H7HA 2I3DA 2I55A 1ABBA 3TW0A 3DOCA 3ZDCA 4I9GA 1I5RA 3D7NA 4E4HA 4MWDA 1KRWA 1UF9A 2ZRKA 4Q4JB 3I2YX 1YW9A 4DT1A 1CGPA 3UUWA 3EGXA 2OZLA 4KYWA 3H4MA 5KYXB 4BHBA 4LJAA 5ETJA 4J49A 2HOQA 2O8BB 1SA0A 4U7TB 1SC9A 1DAPA 1E3JA 4EG3A 3P8CD 2EH3A 5ALRA 4G84A 4RE6A 4DL9A 3NQOA 3P96A 5C3EJ 2WSFH 3GGJA 5JI2E 2VT3A 4JQFA 1CUJA 4F4JA 2PRIA 1ONPA 3I9OA 3HS3A 1QNLA 3CF2A 1O0SA 4RPLA 4PN3A 4LK0F 2PL3A 1P74A 3EDMA 4EUSA 5BMVB 4KUGA 4JC0A 1MIJA 4WLUA 5HP4A 5JI6A 1CUWA 3STVA 3LYUA 1JXSA 4QG7A 1HNWB 4LFUA 1O95A 4B1FA 3PNPA 1T0UA 3SXUA 4WIAA 4Q3AA 1F3OA 4ITUA 1FZQA 4NC9A 4LXYA 1X2BA 3FE2A 2ZBKA 4V0ME 4WGGA 1CUUA 3PQKA 4LISA 4I3GA 2WKWA 1EJ2A 3R3WA 3I0TA 1UBCA 1UOEA 1RWPA 3PNBA 4ZZ3A 2E55A 3OCUA 2REQB 4L5AA 2WUEA 3AJEA 3I09A 4XR9A 1H1DA 4A0RA 1N25A 1OX6A 4RY9A 3PNLA 2XOKD 1JBKA 4BY1J 1NSFA 2LKMA 1EA7A 3UKOA 2HV9A 3VO1A 2CD9A 4KXMA 4P38A 3TMAA 3FKJA 3IAAA 2B2CA 2YNMC 3T4PA 4K6MA 2NOGA 1ID8A 1R0WA 1QX8A 3FXAA 2RQPA 3ERMA 1NG7A 1J4AA 1NE2A 3U37A 3F0CA 4QASA 5JZ9A 1AQIA 1QV6A 4QDXA 1PNRA 3ZEAA 3JW8A 2KJCA 3HUTA 3AG3H 1DWUA 4JQSA 4QOHA 4X1OA 1UC8A 1NO4A 5DHUA 5ESWA 3ZS8A 1JQ5A 1YCFA 2EG9A 4NCXA 4R2LA 4IXNA 4EY5A 4UBIA 3PL5A 1RFLA 4RLSA 2REXB 3FHOA 5CNMA 4QUHA 1OWAA 3U80A 1B0ZA 1XRNA 3LLVA 2E3JA 3P71T 4EQZA 2YXPX 4Q3KA 3LBAA 3M82A 5JCZA 3V7WA 1VJGA 3RL0D 5IAJA 2YQ4A 4BKUA 2WWHA 2BEWB 1RLIA 1OU0A 3R7SA 1GPYA 2XRLA 1Z5ZA 2QRPA 3AR3A 4UBJA 1ZRTD 1DRVA 3MS7A 4DZTA 1NRWA 4Q1EA 3OPYB 4Y7NJ 1Z56C 1RQGA 1LPBB 3HRMA 3I76A 4QDOA 1XEFA 3ZE0B 2KPMA 2R5WA 3V1KA 4XVQA 4EMUA 2IOFA 2CUFA 2R44A 2FKAA 3AWDA 3B6JA 4REOA 2BI4A 1H6AA 5FOUA 3L1IA 3JAMA 3FVVA 2Q0XA 3V9PA 4E88A 2ETXA 5B5EE 4D3ZA 5FKOA 4AYTA 3CB4A 1WZUA 1SUFA 1SKBA 3PNOA 2N3ZA 2ZB9A 2LV8A 3UAOA 3KK0A 4B6RA 5EMMA 4IQ4A 2M6KA 2ZBVA 2HNKA 4A8PA 5AVXB 3E05A 3GLFB 4NBNA 3TRKA 3V7YA 3GFRA 5AVWA 3H19A 4LC9A 4LJ7A 5K09A 4UNOA 3NATA 4R68A 1LFPA 3CXHD 1AKHB 4ROSA 2WSSD 3EZNA 5T6MA 2XMGA 3QNMA 1UJBA 1JFFA 3DBLA 4YREA 4IOKA 1BNCA 5EJEA 3LCVB 3GMSA 2CL6X 2A86A 4OLJA 1UBUS 2JH9A 3BULA 3CVJA 2PNFA 4EZIA 2QW1A 5JXGA 3HACA 1A2KC 4LF5B 1X1DA 2HA2A 4LE2A 1AS2A 4RPIA 3J7TA 1YX5A 3KU1A 1IHYA 3EIFA 3PSFA 1SCJA 1YGPA 5E2BA 2QM7A 1NGSA 3R6DA 1MB9A 3FD8A 3X0DA 4JKIA 1XZFA 3RU9A 1ECPA 4EZBA 2BCGY 4Q9IA 1HLPA 1DDIA 3JQEA 2PH5A 1VFPA 3WGGA 3TD6A 3D5RC 4PU0A 4EFDA 5I5GA 1V16B 2Q6IA 4FN4A 1AHPA 1RESA 2FQWA 1Z0JA 4XYMA 4E32A 4EMBA 2X58A 4FDUA 1OYWA 2PO7A 4IGAA 2C9MA 1S6LA 1T3TA 4TRMA 4YB8A 3MKLA 3Q0TA 4Q9KA 1KYZA 4DQUA 4Y9TA 5G4LA