1ZSCA

Carbonic anhydrase ii mutant e117q, holo form
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAQLHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversal of the hydrogen bond to zinc ligand histidine-119 dramatically diminishes catalysis and enhances metal equilibration kinetics in carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase (oxo-acid)
molecule keywords CARBONIC ANHYDRASE II
total genus 77
structure length 257
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1996-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1zscA00
1G52A 2OSFA 5EHVA 4YXUA 5EHWA 3M1WA 3U47A 4FPTA 5E2KA 2NWPA 4YGKA 1I90A 4QK2A 4Q90A 5DSRA 1BNQA 5FLPA 3F7BA 1BCDA 1ZSBA 1HEAA 3V2JA 2NNGA 5DSQA 3HKUA 3SBHA 4PXXA 5J8ZA 4DZ7A 3RZ0B 3B4FA 1I9QA 2WEOA 3MYQA 3KNEA 1RAZA 3RYJB 1CCSA 3OYQA 1LUGA 4HBAA 3IGPA 2NNOA 3N2PA 1CVHA 4Z1NA 1URTA 3DVBA 1FQRA 4JSZA 2FMGA 1RZBA 4KUYA 8CA2A 5SZ5A 2WEJA 3P3JA 2AX2A 4Q6DA 3MHIA 4CNXA 1ZH9A 1F2WA 4Q08A 1BN1A 2HNCA 3IEOA 4RFCA 4MTYA 4DZ9A 3SAPA 1CAMA 3RYZA 3HKQA 4Z1KA 1JD0A 4R5BA 1FQLA 1CANA 3OIKA 3VBDA 4MDLA 3M2ZA 4Z0QA 4Q07A 4WL4A 5FNHA 1CA2A 3CAJA 1Z9YA 4XZ5A 4BF6A 3DCWA 2VVBX 4PYXA 3NB5A 4Q7PA 3K34A 1V9IC 4RIVA 5E2NA 5CACA 3M2NA 2FW4A 3F8EA 2NMXA 4Q81A 2WD2A 1KEQA 3U7CA 1UGEA 1TTMA 5FLSA 2NN7A 5FLTA 4BCWA 2HL4A 4KUVA 1FQNA 5DSOA 1TEQX 5EKJA 1IF5A 3SAXA 4E3HA 3M98A 3KKXA 5IPZA 5G01A 5JEHB 3CZVA 1DCBA 3MNJA 5DSJA 3R16A 3DC3A 1G0FA 2NWZA 4LP6A 1IF7A 5FNKA 5L3OA 1T9NA 4QJPA 3V3GB 1RZEA 1CNYA 4JSAA 1YDCA 2CBCA 2ABEA 3JXHC 3V3HB 2CBDA 2FMZA 4ZAOA 4FVOA 4E4AA 4KNJA 1IF4A 4KUWA 5FDIA 5EKMA 3RZ8A 3SBIA 3HKNA 4HEZA 1I8ZA 2POVA 4HT2A 3KONA 2CA2A 3DCCA 2FNKA 3KS3A 2X7TA 1DCAA 3V2MA 7CA2A 1IF9A 3M04A 3MDZA 4Q8YA 4WUQA 5L6KA 4TWLA 3EFIA 5E2SA 1G6VA 3M3XA 4HEYA 4KP8A 1CRAA 1ZSCA 4QIYA 3S76A 1CAHA 1CZMA 2POWA 3S78B 1G0EA 4ZX0A 4TWMA 1I9PA 5A25A 4PYYA 1ZSAA 4YGNA 4YGLA 4E49A 2ZNCA 3B1BA 1G45A 3MMFA 4HF3A 4Q6EA 3D9ZA 4UOVA 4Q8XA 4QJOA 4QJMA 4ZWYA 2NN1A 2HKKA 3M2XA 3NI5A 3ZP9A 1TG9A 1CAZA 5FDCA 4M2WA 4MLTA 3DVDA 1CCUA 4Q83A 5FLRA 1LG6A 3FW3A 1KWQA 4CACA 4YXOA 1HUHA 4G0CA 4JSSA 5E5RA 3V3IB 1UGFA 1MOOA 1YDDA 2WEGA 2CBAA 1ZFKA 1CVDA 2QOAA 1TE3X 3RG4A 4ETQC 3U45X 1BNVA 4HU1A 4QK3A 4ZX1A 1CNHA 5JEGB 3BL1A 1BNWA 5EOIA 2H15A 1AZMA 5E2RA 4Z1JA 5EH8A 5JQTA 2CABA 2IT4A 1Y7WA 3KIGA 1FQMA 3KWAA 1G46A 4Q7WA 5SZ4A 4KNMA 3OIMA 1YO2A 3L14A 4X5SA 4YVYA 4L5VA 3LXEA 9CA2A 1BICA 1UGAA 4QTLA 1CVFA 3HS4A 3RZ5A 3MWOA 2POUA 5JQ0A 1Z93A 4K0ZA 1CILA 2FOYA 4RUYA 1H9NA 4YWPA 3M5SA 1RJ6A 3GZ0A 3D92A 3ML5A 4Q87A 1HUGA 1OQ5A 3MHCA 5SZ2A 4N0XB 3OYSA 1ZFQA 1J9WA 2EU3A 2NXSA 4FIKA 4KV0A 3M5EA 4Q06A 5CLUA 1I9MA 3BL0A 5EIJA 2NNSA 4FU5A 5SZ0A 3FFPX 2GD8A 3V3FA 3PO6A 3TMJA 1CINA 4LHIA 3RJ7A 1CNIA 4Z1EA 4FL7A 1HCBA 4QIZA 3JXGA 1LZVA 1KWRA 4KNNA 3P58A 1FSQA 1ZGEA 3ML2A 1HEBA 1I9NA 4FVNA 1JV0A 5AMDA 3M96A 4PZHA 4KNIA 3UYQA 3W6IA 1CVEA 3MNHA 5DSPA 3M1QA 1YO1A 1XPZA 3M1KA 3M2YA 1FR7A 1YO0A 3NJ9A 2EZ7A 5SZ3A 3K2FA 1CVBA 4XE1A 2NWYA 1G48A 1H4NA 3R17B 4L5UA 4WW6A 1H9QA 3S9TA 5FNJA 5DOGA 3TVOX 4CQ0A 1G53A 3S8XA 3M40A 4CNWA 4Q99A 4N16A 5EKHA 3RGEA 3S97A 1CNCA 5HPJA 1FSRA 1OKNA 1RZDA 3T85A 1IF8A 3P3HA 2FOUA 3RYVB 1UGBA 4ZWZA 4M2UA 4K1QA 1CAYA 5SZ6A 1BN3A 3PJJA 4Q9YA 1CAIA 4C3TA 1CAOA 1RJ5A 1UGCA 4QSBA 1THKA 3S74B 4E9OX 3P55A 1FLJA 1FR4A 5JG3B 3RZ1B 3S77B 4E3DA 1CAJA 3K7KA 2X7UA 3DVCA 1XEVA 4QEFA 3OKVA 5FLQA 3IAIA 1G54A 4JS6A 6CA2A 5E2MA 1IF6A 2GEHA 3IBLA 5BRUA 3CYUA 4RH2A 4MDGA 3MHOA 1G4OA 5SZ1A 4Q7SA 4IDRX 3OILA 3HKTA 1CVAA 2HOCA 4BF1A 1JCZA 4IWZA 5G0BA 5JGTB 4M2RA 4YX4A 4QSJA 3D8WA 4MDMA 5A6HA 4WUPA 3P44A 5FL5A 1AVNA 4QJ0A 3M5TA 1RZCA 3F4XA 3D93A 1CRMA 3EFTA 4Q49A 5EZTX 5BRVA 1DMXA 3OKUA 5BYIA 1RZAA 4YGFA 3HLJA 4YHAA 4HEWA 3S73B 4QJXA 3DCSA 1CALA 1LGDA 3RG3A 2FOQA 4ITPA 1BNTA 5DSIA 4Q8ZA 2NNVA 1G1DA 3RYXB 4RUZA 4Q09A 5JEPB 1EOUA 2H4NA 3FE4A 5FNMA 1HCAA 4RUXA 3M67A 4K0TA 4PQ7A 1BNNA 1ZGFA 2QO8A 3IBNA 4QK1A 3IBIA 3BETA 1Z97A 4ILXA 2WEHA 3S72B 4E3FA 1BN4A 1BNMA 5AMGA 5C8IA 1TBTX 5SZ7A 5JG5B 5LMDA 4E3GA 5EH7A 3KLDB 4YGJA 3OY0A 1G3ZA 4QSAA 5BRWA 3U3AX 3P5LA 5G03A 1YDAA 5FL4A 3TVNX 1ZNCA 1TEUX 2O4ZA 3MNUA 3T5ZA 4QJWA 5DSLA 4CNRA 3KOKA 4ITOA 4E5QA 1HVAA 1CIMA 2QP6A 2X7SA 4FRCA 3C7PA 4R59A 3RLDA 1CNWA 5AMLA 3D0NA 5JGSB 2FNNA 3V7XA 4QSIA 2W2JA 3DAZA 5JESB 4HT0A 12CAA 1CCTA 3T82A 3UYNA 2CBBA 1FSNA 4XIXA 4L5WA 2WD3A 3RZ7A 1CNKA 1G4JA 1TG3A 3MHLA 5JDVB 4K13A 5EHEA 2VVAX 3ZNCA 3T5UA 4RIUA 3DD0A 4XIWA 1KOPA 1OKLA 3M14A 1UGDA 1TH9A 3MNKA 3N3JA 5E5UA 2NXTA 2ILIA 4CA2A 1V9EA 4WR7A 1A42A 1CNJA 1CNBA 5FNLA 4WW8A 5DRSA 5FL6A 2HD6A 3DD8A 3QYKA 1AM6A 3HFPA 3MHMA 4KP5A 3W6HA 5CJFA 4KAPA 4YYTA 4RN4A 3Q31A 3S71B 1RAYA 3S75B 1BNUA 4COQA 3DBUA 3T84A 5CA2A 1CNXA 1TB0X 2EU2A 2FOVA 5DSNA 3V3JA 2CBEA 3P4VA 3PYKA 4Q7VA 3IBUA 4MO8A 1I9LA 1HECA 1XEGA 3JXFA 2F14A 3N0NA 5EH5A 5G0CA 5DVXA 2OSMA 5DOHA 3DA2A 2Q38A 5FNIA 4Q78A 4ZWXA 1UGGA 1HEDA 3DV7A 3V5GA 4GL1X 4JSWA 4QY3A 5FLOA 1CVCA 4G7AA 3T83A 4LU3A 1ZE8A 4MLXA 2Q1QA 4M2VA 1BZMA 3KOIA 1YDBA 3MNIA 1XQ0A 2HFWA 3DC9A 3MNAA 4RFDA 1CA3A 5BNLA 4ZWIA 1BV3A 2FNMA 3F7UA 3RYYA 1LG5A 1OKMA 4R5AA 2AW1A 5FNGA 5DSMA 2NWOA 1CAKA 3P5AA 1KOQA 4CNVA 1DMYA 3M1JA 4Q0LA 4YXIA 1CNGA 1I91A 2FOSA 5DSKA 5E28A 4Y0JA 3N4BA 3MZCA 1MUAA 3CA2A 4XFWA 1I9OA 4K0SA 2Q1BA 2NXRA
chains in the Genus database with same CATH superfamily
1G52A 2OSFA 5EHVA 4YXUA 5EHWA 3M1WA 3U47A 4FPTA 5E2KA 2NWPA 4YGKA 1I90A 4QK2A 4Q90A 5DSRA 1BNQA 5FLPA 3F7BA 1BCDA 1ZSBA 1HEAA 3V2JA 2NNGA 5DSQA 3HKUA 3SBHA 4PXXA 5J8ZA 4DZ7A 3RZ0B 3B4FA 1I9QA 2WEOA 3MYQA 3KNEA 1RAZA 3RYJB 1CCSA 3OYQA 1LUGA 4HBAA 3IGPA 2NNOA 3N2PA 1CVHA 4Z1NA 1URTA 3DVBA 1FQRA 4JSZA 2FMGA 1RZBA 4KUYA 8CA2A 5SZ5A 2WEJA 3P3JA 2AX2A 4Q6DA 3MHIA 4CNXA 1ZH9A 1F2WA 4Q08A 1BN1A 2HNCA 3IEOA 4RFCA 4MTYA 4DZ9A 3SAPA 1CAMA 3RYZA 3HKQA 4Z1KA 1JD0A 4R5BA 1FQLA 1CANA 3OIKA 3VBDA 4MDLA 3M2ZA 4Z0QA 4Q07A 4WL4A 5FNHA 1CA2A 3CAJA 1Z9YA 4XZ5A 4BF6A 3DCWA 2VVBX 4PYXA 3NB5A 4Q7PA 3K34A 1V9IC 4RIVA 5E2NA 5CACA 3M2NA 2FW4A 3F8EA 2NMXA 4Q81A 2WD2A 1KEQA 3U7CA 1UGEA 1TTMA 5FLSA 2NN7A 5FLTA 4BCWA 2HL4A 4KUVA 1FQNA 5DSOA 1TEQX 5EKJA 1IF5A 3SAXA 4E3HA 3M98A 3KKXA 5IPZA 5G01A 5JEHB 3CZVA 1DCBA 3MNJA 5DSJA 3R16A 3DC3A 1G0FA 2NWZA 4LP6A 1IF7A 5FNKA 5L3OA 1T9NA 4QJPA 3V3GB 1RZEA 1CNYA 4JSAA 1YDCA 2CBCA 2ABEA 3JXHC 3V3HB 2CBDA 2FMZA 4ZAOA 4FVOA 4E4AA 4KNJA 1IF4A 4KUWA 5FDIA 5EKMA 3RZ8A 3SBIA 3HKNA 4HEZA 1I8ZA 2POVA 4HT2A 3KONA 2CA2A 3DCCA 2FNKA 3KS3A 2X7TA 1DCAA 3V2MA 7CA2A 1IF9A 3M04A 3MDZA 4Q8YA 4WUQA 5L6KA 4TWLA 3EFIA 5E2SA 1G6VA 3M3XA 4HEYA 4KP8A 1CRAA 1ZSCA 4QIYA 3S76A 1CAHA 1CZMA 2POWA 3S78B 1G0EA 4ZX0A 4TWMA 1I9PA 5A25A 4PYYA 1ZSAA 4YGNA 4YGLA 4E49A 2ZNCA 3B1BA 1G45A 3MMFA 4HF3A 4Q6EA 3D9ZA 4UOVA 4Q8XA 4QJOA 4QJMA 4ZWYA 2NN1A 2HKKA 3M2XA 3NI5A 3ZP9A 1TG9A 1CAZA 5FDCA 4M2WA 4MLTA 3DVDA 1CCUA 4Q83A 5FLRA 1LG6A 3FW3A 1KWQA 4CACA 4YXOA 1HUHA 4G0CA 4JSSA 5E5RA 3V3IB 1UGFA 1MOOA 1YDDA 2WEGA 2CBAA 1ZFKA 1CVDA 2QOAA 1TE3X 3RG4A 4ETQC 3U45X 1BNVA 4HU1A 4QK3A 4ZX1A 1CNHA 5JEGB 3BL1A 1BNWA 5EOIA 2H15A 1AZMA 5E2RA 4Z1JA 5EH8A 5JQTA 2CABA 2IT4A 1Y7WA 3KIGA 1FQMA 3KWAA 1G46A 4Q7WA 5SZ4A 4KNMA 3OIMA 1YO2A 3L14A 4X5SA 4YVYA 4L5VA 3LXEA 9CA2A 1BICA 1UGAA 4QTLA 1CVFA 3HS4A 3RZ5A 3MWOA 2POUA 5JQ0A 1Z93A 4K0ZA 1CILA 2FOYA 4RUYA 1H9NA 4YWPA 3M5SA 1RJ6A 3GZ0A 3D92A 3ML5A 4Q87A 1HUGA 1OQ5A 3MHCA 5SZ2A 4N0XB 3OYSA 1ZFQA 1J9WA 2EU3A 2NXSA 4FIKA 4KV0A 3M5EA 4Q06A 5CLUA 1I9MA 3BL0A 5EIJA 2NNSA 4FU5A 5SZ0A 3FFPX 2GD8A 3V3FA 3PO6A 3TMJA 1CINA 4LHIA 3RJ7A 1CNIA 4Z1EA 4FL7A 1HCBA 4QIZA 3JXGA 1LZVA 1KWRA 4KNNA 3P58A 1FSQA 1ZGEA 3ML2A 1HEBA 1I9NA 4FVNA 1JV0A 5AMDA 3M96A 4PZHA 4KNIA 3UYQA 3W6IA 1CVEA 3MNHA 5DSPA 3M1QA 1YO1A 1XPZA 3M1KA 3M2YA 1FR7A 1YO0A 3NJ9A 2EZ7A 5SZ3A 3K2FA 1CVBA 4XE1A 2NWYA 1G48A 1H4NA 3R17B 4L5UA 4WW6A 1H9QA 3S9TA 5FNJA 5DOGA 3TVOX 4CQ0A 1G53A 3S8XA 3M40A 4CNWA 4Q99A 4N16A 5EKHA 3RGEA 3S97A 1CNCA 5HPJA 1FSRA 1OKNA 1RZDA 3T85A 1IF8A 3P3HA 2FOUA 3RYVB 1UGBA 4ZWZA 4M2UA 4K1QA 1CAYA 5SZ6A 1BN3A 3PJJA 4Q9YA 1CAIA 4C3TA 1CAOA 1RJ5A 1UGCA 4QSBA 1THKA 3S74B 4E9OX 3P55A 1FLJA 1FR4A 5JG3B 3RZ1B 3S77B 4E3DA 1CAJA 3K7KA 2X7UA 3DVCA 1XEVA 4QEFA 3OKVA 5FLQA 3IAIA 1G54A 4JS6A 6CA2A 5E2MA 1IF6A 2GEHA 3IBLA 5BRUA 3CYUA 4RH2A 4MDGA 3MHOA 1G4OA 5SZ1A 4Q7SA 4IDRX 3OILA 3HKTA 1CVAA 2HOCA 4BF1A 1JCZA 4IWZA 5G0BA 5JGTB 4M2RA 4YX4A 4QSJA 3D8WA 4MDMA 5A6HA 4WUPA 3P44A 5FL5A 1AVNA 4QJ0A 3M5TA 1RZCA 3F4XA 3D93A 1CRMA 3EFTA 4Q49A 5EZTX 5BRVA 1DMXA 3OKUA 5BYIA 1RZAA 4YGFA 3HLJA 4YHAA 4HEWA 3S73B 4QJXA 3DCSA 1CALA 1LGDA 3RG3A 2FOQA 4ITPA 1BNTA 5DSIA 4Q8ZA 2NNVA 1G1DA 3RYXB 4RUZA 4Q09A 5JEPB 1EOUA 2H4NA 3FE4A 5FNMA 1HCAA 4RUXA 3M67A 4K0TA 4PQ7A 1BNNA 1ZGFA 2QO8A 3IBNA 4QK1A 3IBIA 3BETA 1Z97A 4ILXA 2WEHA 3S72B 4E3FA 1BN4A 1BNMA 5AMGA 5C8IA 1TBTX 5SZ7A 5JG5B 5LMDA 4E3GA 5EH7A 3KLDB 4YGJA 3OY0A 1G3ZA 4QSAA 5BRWA 3U3AX 3P5LA 5G03A 1YDAA 5FL4A 3TVNX 1ZNCA 1TEUX 2O4ZA 3MNUA 3T5ZA 4QJWA 5DSLA 4CNRA 3KOKA 4ITOA 4E5QA 1HVAA 1CIMA 2QP6A 2X7SA 4FRCA 3C7PA 4R59A 3RLDA 1CNWA 5AMLA 3D0NA 5JGSB 2FNNA 3V7XA 4QSIA 2W2JA 3DAZA 5JESB 4HT0A 12CAA 1CCTA 3T82A 3UYNA 2CBBA 1FSNA 4XIXA 4L5WA 2WD3A 3RZ7A 1CNKA 1G4JA 1TG3A 3MHLA 5JDVB 4K13A 5EHEA 2VVAX 3ZNCA 3T5UA 4RIUA 3DD0A 4XIWA 1KOPA 1OKLA 3M14A 1UGDA 1TH9A 3MNKA 3N3JA 5E5UA 2NXTA 2ILIA 4CA2A 1V9EA 4WR7A 1A42A 1CNJA 1CNBA 5FNLA 4WW8A 5DRSA 5FL6A 2HD6A 3DD8A 3QYKA 1AM6A 3HFPA 3MHMA 4KP5A 3W6HA 5CJFA 4KAPA 4YYTA 4RN4A 3Q31A 3S71B 1RAYA 3S75B 1BNUA 4COQA 3DBUA 3T84A 5CA2A 1CNXA 1TB0X 2EU2A 2FOVA 5DSNA 3V3JA 2CBEA 3P4VA 3PYKA 4Q7VA 3IBUA 4MO8A 1I9LA 1HECA 1XEGA 3JXFA 2F14A 3N0NA 5EH5A 5G0CA 5DVXA 2OSMA 5DOHA 3DA2A 2Q38A 5FNIA 4Q78A 4ZWXA 1UGGA 1HEDA 3DV7A 3V5GA 4GL1X 4JSWA 4QY3A 5FLOA 1CVCA 4G7AA 3T83A 4LU3A 1ZE8A 4MLXA 2Q1QA 4M2VA 1BZMA 3KOIA 1YDBA 3MNIA 1XQ0A 2HFWA 3DC9A 3MNAA 4RFDA 1CA3A 5BNLA 4ZWIA 1BV3A 2FNMA 3F7UA 3RYYA 1LG5A 1OKMA 4R5AA 2AW1A 5FNGA 5DSMA 2NWOA 1CAKA 3P5AA 1KOQA 4CNVA 1DMYA 3M1JA 4Q0LA 4YXIA 1CNGA 1I91A 2FOSA 5DSKA 5E28A 4Y0JA 3N4BA 3MZCA 1MUAA 3CA2A 4XFWA 1I9OA 4K0SA 2Q1BA 2NXRA
chains in the Genus database with same CATH topology
1G52A 2OSFA 5EHVA 4YXUA 5EHWA 3M1WA 3U47A 4FPTA 5E2KA 2NWPA 4YGKA 1I90A 4QK2A 4Q90A 5DSRA 1BNQA 5FLPA 3F7BA 1BCDA 1ZSBA 1HEAA 3V2JA 2NNGA 5DSQA 3HKUA 3SBHA 4PXXA 5J8ZA 4DZ7A 3RZ0B 3B4FA 1I9QA 2WEOA 3MYQA 3KNEA 1RAZA 3RYJB 1CCSA 3OYQA 1LUGA 4HBAA 3IGPA 2NNOA 3N2PA 1CVHA 4Z1NA 1URTA 3DVBA 1FQRA 4JSZA 2FMGA 1RZBA 4KUYA 8CA2A 5SZ5A 2WEJA 3P3JA 2AX2A 4Q6DA 3MHIA 4CNXA 1ZH9A 1F2WA 4Q08A 1BN1A 2HNCA 3IEOA 4RFCA 4MTYA 4DZ9A 3SAPA 1CAMA 3RYZA 3HKQA 4Z1KA 1JD0A 4R5BA 1FQLA 1CANA 3OIKA 3VBDA 4MDLA 3M2ZA 4Z0QA 4Q07A 4WL4A 5FNHA 1CA2A 3CAJA 1Z9YA 4XZ5A 4BF6A 3DCWA 2VVBX 4PYXA 3NB5A 4Q7PA 3K34A 1V9IC 4RIVA 5E2NA 5CACA 3M2NA 2FW4A 3F8EA 2NMXA 4Q81A 2WD2A 1KEQA 3U7CA 1UGEA 1TTMA 5FLSA 2NN7A 5FLTA 4BCWA 2HL4A 4KUVA 1FQNA 5DSOA 1TEQX 5EKJA 1IF5A 3SAXA 4E3HA 3M98A 3KKXA 5IPZA 5G01A 5JEHB 3CZVA 1DCBA 3MNJA 5DSJA 3R16A 3DC3A 1G0FA 2NWZA 4LP6A 1IF7A 5FNKA 5L3OA 1T9NA 4QJPA 3V3GB 1RZEA 1CNYA 4JSAA 1YDCA 2CBCA 2ABEA 3JXHC 3V3HB 2CBDA 2FMZA 4ZAOA 4FVOA 4E4AA 4KNJA 1IF4A 4KUWA 5FDIA 5EKMA 3RZ8A 3SBIA 3HKNA 4HEZA 1I8ZA 2POVA 4HT2A 3KONA 2CA2A 3DCCA 2FNKA 3KS3A 2X7TA 1DCAA 3V2MA 7CA2A 1IF9A 3M04A 3MDZA 4Q8YA 4WUQA 5L6KA 4TWLA 3EFIA 5E2SA 1G6VA 3M3XA 4HEYA 4KP8A 1CRAA 1ZSCA 4QIYA 3S76A 1CAHA 1CZMA 2POWA 3S78B 1G0EA 4ZX0A 4TWMA 1I9PA 5A25A 4PYYA 1ZSAA 4YGNA 4YGLA 4E49A 2ZNCA 3B1BA 1G45A 3MMFA 4HF3A 4Q6EA 3D9ZA 4UOVA 4Q8XA 4QJOA 4QJMA 4ZWYA 2NN1A 2HKKA 3M2XA 3NI5A 3ZP9A 1TG9A 1CAZA 5FDCA 4M2WA 4MLTA 3DVDA 1CCUA 4Q83A 5FLRA 1LG6A 3FW3A 1KWQA 4CACA 4YXOA 1HUHA 4G0CA 4JSSA 5E5RA 3V3IB 1UGFA 1MOOA 1YDDA 2WEGA 2CBAA 1ZFKA 1CVDA 2QOAA 1TE3X 3RG4A 4ETQC 3U45X 1BNVA 4HU1A 4QK3A 4ZX1A 1CNHA 5JEGB 3BL1A 1BNWA 5EOIA 2H15A 1AZMA 5E2RA 4Z1JA 5EH8A 5JQTA 2CABA 2IT4A 1Y7WA 3KIGA 1FQMA 3KWAA 1G46A 4Q7WA 5SZ4A 4KNMA 3OIMA 1YO2A 3L14A 4X5SA 4YVYA 4L5VA 3LXEA 9CA2A 1BICA 1UGAA 4QTLA 1CVFA 3HS4A 3RZ5A 3MWOA 2POUA 5JQ0A 1Z93A 4K0ZA 1CILA 2FOYA 4RUYA 1H9NA 4YWPA 3M5SA 1RJ6A 3GZ0A 3D92A 3ML5A 4Q87A 1HUGA 1OQ5A 3MHCA 5SZ2A 4N0XB 3OYSA 1ZFQA 1J9WA 2EU3A 2NXSA 4FIKA 4KV0A 3M5EA 4Q06A 5CLUA 1I9MA 3BL0A 5EIJA 2NNSA 4FU5A 5SZ0A 3FFPX 2GD8A 3V3FA 3PO6A 3TMJA 1CINA 4LHIA 3RJ7A 1CNIA 4Z1EA 4FL7A 1HCBA 4QIZA 3JXGA 1LZVA 1KWRA 4KNNA 3P58A 1FSQA 1ZGEA 3ML2A 1HEBA 1I9NA 4FVNA 1JV0A 5AMDA 3M96A 4PZHA 4KNIA 3UYQA 3W6IA 1CVEA 3MNHA 5DSPA 3M1QA 1YO1A 1XPZA 3M1KA 3M2YA 1FR7A 1YO0A 3NJ9A 2EZ7A 5SZ3A 3K2FA 1CVBA 4XE1A 2NWYA 1G48A 1H4NA 3R17B 4L5UA 4WW6A 1H9QA 3S9TA 5FNJA 5DOGA 3TVOX 4CQ0A 1G53A 3S8XA 3M40A 4CNWA 4Q99A 4N16A 5EKHA 3RGEA 3S97A 1CNCA 5HPJA 1FSRA 1OKNA 1RZDA 3T85A 1IF8A 3P3HA 2FOUA 3RYVB 1UGBA 4ZWZA 4M2UA 4K1QA 1CAYA 5SZ6A 1BN3A 3PJJA 4Q9YA 1CAIA 4C3TA 1CAOA 1RJ5A 1UGCA 4QSBA 1THKA 3S74B 4E9OX 3P55A 1FLJA 1FR4A 5JG3B 3RZ1B 3S77B 4E3DA 1CAJA 3K7KA 2X7UA 3DVCA 1XEVA 4QEFA 3OKVA 5FLQA 3IAIA 1G54A 4JS6A 6CA2A 5E2MA 1IF6A 2GEHA 3IBLA 5BRUA 3CYUA 4RH2A 4MDGA 3MHOA 1G4OA 5SZ1A 4Q7SA 4IDRX 3OILA 3HKTA 1CVAA 2HOCA 4BF1A 1JCZA 4IWZA 5G0BA 5JGTB 4M2RA 4YX4A 4QSJA 3D8WA 4MDMA 5A6HA 4WUPA 3P44A 5FL5A 1AVNA 4QJ0A 3M5TA 1RZCA 3F4XA 3D93A 1CRMA 3EFTA 4Q49A 5EZTX 5BRVA 1DMXA 3OKUA 5BYIA 1RZAA 4YGFA 3HLJA 4YHAA 4HEWA 3S73B 4QJXA 3DCSA 1CALA 1LGDA 3RG3A 2FOQA 4ITPA 1BNTA 5DSIA 4Q8ZA 2NNVA 1G1DA 3RYXB 4RUZA 4Q09A 5JEPB 1EOUA 2H4NA 3FE4A 5FNMA 1HCAA 4RUXA 3M67A 4K0TA 4PQ7A 1BNNA 1ZGFA 2QO8A 3IBNA 4QK1A 3IBIA 3BETA 1Z97A 4ILXA 2WEHA 3S72B 4E3FA 1BN4A 1BNMA 5AMGA 5C8IA 1TBTX 5SZ7A 5JG5B 5LMDA 4E3GA 5EH7A 3KLDB 4YGJA 3OY0A 1G3ZA 4QSAA 5BRWA 3U3AX 3P5LA 5G03A 1YDAA 5FL4A 3TVNX 1ZNCA 1TEUX 2O4ZA 3MNUA 3T5ZA 4QJWA 5DSLA 4CNRA 3KOKA 4ITOA 4E5QA 1HVAA 1CIMA 2QP6A 2X7SA 4FRCA 3C7PA 4R59A 3RLDA 1CNWA 5AMLA 3D0NA 5JGSB 2FNNA 3V7XA 4QSIA 2W2JA 3DAZA 5JESB 4HT0A 12CAA 1CCTA 3T82A 3UYNA 2CBBA 1FSNA 4XIXA 4L5WA 2WD3A 3RZ7A 1CNKA 1G4JA 1TG3A 3MHLA 5JDVB 4K13A 5EHEA 2VVAX 3ZNCA 3T5UA 4RIUA 3DD0A 4XIWA 1KOPA 1OKLA 3M14A 1UGDA 1TH9A 3MNKA 3N3JA 5E5UA 2NXTA 2ILIA 4CA2A 1V9EA 4WR7A 1A42A 1CNJA 1CNBA 5FNLA 4WW8A 5DRSA 5FL6A 2HD6A 3DD8A 3QYKA 1AM6A 3HFPA 3MHMA 4KP5A 3W6HA 5CJFA 4KAPA 4YYTA 4RN4A 3Q31A 3S71B 1RAYA 3S75B 1BNUA 4COQA 3DBUA 3T84A 5CA2A 1CNXA 1TB0X 2EU2A 2FOVA 5DSNA 3V3JA 2CBEA 3P4VA 3PYKA 4Q7VA 3IBUA 4MO8A 1I9LA 1HECA 1XEGA 3JXFA 2F14A 3N0NA 5EH5A 5G0CA 5DVXA 2OSMA 5DOHA 3DA2A 2Q38A 5FNIA 4Q78A 4ZWXA 1UGGA 1HEDA 3DV7A 3V5GA 4GL1X 4JSWA 4QY3A 5FLOA 1CVCA 4G7AA 3T83A 4LU3A 1ZE8A 4MLXA 2Q1QA 4M2VA 1BZMA 3KOIA 1YDBA 3MNIA 1XQ0A 2HFWA 3DC9A 3MNAA 4RFDA 1CA3A 5BNLA 4ZWIA 1BV3A 2FNMA 3F7UA 3RYYA 1LG5A 1OKMA 4R5AA 2AW1A 5FNGA 5DSMA 2NWOA 1CAKA 3P5AA 1KOQA 4CNVA 1DMYA 3M1JA 4Q0LA 4YXIA 1CNGA 1I91A 2FOSA 5DSKA 5E28A 4Y0JA 3N4BA 3MZCA 1MUAA 3CA2A 4XFWA 1I9OA 4K0SA 2Q1BA 2NXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G52 A;  2OSF A;  5EHV A;  4YXU A;  5EHW A;  3M1W A;  3U47 A;  4FPT A;  5E2K A;  2NWP A;  4YGK A;  1I90 A;  4QK2 A;  4Q90 A;  5DSR A;  1BNQ A;  5FLP A;  3F7B A;  1BCD A;  1ZSB A;  1HEA A;  3V2J A;  2NNG A;  5DSQ A;  3HKU A;  3SBH A;  4PXX A;  5J8Z A;  4DZ7 A;  3RZ0 B;  3B4F A;  1I9Q A;  2WEO A;  3MYQ A;  3KNE A;  1RAZ A;  3RYJ B;  1CCS A;  3OYQ A;  1LUG A;  4HBA A;  3IGP A;  2NNO A;  3N2P A;  1CVH A;  4Z1N A;  1URT A;  3DVB A;  1FQR A;  4JSZ A;  2FMG A;  1RZB A;  4KUY A;  8CA2 A;  5SZ5 A;  2WEJ A;  3P3J A;  2AX2 A;  4Q6D A;  3MHI A;  4CNX A;  1ZH9 A;  1F2W A;  4Q08 A;  1BN1 A;  2HNC A;  3IEO A;  4RFC A;  4MTY A;  4DZ9 A;  3SAP A;  1CAM A;  3RYZ A;  3HKQ A;  4Z1K A;  1JD0 A;  4R5B A;  1FQL A;  1CAN A;  3OIK A;  3VBD A;  4MDL A;  3M2Z A;  4Z0Q A;  4Q07 A;  4WL4 A;  5FNH A;  1CA2 A;  3CAJ A;  1Z9Y A;  4XZ5 A;  4BF6 A;  3DCW A;  2VVB X;  4PYX A;  3NB5 A;  4Q7P A;  3K34 A;  1V9I C;  4RIV A;  5E2N A;  5CAC A;  3M2N A;  2FW4 A;  3F8E A;  2NMX A;  4Q81 A;  2WD2 A;  1KEQ A;  3U7C A;  1UGE A;  1TTM A;  5FLS A;  2NN7 A;  5FLT A;  4BCW A;  2HL4 A;  4KUV A;  1FQN A;  5DSO A;  1TEQ X;  5EKJ A;  1IF5 A;  3SAX A;  4E3H A;  3M98 A;  3KKX A;  5IPZ A;  5G01 A;  5JEH B;  3CZV A;  1DCB A;  3MNJ A;  5DSJ A;  3R16 A;  3DC3 A;  1G0F A;  2NWZ A;  4LP6 A;  1IF7 A;  5FNK A;  5L3O A;  1T9N A;  4QJP A;  3V3G B;  1RZE A;  1CNY A;  4JSA A;  1YDC A;  2CBC A;  2ABE A;  3JXH C;  3V3H B;  2CBD A;  2FMZ A;  4ZAO A;  4FVO A;  4E4A A;  4KNJ A;  1IF4 A;  4KUW A;  5FDI A;  5EKM A;  3RZ8 A;  3SBI A;  3HKN A;  4HEZ A;  1I8Z A;  2POV A;  4HT2 A;  3KON A;  2CA2 A;  3DCC A;  2FNK A;  3KS3 A;  2X7T A;  1DCA A;  3V2M A;  7CA2 A;  1IF9 A;  3M04 A;  3MDZ A;  4Q8Y A;  4WUQ A;  5L6K A;  4TWL A;  3EFI A;  5E2S A;  1G6V A;  3M3X A;  4HEY A;  4KP8 A;  1CRA A;  1ZSC A;  4QIY A;  3S76 A;  1CAH A;  1CZM A;  2POW A;  3S78 B;  1G0E A;  4ZX0 A;  4TWM A;  1I9P A;  5A25 A;  4PYY A;  1ZSA A;  4YGN A;  4YGL A;  4E49 A;  2ZNC A;  3B1B A;  1G45 A;  3MMF A;  4HF3 A;  4Q6E A;  3D9Z A;  4UOV A;  4Q8X A;  4QJO A;  4QJM A;  4ZWY A;  2NN1 A;  2HKK A;  3M2X A;  3NI5 A;  3ZP9 A;  1TG9 A;  1CAZ A;  5FDC A;  4M2W A;  4MLT A;  3DVD A;  1CCU A;  4Q83 A;  5FLR A;  1LG6 A;  3FW3 A;  1KWQ A;  4CAC A;  4YXO A;  1HUH A;  4G0C A;  4JSS A;  5E5R A;  3V3I B;  1UGF A;  1MOO A;  1YDD A;  2WEG A;  2CBA A;  1ZFK A;  1CVD A;  2QOA A;  1TE3 X;  3RG4 A;  4ETQ C;  3U45 X;  1BNV A;  4HU1 A;  4QK3 A;  4ZX1 A;  1CNH A;  5JEG B;  3BL1 A;  1BNW A;  5EOI A;  2H15 A;  1AZM A;  5E2R A;  4Z1J A;  5EH8 A;  5JQT A;  2CAB A;  2IT4 A;  1Y7W A;  3KIG A;  1FQM A;  3KWA A;  1G46 A;  4Q7W A;  5SZ4 A;  4KNM A;  3OIM A;  1YO2 A;  3L14 A;  4X5S A;  4YVY A;  4L5V A;  3LXE A;  9CA2 A;  1BIC A;  1UGA A;  4QTL A;  1CVF A;  3HS4 A;  3RZ5 A;  3MWO A;  2POU A;  5JQ0 A;  1Z93 A;  4K0Z A;  1CIL A;  2FOY A;  4RUY A;  1H9N A;  4YWP A;  3M5S A;  1RJ6 A;  3GZ0 A;  3D92 A;  3ML5 A;  4Q87 A;  1HUG A;  1OQ5 A;  3MHC A;  5SZ2 A;  4N0X B;  3OYS A;  1ZFQ A;  1J9W A;  2EU3 A;  2NXS A;  4FIK A;  4KV0 A;  3M5E A;  4Q06 A;  5CLU A;  1I9M A;  3BL0 A;  5EIJ A;  2NNS A;  4FU5 A;  5SZ0 A;  3FFP X;  2GD8 A;  3V3F A;  3PO6 A;  3TMJ A;  1CIN A;  4LHI A;  3RJ7 A;  1CNI A;  4Z1E A;  4FL7 A;  1HCB A;  4QIZ A;  3JXG A;  1LZV A;  1KWR A;  4KNN A;  3P58 A;  1FSQ A;  1ZGE A;  3ML2 A;  1HEB A;  1I9N A;  4FVN A;  1JV0 A;  5AMD A;  3M96 A;  4PZH A;  4KNI A;  3UYQ A;  3W6I A;  1CVE A;  3MNH A;  5DSP A;  3M1Q A;  1YO1 A;  1XPZ A;  3M1K A;  3M2Y A;  1FR7 A;  1YO0 A;  3NJ9 A;  2EZ7 A;  5SZ3 A;  3K2F A;  1CVB A;  4XE1 A;  2NWY A;  1G48 A;  1H4N A;  3R17 B;  4L5U A;  4WW6 A;  1H9Q A;  3S9T A;  5FNJ A;  5DOG A;  3TVO X;  4CQ0 A;  1G53 A;  3S8X A;  3M40 A;  4CNW A;  4Q99 A;  4N16 A;  5EKH A;  3RGE A;  3S97 A;  1CNC A;  5HPJ A;  1FSR A;  1OKN A;  1RZD A;  3T85 A;  1IF8 A;  3P3H A;  2FOU A;  3RYV B;  1UGB A;  4ZWZ A;  4M2U A;  4K1Q A;  1CAY A;  5SZ6 A;  1BN3 A;  3PJJ A;  4Q9Y A;  1CAI A;  4C3T A;  1CAO A;  1RJ5 A;  1UGC A;  4QSB A;  1THK A;  3S74 B;  4E9O X;  3P55 A;  1FLJ A;  1FR4 A;  5JG3 B;  3RZ1 B;  3S77 B;  4E3D A;  1CAJ A;  3K7K A;  2X7U A;  3DVC A;  1XEV A;  4QEF A;  3OKV A;  5FLQ A;  3IAI A;  1G54 A;  4JS6 A;  6CA2 A;  5E2M A;  1IF6 A;  2GEH A;  3IBL A;  5BRU A;  3CYU A;  4RH2 A;  4MDG A;  3MHO A;  1G4O A;  5SZ1 A;  4Q7S A;  4IDR X;  3OIL A;  3HKT A;  1CVA A;  2HOC A;  4BF1 A;  1JCZ A;  4IWZ A;  5G0B A;  5JGT B;  4M2R A;  4YX4 A;  4QSJ A;  3D8W A;  4MDM A;  5A6H A;  4WUP A;  3P44 A;  5FL5 A;  1AVN A;  4QJ0 A;  3M5T A;  1RZC A;  3F4X A;  3D93 A;  1CRM A;  3EFT A;  4Q49 A;  5EZT X;  5BRV A;  1DMX A;  3OKU A;  5BYI A;  1RZA A;  4YGF A;  3HLJ A;  4YHA A;  4HEW A;  3S73 B;  4QJX A;  3DCS A;  1CAL A;  1LGD A;  3RG3 A;  2FOQ A;  4ITP A;  1BNT A;  5DSI A;  4Q8Z A;  2NNV A;  1G1D A;  3RYX B;  4RUZ A;  4Q09 A;  5JEP B;  1EOU A;  2H4N A;  3FE4 A;  5FNM A;  1HCA A;  4RUX A;  3M67 A;  4K0T A;  4PQ7 A;  1BNN A;  1ZGF A;  2QO8 A;  3IBN A;  4QK1 A;  3IBI A;  3BET A;  1Z97 A;  4ILX A;  2WEH A;  3S72 B;  4E3F A;  1BN4 A;  1BNM A;  5AMG A;  5C8I A;  1TBT X;  5SZ7 A;  5JG5 B;  5LMD A;  4E3G A;  5EH7 A;  3KLD B;  4YGJ A;  3OY0 A;  1G3Z A;  4QSA A;  5BRW A;  3U3A X;  3P5L A;  5G03 A;  1YDA A;  5FL4 A;  3TVN X;  1ZNC A;  1TEU X;  2O4Z A;  3MNU A;  3T5Z A;  4QJW A;  5DSL A;  4CNR A;  3KOK A;  4ITO A;  4E5Q A;  1HVA A;  1CIM A;  2QP6 A;  2X7S A;  4FRC A;  3C7P A;  4R59 A;  3RLD A;  1CNW A;  5AML A;  3D0N A;  5JGS B;  2FNN A;  3V7X A;  4QSI A;  2W2J A;  3DAZ A;  5JES B;  4HT0 A;  12CA A;  1CCT A;  3T82 A;  3UYN A;  2CBB A;  1FSN A;  4XIX A;  4L5W A;  2WD3 A;  3RZ7 A;  1CNK A;  1G4J A;  1TG3 A;  3MHL A;  5JDV B;  4K13 A;  5EHE A;  2VVA X;  3ZNC A;  3T5U A;  4RIU A;  3DD0 A;  4XIW A;  1KOP A;  1OKL A;  3M14 A;  1UGD A;  1TH9 A;  3MNK A;  3N3J A;  5E5U A;  2NXT A;  2ILI A;  4CA2 A;  1V9E A;  4WR7 A;  1A42 A;  1CNJ A;  1CNB A;  5FNL A;  4WW8 A;  5DRS A;  5FL6 A;  2HD6 A;  3DD8 A;  3QYK A;  1AM6 A;  3HFP A;  3MHM A;  4KP5 A;  3W6H A;  5CJF A;  4KAP A;  4YYT A;  4RN4 A;  3Q31 A;  3S71 B;  1RAY A;  3S75 B;  1BNU A;  4COQ A;  3DBU A;  3T84 A;  5CA2 A;  1CNX A;  1TB0 X;  2EU2 A;  2FOV A;  5DSN A;  3V3J A;  2CBE A;  3P4V A;  3PYK A;  4Q7V A;  3IBU A;  4MO8 A;  1I9L A;  1HEC A;  1XEG A;  3JXF A;  2F14 A;  3N0N A;  5EH5 A;  5G0C A;  5DVX A;  2OSM A;  5DOH A;  3DA2 A;  2Q38 A;  5FNI A;  4Q78 A;  4ZWX A;  1UGG A;  1HED A;  3DV7 A;  3V5G A;  4GL1 X;  4JSW A;  4QY3 A;  5FLO A;  1CVC A;  4G7A A;  3T83 A;  4LU3 A;  1ZE8 A;  4MLX A;  2Q1Q A;  4M2V A;  1BZM A;  3KOI A;  1YDB A;  3MNI A;  1XQ0 A;  2HFW A;  3DC9 A;  3MNA A;  4RFD A;  1CA3 A;  5BNL A;  4ZWI A;  1BV3 A;  2FNM A;  3F7U A;  3RYY A;  1LG5 A;  1OKM A;  4R5A A;  2AW1 A;  5FNG A;  5DSM A;  2NWO A;  1CAK A;  3P5A A;  1KOQ A;  4CNV A;  1DMY A;  3M1J A;  4Q0L A;  4YXI A;  1CNG A;  1I91 A;  2FOS A;  5DSK A;  5E28 A;  4Y0J A;  3N4B A;  3MZC A;  1MUA A;  3CA2 A;  4XFW A;  1I9O A;  4K0S A;  2Q1B A;  2NXR A; 
#chains in the Genus database with same CATH topology
 1G52 A;  2OSF A;  5EHV A;  4YXU A;  5EHW A;  3M1W A;  3U47 A;  4FPT A;  5E2K A;  2NWP A;  4YGK A;  1I90 A;  4QK2 A;  4Q90 A;  5DSR A;  1BNQ A;  5FLP A;  3F7B A;  1BCD A;  1ZSB A;  1HEA A;  3V2J A;  2NNG A;  5DSQ A;  3HKU A;  3SBH A;  4PXX A;  5J8Z A;  4DZ7 A;  3RZ0 B;  3B4F A;  1I9Q A;  2WEO A;  3MYQ A;  3KNE A;  1RAZ A;  3RYJ B;  1CCS A;  3OYQ A;  1LUG A;  4HBA A;  3IGP A;  2NNO A;  3N2P A;  1CVH A;  4Z1N A;  1URT A;  3DVB A;  1FQR A;  4JSZ A;  2FMG A;  1RZB A;  4KUY A;  8CA2 A;  5SZ5 A;  2WEJ A;  3P3J A;  2AX2 A;  4Q6D A;  3MHI A;  4CNX A;  1ZH9 A;  1F2W A;  4Q08 A;  1BN1 A;  2HNC A;  3IEO A;  4RFC A;  4MTY A;  4DZ9 A;  3SAP A;  1CAM A;  3RYZ A;  3HKQ A;  4Z1K A;  1JD0 A;  4R5B A;  1FQL A;  1CAN A;  3OIK A;  3VBD A;  4MDL A;  3M2Z A;  4Z0Q A;  4Q07 A;  4WL4 A;  5FNH A;  1CA2 A;  3CAJ A;  1Z9Y A;  4XZ5 A;  4BF6 A;  3DCW A;  2VVB X;  4PYX A;  3NB5 A;  4Q7P A;  3K34 A;  1V9I C;  4RIV A;  5E2N A;  5CAC A;  3M2N A;  2FW4 A;  3F8E A;  2NMX A;  4Q81 A;  2WD2 A;  1KEQ A;  3U7C A;  1UGE A;  1TTM A;  5FLS A;  2NN7 A;  5FLT A;  4BCW A;  2HL4 A;  4KUV A;  1FQN A;  5DSO A;  1TEQ X;  5EKJ A;  1IF5 A;  3SAX A;  4E3H A;  3M98 A;  3KKX A;  5IPZ A;  5G01 A;  5JEH B;  3CZV A;  1DCB A;  3MNJ A;  5DSJ A;  3R16 A;  3DC3 A;  1G0F A;  2NWZ A;  4LP6 A;  1IF7 A;  5FNK A;  5L3O A;  1T9N A;  4QJP A;  3V3G B;  1RZE A;  1CNY A;  4JSA A;  1YDC A;  2CBC A;  2ABE A;  3JXH C;  3V3H B;  2CBD A;  2FMZ A;  4ZAO A;  4FVO A;  4E4A A;  4KNJ A;  1IF4 A;  4KUW A;  5FDI A;  5EKM A;  3RZ8 A;  3SBI A;  3HKN A;  4HEZ A;  1I8Z A;  2POV A;  4HT2 A;  3KON A;  2CA2 A;  3DCC A;  2FNK A;  3KS3 A;  2X7T A;  1DCA A;  3V2M A;  7CA2 A;  1IF9 A;  3M04 A;  3MDZ A;  4Q8Y A;  4WUQ A;  5L6K A;  4TWL A;  3EFI A;  5E2S A;  1G6V A;  3M3X A;  4HEY A;  4KP8 A;  1CRA A;  1ZSC A;  4QIY A;  3S76 A;  1CAH A;  1CZM A;  2POW A;  3S78 B;  1G0E A;  4ZX0 A;  4TWM A;  1I9P A;  5A25 A;  4PYY A;  1ZSA A;  4YGN A;  4YGL A;  4E49 A;  2ZNC A;  3B1B A;  1G45 A;  3MMF A;  4HF3 A;  4Q6E A;  3D9Z A;  4UOV A;  4Q8X A;  4QJO A;  4QJM A;  4ZWY A;  2NN1 A;  2HKK A;  3M2X A;  3NI5 A;  3ZP9 A;  1TG9 A;  1CAZ A;  5FDC A;  4M2W A;  4MLT A;  3DVD A;  1CCU A;  4Q83 A;  5FLR A;  1LG6 A;  3FW3 A;  1KWQ A;  4CAC A;  4YXO A;  1HUH A;  4G0C A;  4JSS A;  5E5R A;  3V3I B;  1UGF A;  1MOO A;  1YDD A;  2WEG A;  2CBA A;  1ZFK A;  1CVD A;  2QOA A;  1TE3 X;  3RG4 A;  4ETQ C;  3U45 X;  1BNV A;  4HU1 A;  4QK3 A;  4ZX1 A;  1CNH A;  5JEG B;  3BL1 A;  1BNW A;  5EOI A;  2H15 A;  1AZM A;  5E2R A;  4Z1J A;  5EH8 A;  5JQT A;  2CAB A;  2IT4 A;  1Y7W A;  3KIG A;  1FQM A;  3KWA A;  1G46 A;  4Q7W A;  5SZ4 A;  4KNM A;  3OIM A;  1YO2 A;  3L14 A;  4X5S A;  4YVY A;  4L5V A;  3LXE A;  9CA2 A;  1BIC A;  1UGA A;  4QTL A;  1CVF A;  3HS4 A;  3RZ5 A;  3MWO A;  2POU A;  5JQ0 A;  1Z93 A;  4K0Z A;  1CIL A;  2FOY A;  4RUY A;  1H9N A;  4YWP A;  3M5S A;  1RJ6 A;  3GZ0 A;  3D92 A;  3ML5 A;  4Q87 A;  1HUG A;  1OQ5 A;  3MHC A;  5SZ2 A;  4N0X B;  3OYS A;  1ZFQ A;  1J9W A;  2EU3 A;  2NXS A;  4FIK A;  4KV0 A;  3M5E A;  4Q06 A;  5CLU A;  1I9M A;  3BL0 A;  5EIJ A;  2NNS A;  4FU5 A;  5SZ0 A;  3FFP X;  2GD8 A;  3V3F A;  3PO6 A;  3TMJ A;  1CIN A;  4LHI A;  3RJ7 A;  1CNI A;  4Z1E A;  4FL7 A;  1HCB A;  4QIZ A;  3JXG A;  1LZV A;  1KWR A;  4KNN A;  3P58 A;  1FSQ A;  1ZGE A;  3ML2 A;  1HEB A;  1I9N A;  4FVN A;  1JV0 A;  5AMD A;  3M96 A;  4PZH A;  4KNI A;  3UYQ A;  3W6I A;  1CVE A;  3MNH A;  5DSP A;  3M1Q A;  1YO1 A;  1XPZ A;  3M1K A;  3M2Y A;  1FR7 A;  1YO0 A;  3NJ9 A;  2EZ7 A;  5SZ3 A;  3K2F A;  1CVB A;  4XE1 A;  2NWY A;  1G48 A;  1H4N A;  3R17 B;  4L5U A;  4WW6 A;  1H9Q A;  3S9T A;  5FNJ A;  5DOG A;  3TVO X;  4CQ0 A;  1G53 A;  3S8X A;  3M40 A;  4CNW A;  4Q99 A;  4N16 A;  5EKH A;  3RGE A;  3S97 A;  1CNC A;  5HPJ A;  1FSR A;  1OKN A;  1RZD A;  3T85 A;  1IF8 A;  3P3H A;  2FOU A;  3RYV B;  1UGB A;  4ZWZ A;  4M2U A;  4K1Q A;  1CAY A;  5SZ6 A;  1BN3 A;  3PJJ A;  4Q9Y A;  1CAI A;  4C3T A;  1CAO A;  1RJ5 A;  1UGC A;  4QSB A;  1THK A;  3S74 B;  4E9O X;  3P55 A;  1FLJ A;  1FR4 A;  5JG3 B;  3RZ1 B;  3S77 B;  4E3D A;  1CAJ A;  3K7K A;  2X7U A;  3DVC A;  1XEV A;  4QEF A;  3OKV A;  5FLQ A;  3IAI A;  1G54 A;  4JS6 A;  6CA2 A;  5E2M A;  1IF6 A;  2GEH A;  3IBL A;  5BRU A;  3CYU A;  4RH2 A;  4MDG A;  3MHO A;  1G4O A;  5SZ1 A;  4Q7S A;  4IDR X;  3OIL A;  3HKT A;  1CVA A;  2HOC A;  4BF1 A;  1JCZ A;  4IWZ A;  5G0B A;  5JGT B;  4M2R A;  4YX4 A;  4QSJ A;  3D8W A;  4MDM A;  5A6H A;  4WUP A;  3P44 A;  5FL5 A;  1AVN A;  4QJ0 A;  3M5T A;  1RZC A;  3F4X A;  3D93 A;  1CRM A;  3EFT A;  4Q49 A;  5EZT X;  5BRV A;  1DMX A;  3OKU A;  5BYI A;  1RZA A;  4YGF A;  3HLJ A;  4YHA A;  4HEW A;  3S73 B;  4QJX A;  3DCS A;  1CAL A;  1LGD A;  3RG3 A;  2FOQ A;  4ITP A;  1BNT A;  5DSI A;  4Q8Z A;  2NNV A;  1G1D A;  3RYX B;  4RUZ A;  4Q09 A;  5JEP B;  1EOU A;  2H4N A;  3FE4 A;  5FNM A;  1HCA A;  4RUX A;  3M67 A;  4K0T A;  4PQ7 A;  1BNN A;  1ZGF A;  2QO8 A;  3IBN A;  4QK1 A;  3IBI A;  3BET A;  1Z97 A;  4ILX A;  2WEH A;  3S72 B;  4E3F A;  1BN4 A;  1BNM A;  5AMG A;  5C8I A;  1TBT X;  5SZ7 A;  5JG5 B;  5LMD A;  4E3G A;  5EH7 A;  3KLD B;  4YGJ A;  3OY0 A;  1G3Z A;  4QSA A;  5BRW A;  3U3A X;  3P5L A;  5G03 A;  1YDA A;  5FL4 A;  3TVN X;  1ZNC A;  1TEU X;  2O4Z A;  3MNU A;  3T5Z A;  4QJW A;  5DSL A;  4CNR A;  3KOK A;  4ITO A;  4E5Q A;  1HVA A;  1CIM A;  2QP6 A;  2X7S A;  4FRC A;  3C7P A;  4R59 A;  3RLD A;  1CNW A;  5AML A;  3D0N A;  5JGS B;  2FNN A;  3V7X A;  4QSI A;  2W2J A;  3DAZ A;  5JES B;  4HT0 A;  12CA A;  1CCT A;  3T82 A;  3UYN A;  2CBB A;  1FSN A;  4XIX A;  4L5W A;  2WD3 A;  3RZ7 A;  1CNK A;  1G4J A;  1TG3 A;  3MHL A;  5JDV B;  4K13 A;  5EHE A;  2VVA X;  3ZNC A;  3T5U A;  4RIU A;  3DD0 A;  4XIW A;  1KOP A;  1OKL A;  3M14 A;  1UGD A;  1TH9 A;  3MNK A;  3N3J A;  5E5U A;  2NXT A;  2ILI A;  4CA2 A;  1V9E A;  4WR7 A;  1A42 A;  1CNJ A;  1CNB A;  5FNL A;  4WW8 A;  5DRS A;  5FL6 A;  2HD6 A;  3DD8 A;  3QYK A;  1AM6 A;  3HFP A;  3MHM A;  4KP5 A;  3W6H A;  5CJF A;  4KAP A;  4YYT A;  4RN4 A;  3Q31 A;  3S71 B;  1RAY A;  3S75 B;  1BNU A;  4COQ A;  3DBU A;  3T84 A;  5CA2 A;  1CNX A;  1TB0 X;  2EU2 A;  2FOV A;  5DSN A;  3V3J A;  2CBE A;  3P4V A;  3PYK A;  4Q7V A;  3IBU A;  4MO8 A;  1I9L A;  1HEC A;  1XEG A;  3JXF A;  2F14 A;  3N0N A;  5EH5 A;  5G0C A;  5DVX A;  2OSM A;  5DOH A;  3DA2 A;  2Q38 A;  5FNI A;  4Q78 A;  4ZWX A;  1UGG A;  1HED A;  3DV7 A;  3V5G A;  4GL1 X;  4JSW A;  4QY3 A;  5FLO A;  1CVC A;  4G7A A;  3T83 A;  4LU3 A;  1ZE8 A;  4MLX A;  2Q1Q A;  4M2V A;  1BZM A;  3KOI A;  1YDB A;  3MNI A;  1XQ0 A;  2HFW A;  3DC9 A;  3MNA A;  4RFD A;  1CA3 A;  5BNL A;  4ZWI A;  1BV3 A;  2FNM A;  3F7U A;  3RYY A;  1LG5 A;  1OKM A;  4R5A A;  2AW1 A;  5FNG A;  5DSM A;  2NWO A;  1CAK A;  3P5A A;  1KOQ A;  4CNV A;  1DMY A;  3M1J A;  4Q0L A;  4YXI A;  1CNG A;  1I91 A;  2FOS A;  5DSK A;  5E28 A;  4Y0J A;  3N4B A;  3MZC A;  1MUA A;  3CA2 A;  4XFW A;  1I9O A;  4K0S A;  2Q1B A;  2NXR A; 
#chains in the Genus database with same CATH homology
 1G52 A;  2OSF A;  5EHV A;  4YXU A;  5EHW A;  3M1W A;  3U47 A;  4FPT A;  5E2K A;  2NWP A;  4YGK A;  1I90 A;  4QK2 A;  4Q90 A;  5DSR A;  1BNQ A;  5FLP A;  3F7B A;  1BCD A;  1ZSB A;  1HEA A;  3V2J A;  2NNG A;  5DSQ A;  3HKU A;  3SBH A;  4PXX A;  5J8Z A;  4DZ7 A;  3RZ0 B;  3B4F A;  1I9Q A;  2WEO A;  3MYQ A;  3KNE A;  1RAZ A;  3RYJ B;  1CCS A;  3OYQ A;  1LUG A;  4HBA A;  3IGP A;  2NNO A;  3N2P A;  1CVH A;  4Z1N A;  1URT A;  3DVB A;  1FQR A;  4JSZ A;  2FMG A;  1RZB A;  4KUY A;  8CA2 A;  5SZ5 A;  2WEJ A;  3P3J A;  2AX2 A;  4Q6D A;  3MHI A;  4CNX A;  1ZH9 A;  1F2W A;  4Q08 A;  1BN1 A;  2HNC A;  3IEO A;  4RFC A;  4MTY A;  4DZ9 A;  3SAP A;  1CAM A;  3RYZ A;  3HKQ A;  4Z1K A;  1JD0 A;  4R5B A;  1FQL A;  1CAN A;  3OIK A;  3VBD A;  4MDL A;  3M2Z A;  4Z0Q A;  4Q07 A;  4WL4 A;  5FNH A;  1CA2 A;  3CAJ A;  1Z9Y A;  4XZ5 A;  4BF6 A;  3DCW A;  2VVB X;  4PYX A;  3NB5 A;  4Q7P A;  3K34 A;  1V9I C;  4RIV A;  5E2N A;  5CAC A;  3M2N A;  2FW4 A;  3F8E A;  2NMX A;  4Q81 A;  2WD2 A;  1KEQ A;  3U7C A;  1UGE A;  1TTM A;  5FLS A;  2NN7 A;  5FLT A;  4BCW A;  2HL4 A;  4KUV A;  1FQN A;  5DSO A;  1TEQ X;  5EKJ A;  1IF5 A;  3SAX A;  4E3H A;  3M98 A;  3KKX A;  5IPZ A;  5G01 A;  5JEH B;  3CZV A;  1DCB A;  3MNJ A;  5DSJ A;  3R16 A;  3DC3 A;  1G0F A;  2NWZ A;  4LP6 A;  1IF7 A;  5FNK A;  5L3O A;  1T9N A;  4QJP A;  3V3G B;  1RZE A;  1CNY A;  4JSA A;  1YDC A;  2CBC A;  2ABE A;  3JXH C;  3V3H B;  2CBD A;  2FMZ A;  4ZAO A;  4FVO A;  4E4A A;  4KNJ A;  1IF4 A;  4KUW A;  5FDI A;  5EKM A;  3RZ8 A;  3SBI A;  3HKN A;  4HEZ A;  1I8Z A;  2POV A;  4HT2 A;  3KON A;  2CA2 A;  3DCC A;  2FNK A;  3KS3 A;  2X7T A;  1DCA A;  3V2M A;  7CA2 A;  1IF9 A;  3M04 A;  3MDZ A;  4Q8Y A;  4WUQ A;  5L6K A;  4TWL A;  3EFI A;  5E2S A;  1G6V A;  3M3X A;  4HEY A;  4KP8 A;  1CRA A;  1ZSC A;  4QIY A;  3S76 A;  1CAH A;  1CZM A;  2POW A;  3S78 B;  1G0E A;  4ZX0 A;  4TWM A;  1I9P A;  5A25 A;  4PYY A;  1ZSA A;  4YGN A;  4YGL A;  4E49 A;  2ZNC A;  3B1B A;  1G45 A;  3MMF A;  4HF3 A;  4Q6E A;  3D9Z A;  4UOV A;  4Q8X A;  4QJO A;  4QJM A;  4ZWY A;  2NN1 A;  2HKK A;  3M2X A;  3NI5 A;  3ZP9 A;  1TG9 A;  1CAZ A;  5FDC A;  4M2W A;  4MLT A;  3DVD A;  1CCU A;  4Q83 A;  5FLR A;  1LG6 A;  3FW3 A;  1KWQ A;  4CAC A;  4YXO A;  1HUH A;  4G0C A;  4JSS A;  5E5R A;  3V3I B;  1UGF A;  1MOO A;  1YDD A;  2WEG A;  2CBA A;  1ZFK A;  1CVD A;  2QOA A;  1TE3 X;  3RG4 A;  4ETQ C;  3U45 X;  1BNV A;  4HU1 A;  4QK3 A;  4ZX1 A;  1CNH A;  5JEG B;  3BL1 A;  1BNW A;  5EOI A;  2H15 A;  1AZM A;  5E2R A;  4Z1J A;  5EH8 A;  5JQT A;  2CAB A;  2IT4 A;  1Y7W A;  3KIG A;  1FQM A;  3KWA A;  1G46 A;  4Q7W A;  5SZ4 A;  4KNM A;  3OIM A;  1YO2 A;  3L14 A;  4X5S A;  4YVY A;  4L5V A;  3LXE A;  9CA2 A;  1BIC A;  1UGA A;  4QTL A;  1CVF A;  3HS4 A;  3RZ5 A;  3MWO A;  2POU A;  5JQ0 A;  1Z93 A;  4K0Z A;  1CIL A;  2FOY A;  4RUY A;  1H9N A;  4YWP A;  3M5S A;  1RJ6 A;  3GZ0 A;  3D92 A;  3ML5 A;  4Q87 A;  1HUG A;  1OQ5 A;  3MHC A;  5SZ2 A;  4N0X B;  3OYS A;  1ZFQ A;  1J9W A;  2EU3 A;  2NXS A;  4FIK A;  4KV0 A;  3M5E A;  4Q06 A;  5CLU A;  1I9M A;  3BL0 A;  5EIJ A;  2NNS A;  4FU5 A;  5SZ0 A;  3FFP X;  2GD8 A;  3V3F A;  3PO6 A;  3TMJ A;  1CIN A;  4LHI A;  3RJ7 A;  1CNI A;  4Z1E A;  4FL7 A;  1HCB A;  4QIZ A;  3JXG A;  1LZV A;  1KWR A;  4KNN A;  3P58 A;  1FSQ A;  1ZGE A;  3ML2 A;  1HEB A;  1I9N A;  4FVN A;  1JV0 A;  5AMD A;  3M96 A;  4PZH A;  4KNI A;  3UYQ A;  3W6I A;  1CVE A;  3MNH A;  5DSP A;  3M1Q A;  1YO1 A;  1XPZ A;  3M1K A;  3M2Y A;  1FR7 A;  1YO0 A;  3NJ9 A;  2EZ7 A;  5SZ3 A;  3K2F A;  1CVB A;  4XE1 A;  2NWY A;  1G48 A;  1H4N A;  3R17 B;  4L5U A;  4WW6 A;  1H9Q A;  3S9T A;  5FNJ A;  5DOG A;  3TVO X;  4CQ0 A;  1G53 A;  3S8X A;  3M40 A;  4CNW A;  4Q99 A;  4N16 A;  5EKH A;  3RGE A;  3S97 A;  1CNC A;  5HPJ A;  1FSR A;  1OKN A;  1RZD A;  3T85 A;  1IF8 A;  3P3H A;  2FOU A;  3RYV B;  1UGB A;  4ZWZ A;  4M2U A;  4K1Q A;  1CAY A;  5SZ6 A;  1BN3 A;  3PJJ A;  4Q9Y A;  1CAI A;  4C3T A;  1CAO A;  1RJ5 A;  1UGC A;  4QSB A;  1THK A;  3S74 B;  4E9O X;  3P55 A;  1FLJ A;  1FR4 A;  5JG3 B;  3RZ1 B;  3S77 B;  4E3D A;  1CAJ A;  3K7K A;  2X7U A;  3DVC A;  1XEV A;  4QEF A;  3OKV A;  5FLQ A;  3IAI A;  1G54 A;  4JS6 A;  6CA2 A;  5E2M A;  1IF6 A;  2GEH A;  3IBL A;  5BRU A;  3CYU A;  4RH2 A;  4MDG A;  3MHO A;  1G4O A;  5SZ1 A;  4Q7S A;  4IDR X;  3OIL A;  3HKT A;  1CVA A;  2HOC A;  4BF1 A;  1JCZ A;  4IWZ A;  5G0B A;  5JGT B;  4M2R A;  4YX4 A;  4QSJ A;  3D8W A;  4MDM A;  5A6H A;  4WUP A;  3P44 A;  5FL5 A;  1AVN A;  4QJ0 A;  3M5T A;  1RZC A;  3F4X A;  3D93 A;  1CRM A;  3EFT A;  4Q49 A;  5EZT X;  5BRV A;  1DMX A;  3OKU A;  5BYI A;  1RZA A;  4YGF A;  3HLJ A;  4YHA A;  4HEW A;  3S73 B;  4QJX A;  3DCS A;  1CAL A;  1LGD A;  3RG3 A;  2FOQ A;  4ITP A;  1BNT A;  5DSI A;  4Q8Z A;  2NNV A;  1G1D A;  3RYX B;  4RUZ A;  4Q09 A;  5JEP B;  1EOU A;  2H4N A;  3FE4 A;  5FNM A;  1HCA A;  4RUX A;  3M67 A;  4K0T A;  4PQ7 A;  1BNN A;  1ZGF A;  2QO8 A;  3IBN A;  4QK1 A;  3IBI A;  3BET A;  1Z97 A;  4ILX A;  2WEH A;  3S72 B;  4E3F A;  1BN4 A;  1BNM A;  5AMG A;  5C8I A;  1TBT X;  5SZ7 A;  5JG5 B;  5LMD A;  4E3G A;  5EH7 A;  3KLD B;  4YGJ A;  3OY0 A;  1G3Z A;  4QSA A;  5BRW A;  3U3A X;  3P5L A;  5G03 A;  1YDA A;  5FL4 A;  3TVN X;  1ZNC A;  1TEU X;  2O4Z A;  3MNU A;  3T5Z A;  4QJW A;  5DSL A;  4CNR A;  3KOK A;  4ITO A;  4E5Q A;  1HVA A;  1CIM A;  2QP6 A;  2X7S A;  4FRC A;  3C7P A;  4R59 A;  3RLD A;  1CNW A;  5AML A;  3D0N A;  5JGS B;  2FNN A;  3V7X A;  4QSI A;  2W2J A;  3DAZ A;  5JES B;  4HT0 A;  12CA A;  1CCT A;  3T82 A;  3UYN A;  2CBB A;  1FSN A;  4XIX A;  4L5W A;  2WD3 A;  3RZ7 A;  1CNK A;  1G4J A;  1TG3 A;  3MHL A;  5JDV B;  4K13 A;  5EHE A;  2VVA X;  3ZNC A;  3T5U A;  4RIU A;  3DD0 A;  4XIW A;  1KOP A;  1OKL A;  3M14 A;  1UGD A;  1TH9 A;  3MNK A;  3N3J A;  5E5U A;  2NXT A;  2ILI A;  4CA2 A;  1V9E A;  4WR7 A;  1A42 A;  1CNJ A;  1CNB A;  5FNL A;  4WW8 A;  5DRS A;  5FL6 A;  2HD6 A;  3DD8 A;  3QYK A;  1AM6 A;  3HFP A;  3MHM A;  4KP5 A;  3W6H A;  5CJF A;  4KAP A;  4YYT A;  4RN4 A;  3Q31 A;  3S71 B;  1RAY A;  3S75 B;  1BNU A;  4COQ A;  3DBU A;  3T84 A;  5CA2 A;  1CNX A;  1TB0 X;  2EU2 A;  2FOV A;  5DSN A;  3V3J A;  2CBE A;  3P4V A;  3PYK A;  4Q7V A;  3IBU A;  4MO8 A;  1I9L A;  1HEC A;  1XEG A;  3JXF A;  2F14 A;  3N0N A;  5EH5 A;  5G0C A;  5DVX A;  2OSM A;  5DOH A;  3DA2 A;  2Q38 A;  5FNI A;  4Q78 A;  4ZWX A;  1UGG A;  1HED A;  3DV7 A;  3V5G A;  4GL1 X;  4JSW A;  4QY3 A;  5FLO A;  1CVC A;  4G7A A;  3T83 A;  4LU3 A;  1ZE8 A;  4MLX A;  2Q1Q A;  4M2V A;  1BZM A;  3KOI A;  1YDB A;  3MNI A;  1XQ0 A;  2HFW A;  3DC9 A;  3MNA A;  4RFD A;  1CA3 A;  5BNL A;  4ZWI A;  1BV3 A;  2FNM A;  3F7U A;  3RYY A;  1LG5 A;  1OKM A;  4R5A A;  2AW1 A;  5FNG A;  5DSM A;  2NWO A;  1CAK A;  3P5A A;  1KOQ A;  4CNV A;  1DMY A;  3M1J A;  4Q0L A;  4YXI A;  1CNG A;  1I91 A;  2FOS A;  5DSK A;  5E28 A;  4Y0J A;  3N4B A;  3MZC A;  1MUA A;  3CA2 A;  4XFW A;  1I9O A;  4K0S A;  2Q1B A;  2NXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...