1ZZZA

Trypsin inhibitors with rigid tripeptidyl aldehydes
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Highly selective mechanism-based thrombin inhibitors: structures of thrombin and trypsin inhibited with rigid peptidyl aldehydes.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zzzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zzzA02
2BD8A 1IQFA 3MH7A 3SQEE 4YT6H 2ZPRA 1TIOA 1Z6EA 1DWCH 5EODA 1AKSA 2QV1A 1LQDB 2PKSB 2ZFRH 3RU4D 2BY9X 1GCDA 1GI9B 3A85A 3MO9A 5EPNA 2AYWA 2GVFA 1V2JT 1UVOA 9ESTA 1XXFA 3BTTE 5K7RA 3SQHE 2BD9A 2XBWA 1HNEE 3QN7A 4ASHA 2FOBA 1H8DH 4Q80A 2G4UA 1S0RA 1MBMA 1O3DA 3TH2H 3TK9A 1HAHH 1EKBB 1O3FA 1H9IE 5FXLA 4KP0A 2B0FA 4Y79A 2FODA 4IS5A 5I25A 3I77A 1V2VT 1TQ0B 5BPEA 5JBCS 1GMHG 1SGFA 1ANBA 1GJAB 3RMLH 4NIYA 1C1TA 1O2JA 3HGPA 1RXPA 3SJOA 3VFEA 1AVWA 3SU5A 1T4VH 1OYQA 1D6WA 2UUFB 1HPGA 3SZNA 1VITF 2GV6A 1SQAA 2Z94A 1PQ8A 2H5CA 4DJZB 1D9IA 1TNGA 1SGNE 3VB4A 1SFQB 3RXHA 2HOBA 1QBNA 2XRCA 3U1JB 2ZG0H 1SGCA 2Z3DA 3BTHE 1XX9A 1KSNA 1GHXH 4RSPA 1GVLA 3A80A 5JDUB 1G36A 4WJG2 1Y5BT 2SNWA 1DWBH 2CMYA 3B8JA 6CHAC 4OS6A 3G01A 4TPIZ 5LH8A 1C5XB 2BOHB 1BDAA 1LKAA 5EG4A 1DXPA 2J4IA 4B2CA 1O3EA 3FZDA 1O2OA 1MD8A 1CT4E 2FS9A 1VCPA 3PWCA 1GI5A 2H9EH 3MNXA 1W10U 2ZU1A 3M5NA 1OWEA 1TB6H 2Z9LA 1O34A 1IQGA 1A5IA 4E7RG 1GI4A 2Y5FA 1DSTA 5EQRA 1MCTA 2BDHA 2F9VA 2FXRA 1G2MA 1E38B 3AAVA 1THRH 2WPIS 2Z3CA 5GDSH 2GT8A 3SHCH 3ATKA 4AOQA 1CHOF 1OS8A 5PTPA 1NTPA 4AFUA 1GGDC 4H4FA 1HIAB 3SUFA 1Z6JH 4GAWA 1HAIH 1O5CB 2ZA5A 1GBDA 2YNAA 2OXSA 2AMQA 3C1KA 1AY6H 1LCYA 1SGRE 4Q7YA 2VWOA 3NPSA 1XKAC 4R0IA 3IG6B 1BOQA 1A4WH 3SI4H 1P2IA 1LPKB 1SC8U 2WV4A 3FP6E 1MTWA 3SGAE 5C2ZA 4TYDA 1PFXC 1E36B 4Y7AA 4YESB 2BVRH 2ZPQA 1O3CA 4DIIH 3T62A 1KIGH 1UVUH 1ETSH 1QQ4A 2FOAA 4CREA 4X1PU 1AE8H 1EAUA 4B2AA 2BHGA 2Z9KA 4HZHA 3A7YA 6GCHF 1FUJA 1XUIA 1KXAA 1C2IA 4TWWA 3STIA 2BVSH 2AMDA 4ZAEA 3MNSA 3LJOA 4DCDA 1WQVH 2ZECA 3T5FH 3KQCA 2TGTA 1FXYA 1J14A 2BY5X 3F1SB 5K0HA 1O2MA 3L3TA 4AFQA 2P3UB 1PPBH 1TOMH 1UK2A 2WPLS 4YTAA 3BEUA 8GCHF 1LVOA 1UTPA 3AASA 4CR9A 4CRDA 2CF8H 1ZMLA 2BOKA 1YPLH 1K22H 3RC6A 4LOYH 2H9HA 1LPGB 1BTYA 3QGJA 1WSSH 3URCA 4INLA 2AMPA 4GSOA 2ZKSA 1FY5A 3RXMA 3SUDA 2F91A 1QGFA 4UONA 3UR6A 1DWDH 1EAIA 2QY0B 2P3TB 3S7HB 1TOCB 4BAOB 3RXDA 4KTUA 3SGBE 1FPHH 1YCPH 3TPIZ 5IYTA 1O32A 1YCPK 2RDLA 2F9OA 4AB9A 4I8JA 1AVGH 1DPOA 2RA0A 4WH6A 4X6OA 2ZDLA 3TLOA 3SUGA 4Y71A 3LGIA 1O3LA 2BY6X 1FAKH 1UTOA 2PKAB 1UVTH 2J92A 2H2ZA 1GBJA 1BA8B 2BD7A 2P95A 3N7OA 4TWYA 4U32A 2ZGJA 2V35A 1BTPA 1G9IE 1GHYH 3I29A 1HAVA 3LC3A 1ELBA 3RXTA 4B1TA 4ABIA 1GJ8B 3MU8A 1ESAA 5FAHA 3ZYDA 1JOUB 1GG6B 1V6DA 2A5IA 1LHFH 3BTDE 3A8BA 1THPB 1PPZA 1G32B 3S69A 4YOJA 3E1XB 1PYTD 1IQNA 1H8IH 2XCNA 2GZ7A 3B23B 5CMXH 1P9UA 1SFIA 2QIQA 5DP5A 1GBLA 3QDZB 5GIBA 3KQBA 3MOCA 1KLIH 2SGEE 3EAJA 5JB8S 2QC2A 1V2NT 5HM9A 2JH6D 1C5WB 1VJAU 3SOSA 4X1RU 4UD9H 2Z6BD 1AIXH 3UUZA 5L6NH 1C5PA 1OWKA 1Z8RA 3TVJB 3GDVA 5FCKA 3S0NA 2F9PA 5CHAC 4XBDA 1ZZZA 4XFQA 4D7GA 4IN2A 4K2YA 2JETC 2WPJS 2ZTXA 1O3AA 2TGDA 3UNRA 1C5QA 2ZCHP 4AFZA 1O38A 2UUJB 2GKVE 1Z71A 1WQSA 1MTNC 2CN0H 2A1DB 4ZROA 1YC0A 3ATMA 2Y6TA 1GJ6A 3ZVBA 1O3MA 4IC5A 5EU8A 5GCHG 4UFDH 4LZ4B 1P06A 1N8OC 3A82A 1PQ5A 3BTFE 1S84A 1TYNA 4AGKA 1XUJA 3SV2H 2PWXA 1NFYA 3MH5A 1BMMH 1IQKA 4ZMAH 1ZJDA 1WTHD 3NCLA 1PPEE 2TGAA 1YLDA 4KGAA 1RTKA 1BJUA 2WUBA 3RDZA 2A2QH 1GDNA 3NKKA 1ORFA 1EZSC 5GJ4B 1ZGVA 5FCRA 1CGHA 1FV9A 3GDSA 5A8YA 1YBWA 1TBQH 2BTCE 1TPOA 2DE9A 1P0SH 2GV7A 3E3TA 3TJVA 1AB9B 1AD8H 1AZ8A 3E6PH 4K8BA 2R3UA 2H5DA 1C2DA 1F5LA 3TGKE 4GCHF 1UO6A 1FLEE 4A5TS 1C4U2 3LDXH 2ZU2A 3M7QA 1GBBA 4I31A 3E91A 3MYWA 3M3VA 4JZDH 4Q7XA 1DUAA 3OSYA 1EUFA 4DG4A 3ZZ6A 1A7SA 2PTCE 1TNKA 5J4SA 3VGCB 2CV3A 2ILNA 2QXHA 4NZQA 1GHWH 1C2KA 4ABBA 1NFWA 1FY1A 2ZU4A 3E8LA 2Y5GA 4NSYA 4Z0KA 4RKOB 3MO3A 3MWIU 2A5KA 1O3NA 4NFFA 3NK8A 2J9NA 1SOZA 3ZYEA 4H42U 1CBWB 5C67A 5E8EH 2C8YB 1DITH 2PLXA 1ZR0A 1YLCA 1BRCE 1P3CA 2ANMH 2G8TA 1YPJH 2ZHFH 4ESTE 1DY8A 1HAZB 2BZ6H 3ATWA 3UREA 4WMFA 5JBAS 1AKSB 1AVXA 2A32A 1PPGE 1SMFE 4X2VA 3U1IB 1DDJA 5FPTA 3GY2A 2Y7ZA 3V3MA 1DSUA 1TX8A 3A7XA 3MU0A 1OWJA 5L2ZH 4I32A 1ANEA 1VGCB 1GI6A 1RGQA 1O2UA 2PKAA 2A5AA 4MQAA 1EPTA 1O3JA 1C4V2 2VU8E 4A1VA 2XC4A 1O31A 1QJ1B 1UTLM 3QTVH 1P3EA 4K1TA 3A87A 1BITA 2OC1A 1MAYA 1A2CH 1QIXB 2PSYA 2GGVB 1AGJA 1ZGIA 2FS8A 1UTKA 1AUTC 2O8WA 1DE7H 1A5GH 3RM2H 4RN6A 3RC5A 1QY6A 3F68H 1O3GA 2BD2A 2PHBA 3UNSA 1EJMA 2LNCA 1DT2A 1F0SA 3KGPA 3M5MA 4E06H 1EASA 1G3DA 5L30H 1QRXA 1C1QA 2QN5T 2ODYB 3ZZBA 1ZTKA 1G30B 1EZUC 1C5VA 1L1GA 1O3IA 3SU1A 7KMEH 3QGNB 1CGIE 1GI0A 3V12A 4MVNA 2SGDE 3TH4H 1Y3XA 4X6NA 4KKDA 1HBTH 1SLXB 1GBCA 1ELEE 4HGCA 4ABGA 3SNBA 1A0JA 2OBOA 2B8OH 1EQ9A 4BXWA 1B0FA 1O35A 1TPAE 1MKWH 4Z6AH 1V2RT 4NIWA 1MKWK 1MTUA 4MPVA 2FOEA 2C90B 2RA3A 1AFQC 1CT2E 3LPRA 5A2MH 3HKIB 2ZO3H 3LH1A 4FUBA 5C1UA 2TPIZ 4OS1A 3FAOA 2FIRH 1HJ9A 1SPJA 2SGPE 3D49H 1VCWA 1K1OA 4YT7H 1WUNH 2ALVA 2VB0A 3QTOH 3P8NA 3V7TA 5E2PA 4AN7A 2A2XH 2GCHF 2F83A 4TY6A 1T8NA 1DANH 1NO9H 1HGTH 2QXGA 3SJ8A 1C5NH 3OY5U 3SI3H 2GMTC 1DOJA 4IGDA 2ZI2H 3MH4A 2XWBI 1TLDA 2VIPA 1NFXA 2BXTH 5FPYA 3EQ0H 1TA2A 1UMAH 1O2TA 2GDDA 3K65B 3VEQB 2BX3A 2ZDAH 1ZPBA 4BAKB 5DP8A 1OP0A 5I46H 3A89A 3QWCH 5TJXA 1A3BH 2AS9A 2GZ9A 2XW9A 1BRBE 3NXPA 3IWMA 2EI8A 3ODDA 4BAMB 5ESTE 4I33A 2BY7X 3KN2A 4NA9H 2WYJA 2D8WA 3FP7E 1NN6A 3GCHC 4JZIA 1QJ6B 1XVOA 3TIUA 1Y5AT 3SNEA 3PMHB 1GHAG 1QRZA 3DT0H 3K9XB 1AQ7A 1E34B 1ELAA 3F9GA 3KHVA 2YNBA 2WUCA 1YCPM 1S5SA 1KLTA 2AIQA 4Y8XA 1KXBA 4ZHMU 5F6MA 1O3KA 2CHAC 2GD4B 2QAAA 4AG2A 1DWEH 1O5FH 3Q3KA 2UWLA 3EGKH 3UY9A 1C2GA 2XTTB 4GVUA 1AZZA 2GCTB 1F7ZA 3HATH 2PFEA 5AHGH 4CBNA 6LPRA 2NWNA 4BXSA 3E0NB 1EX3A 2Y7XA 3SNCA 1O5GH 3ZVFA 1NC6A 1UJ1A 2R3YA 1W14U 2GZ8A 2ZQ1A 2VIDA 4THNH 1V2KT 1WYKA 2HALA 3P8FA 2ZFPH 1O5AB 1Q3XA 3ZZ5A 3QZQA 1NROH 3AW1A 2NU4E 4ISLA 1BUIA 1BTWA 1IHTH 2ZGBH 3PB1E 4BAHB 5EPYA 3KL6A 3VXEH 3RU4T 4YO9A 2P3FH 4YLUA 2W7UA 3TJUA 3UPEA 2GDEH 4GLYA 1GMHF 1JIMA 5T3HA 3VXFH 1IQLA 1T4UH 3BEIB 1BIOA 1P04A 1BBRE 4FU9A 4FUCA 4BANB 1CU1A 3TK6A 5A8ZA 3SJ9A 1QA7A 5HGGA 5DP6A 1EP6A 1RIWB 1HAVB 4GHQA 3PWBA 1UTJA 1NU7B 2O8LA 1Y8TA 2Z9JA 3RXSA 1P01A 1DLKB 2BQ6B 4MG3A 2R2MB 2FI5E 2ALPA 3SV9A 5JYIA 2OP9A 3LGVA 1GHBF 1DS2E 3P8OA 4LZ1H 1C1MA 1BBRH 2VGCB 1VITG 5EGMA 1BBRK 5J4QA 3GCNA 1O2XA 4A1TA 2EI6A 5F8ZA 3PTBA 2ZDNA 2ZDKA 3M7TA 1LKBA 4X1NU 8KME2 3GYMA 3ZVGA 1K1JA 2O8MA 1TALA 2FOCA 1GCTB 1EATA 4X8TH 2A31A 5C20A 2FO9A 4B74A 1HLTH 1XMNB 3QLPH 1HAOH 4FUDA 1T32A 3T28A 1O2VA 1L4ZA 1SGFG 1MKXH 1QL9A 2ZU5A 1YM0A 1MKXK 2FTLE 1Q31A 1UHBA 2KAIB 3AVZA 4YLQH 2STAE 1NFUA 4BTUB 2CXVA 5EW1H 3Q76A 1Z7KA 1HAPH 1TA6A 5FPSA 2P8OC 4KTCA 2PTNA 3A84A 1O2WA 4I8KA 1EOJA 1Y3VA 2BDGA 2XBYA 1O0DH 3NWUA 3MNBA 4A7IB 2OLGA 2AIPA 1QCPA 1K1PA 1BTUA 2A4OA 3HKJB 5TCAA 5F8XA 3RXLA 3RMMH 1MD7A 4SGAE 3LGUA 4Y8ZA 2WINI 5LPEA 1L1JA 1CHOG 5DP9A 3LOXA 3FFGA 1TRYA 1J8AA 1EAWA 1NS3A 2PUQH 1W7XH 4INHA 2RG3A 5FX6A 5H4IB 1RS0A 1FI8A 3SN8A 4FU8A 1NESE 5E2OA 1MZDA 5AF9H 1UVPA 1QRWA 4NIXA 1UTNA 4WH8A 2BZAA 2BDCA 4LXBH 1FONA 1AMHA 1INCA 1EAXA 2ZHDA 3BG4C 1ZSJA 4I8GA 1YPHE 3ATLA 1AE5A 1DM4B 3F9EA 2GT7A 3SGQE 3VB3A 3PTNA 3K6ZA 1ZYOA 1TGTA 3ZV9A 1PPHE 2ZFFH 4Y0ZE 1C2HA 1CA0B 1RJXB 2QXJA 2VIQA 1VJ9U 2C8ZB 1P8VC 3RLYH 4H6SB 5T6FA 1C5UA 7GCHF 1Z1IA 1C2EA 2ZPSA 2IN2A 1YF4A 5DPAA 8GCHG 1H9LB 3ZVDA 2ZDVH 4CHAC 2Y80A 4GHTA 1CVWH 1Y59T 3SJKA 5FBIA 1ELDE 1MBQA 4O3TA 1OWIA 3GOVB 1V2TT 4DVAU 4ZUHA 1ZRKA 1KYNA 1HXFH 2VWMA 1SG8B 4WMEA 1ZOMA 2THFB 4MPWA 2Z9GA 3DFJA 1GJ9B 5GXPA 5DO4H 3U8OH 1EPTB 1FJSA 1GI8B 1GMCG 2Y81A 3ZZ7A 2SGFE 3SU0A 2BYAX 8LPRA 1K1LA 2NU3E 3M36A 3LGTA 3U9AH 3QO6A 1O2SA 4JYUH 5L2YH 4A92A 4GUXA 1BCUH 3SHAH 1P2QA 1SB1H 2ZFQH 3A8AA 4ABHA 3JZ1B 4JK5A 4CRCA 3VPKA 1O5EH 3PLKA 3RXBA 3MHWU 1IQJA 1TBZH 4J1YA 1RFNA 3KEEA 4AYVB 2BMGB 1QFKH 1GHZA 2A4GA 2P94A 5E0JA 4B73A 2YOLA 5AFZH 4Q7ZA 2UUKB 1FZZA 1V2OT 4Y7BA 3EA7A 2VVUA 4WWYA 4A6LA 1CA8B 5JBBS 2FI3E 1KY9A 1TRMA 3Q3XA 2HRVA 2PKSC 2ZGXH 3T27A 2K1QA 1BTHH 1G3BA 1S85A 1XM1A 3URDA 1W0ZU 2D1JA 2QYIA 2KAIA 1A46H 3P8GA 1GPZA 1SHHB 2WV5A 1TBRH 3L33A 2J38A 1GVKB 3TJOA 4XBCA 2VWLA 1BHXF 1TX6A 2EA3A 3F9FA 3SV6A 3LC5A 2BVXH 2HPQH 2XC0A 1GBTA 1D6RA 1P2OA 3RMNH 5GCHF 1LO6A 1UK3A 1KXDA 1C2FA 2A45B 4X8UH 4JZFH 1GBKA 2JH0D 2VNTA 2G5NA 2Y5HA 4E05H 4K5ZA 3BIUH 2GTBA 2XBXA 4XDEA 3ZZ8A 2O9QA 2A0QB 3MNCA 1HJAB 2AGGX 2P16A 1FPCH 1Z8JB 1IQHA 1TWXB 1P9SA 1SGEE 2HLCA 1U6QA 4Y6DA 3HGNA 3M7UA 4BTIB 1ZHRA 3T29A 4WXIA 3RUOA 3EDXB 1FY3A 3PO1B 2D2DA 1O3HA 2BM2A 2VWNA 4Y0YE 1GMDF 1B5GH 1IHSH 2JH5D 2ZEBA 3RXJA 2WPKS 3I78A 2IJOB 2ZQ2A 5G4BA 3MFJA 3BEFB 1BMNH 5EQQA 3GYLB 1OOKB 2VJ1A 1TNJA 3UQVA 2C4FH 3CENA 3MU1A 1K1NA 1RD3B 2HGTH 4RKJB 2CGAA 1C1RA 1ESBA 5C3NA 1C1VH 4D7FA 3BTQE 1GBIA 1O2PA 1GCTC 4MDSA 4ZH8A 1UCYE 3KF2A 4GCHG 4JK6A 1O33A 1P2MA 1D3QB 3K6YA 3D23A 5HYOA 3GCTF 1ZLRA 4NG9H 3PMAB 2QF3A 1XXDA 2OC7A 4XOJA 3SUEA 1AN1E 3SW2B 1WAYB 3GDUA 5IDKA 2BD5A 1C1WH 1W2KH 3EA8A 1JIRA 2BLWA 1JXPA 2PUXB 1UCYH 1UCYK 1G3CA 2AGEX 4BNRA 3EE0B 4BTTB 2AEIH 1IOEA 4ISHH 5ESBA 2HWLB 5DP7A 1O37A 3UWIA 3M35A 4CRGA 5JBTA 6CHAB 2Y82A 4H6TA 1IQIA 1THSH 1GJDB 4DGJA 4AGJA 1SR5C 4YOGA 5A8XA 1AWHB 1J17T 2PGQB 4UE7H 2P93A 1JWTA 2FLBH 3O8RA 3ELAH 1PYTC 2XWAA 2H1UA 2QGRA 4OS4A 5T6DA 4WVPE 7LPRA 4AX9H 3A7ZA 4B2BA 4PROA 2HNTF 2OQ5A 1P10A 1XKBC 1X7AC 4K1EA 4CRFA 3RXKA 1ACBE 1IQEA 2QF0A 1G2LA 3ZZDA 1C5TA 1K28D 2JKHA 3W94A 1DLEA 3RXFA 2ODPA 1YKTA 2FZZA 4Y11E 1TMTH 3O8BA 1GI2A 2QA9E 1P2JA 2EI7A 4XBBA 1K1MA 2F3CE 1AO5A 1P11E 4K69A 2ZZUH 2HVXA 4DY7B 1YP9A 4D8NA 4FXGH 4ABJA 1K1IA 3BV9B 1C5ZB 1GBFA 1SQTA 1QHRB 1XUGA 5JPMH 1TRNA 5LGOA 1LHGH 1FN8A 1L0ZA 1W7GH 2FM2A 5E0GA 4E7NA 2FMJA 4TPYA 4OGYA 5DGJA 3S9AA 1OSSA 1LVMA 4WY3A 4JYTA 2FP7B 3Q00A 2G55A 4QT8C 1Z8GA 1ELCA 3BN9A 4KELA 5DKMA 3ZV8A 1C9PA 3RXVA 3F9HA 3SU3A 1H9HE 3P95A 4VGCB 4X8VH 3SJIA 4AB8A 3ZZAA 5EW2H 1LVBA 2IOTA 1MZAA 2SGQE 1MTSA 1O2LA 3OTJE 1P12E 2B5TB 2J34A 2W26A 2BQWB 1IAUA 2XBVA 4LK4A 1C5SA 1UHBB 3A88A 2F9UA 2ZWLH 1HDTH 3LU9B 1LQEA 3P70B 1ETRH 1ZTLA 1P02A 4IMZA 1NM6A 5DJ7A 5C5NA 2P59A 3BTEE 2A7CA 1BB0B 3A8DA 1NZQH 1IQMA 4K3JA 1Y3WA 4FUJA 3EA9A 2Z3EA 1NU9A 3QX5H 1ZPZA 2GCHG 2FESH 3LGWA 3BTME 1MH0A 1GG6C 2I6SA 1GWAA 1SGDE 1GI3A 1SLWB 3UR9A 1ELVA 4UFFH 1BJVA 4FVDA 1O5BB 2V3HH 5CE1A 2HNTE 2SGAA 1C4Y2 2J94A 1MQ6A 3A7TA 1P05A 1EJAA 2FTMA 1MU6B 2ANYA 4ABDA 1DUEA 2FX4A 4IC6A 3TNTA 3DUXH 1HUTH 3U8TH 1KDQA 4AZ2B 1YPEH 1PPFE 1TFXA 2Q6DA 1WV7H 2BD3A 1LMWB 4ZHAA 3RXIA 2Q6FA 1KXFA 5SGAE 1YPGH 1ABIH 1NT1A 1BZXE 2ZF0H 1MU8B 3BF6H 4ABEA 3VB6A 5T6GA 1BTZA 1S6HA 3JZ2B 3BG8A 4IW4E 3O8CA 1BRUP 1MQ5A 1SVPA 3OYPA 1S82A 2FYRA 3RXQA 3ODFA 4CBOA 3E90B 3ITIA 4OGXA 4NA8A 3BTKE 1SI5H 1C2MA 3FVFB 3RXCA 1A0HB 1A61H 1W8BH 5EXNA 1S6FA 2W5EA 1A3EH 3R0FA 2OUAA 1SQOA 5F03A 1ANCA 1KXEA 1C1UH 1HB0B 1ESTA 2AERH 2G81E 4WF8A 3GY7A 2OC0A 3KIDU 1QTFA 2SFAA 2V0BA 2XXLA 2ZHWH 3LT3A 3TJNA 5TCCA 3PO1C 5CHAB 4IMQA 1TE0A 4ABAA 5LPRA 1AB9C 2JETB 1FIWA 1FY4A 3MI4A 3W95A 7ESTE 1MUEB 1HAGE 1MTNB 4F4OC 2BLQA 1O5DH 1GL0E 2VH6A 1QB6A 1BQYA 2RCEA 2VIVA 3ZZ9A 1N8OB 1T8LA 1C5RA 3HK6B 5DG6A 4ZKSU 4Y8YA 3DA9B 3PYHA 3V0XA 3VGCC 1ANDA 1PQAA 1TGSZ 1HCGA 1O3BA 1C5YB 1HFDA 1GJBB 3RXPA 2OD3B 3HK3B 3GY6A 1OWHA 3OU0A 4A1XA 3ESTA 1AUJA 3U8RH 2VVCA 1F5RA 4NGAH 2ZFTA 3SO3A 1BHXB 1J15A 1CBWC 3SORA 4O9VA 1KTSB 1AWFH 4ABFA 4B76A 1C2JA 1EB1H 1T8OA 2VIOA 2G5VA 5AFYH 1O2ZA 1C1PA 2TRMA 5A0AE 3UWJH 4NWKA 1GHBG 3PM3A 4D76A 1O2NA 3CS0A 1HYLA 2C3SA 3GY8A 4ISNA 4JZ1A 2ZTZA 1F2SE 1O3OA 1EZQA 2OTVA 3MU4A 5A09A 3S9BA 5EXMA 2M5TA 1NRRH 1S81A 2OC8A 1CO7E 2IPHA 2BLOA 1SLVB 3FP8E 4MPUA 1SBWA 3ZZ3A 1CHGA 1D4PB 2D26C 1PPCE 1V2QT 2BX4A 1DFPA 1VGCC 2Z9IA 4AYYB 1L1NA 1E37B 1P2KA 1TGBA 4JYVH 4CR5A 1QA0A 3UTUH 4FUGA 5A0BA 1WOFA 2R9PA 1YPHC 3FANA 3BIVH 1GBHA 5GWZA 1SL3A 3SU6A 3GY3A 1H4WA 3RP2A 1GBAA 1RRKA 3PROA 1NRPH 2ODQA 3GY4A 3A81A 4WMDA 4FUEA 2HPPH 2ZNKH 5LPFA 3U69H 4ZKRU 1D3DB 1ABJH 2QCYA 1HV7A 1Y5UT 2STBE 1VZQH 3F6UH 2C8XB 2FDAA 3HPTB 4ZKOU 4HTCH 1GI7B 1W13U 3A83A 3MH6A 4CH2B 1TX7A 3A7VA 1G37A 2G51A 1FIZA 1WU1A 5A0CA 1T31A 2GX4A 3DD2H 1MMJN 1C1NA 4FVBA 4I8LA 3Q77A 3ENSB 4K1SA 2QXIA 4YZUA 4JMYA 1FMGA 3BSQA 2I6QA 1HAYB 1CT0E 3Q3YA 1TABE 3M37A 1JRTA 1GL1A 1NY22 1BT7A 1B7XB 4MNVA 3NUMA 1EB2A 3STJA 1QL7A 4FU7A 1HJ8A 5F8TA 4XSKU 3QK1A 2ZGHA 3D62A 1ARCA 1QJ7B 1C5LH 3WY8A 1C1OA 1ZHPA 2BY8X 2F9NA 2LPRA 2R0KA 2WYGA 3DHKH 1K2I1 4VGCC 5GPIB 1V2MT 6GCHG 2BDYA 1HXEH 3S9CA 2PR3A 1FNIA 1TPSA 3M5OA 2FWWA 1V2PT 4X0WU 1O2RA 3P17H 4UEHH 2WPMS 1HAXB 4UDWH 1ZSKA 4NWLA 5BRRE 1O30A 1S83A 1GBEA 1O2GH 2TIOA 4IN1A 3GICB 1VITH 1NRQH 4IBLH 1OKXA 2VIWA 1DX5M 1AI8H 1EZXC 1W12U 3H5CB 3A8CA 1ZTJA 3GY5A 2B7DH 4B71A 4TY7A 1OX1A 3R3GB 7GCHG 1GHVH 4MNYA 5ABWA 2FOFA 3P92A 1E0FD 1TMBH 9LPRA 1GDQA 4X2XA 2BQ7B 1P2NA 1ID5H 4Q2KA 1AFQB 2J95A 3KNXA 5FBEA 1GMCF 4NSVA 3RXUA 1K9OE 3RU4E 3M5LA 1TAWA 1XVMA 1C5MD 3SU4A 1TNIA 2TGPZ 1GBMA 1W11U 3ZVAA 1O2YA 1RTLA 3SBKA 5ETXA 1F0UA 3H7TA 1J9CH 2GMTB 1W3CA 2OBQA 4OS7A 2OINA 1TGCA 3NZIA 3SV8A 1J16A 2EC9H 1ELGA 2W7SA 5AVDA 2ULLA 2ZHEH 3ZVEA 1KXCA 1VR1H 2GCTC 2ANWA 3O8DA 3RXGA 3TITA 2EEKA 3UFAA 1YYY1 1ETTH 1ELFA 1F92A 1FY8E 2CF9H 1ZSLA 4DURA 2FX6A 5C1YA 1N6YA 3TH3H 1KLJH 2NU2E 1HRTH 3UQOA 1A0LA 1GJCB 2A4RA 1UTQA 1K21H 1P03A 1WBGB 4DIHH 3GCHB 3MTYA 4ISIH 2G52A 3P6ZB 4X6PA 1O2IA 1PQ7A 1MTVA 2ZTYA 3TU7H 4U01A 1GI1A 5DP4A 2ESTE 1QQUA 4AG1A 1Z8IB 3PLBA 1OYTH 2CHAB 3T25A 2ZGCA 1V2UT 3M61U 1O3PB 1ZMNA 4I8HA 1QURH 1ZHMA 3LKWA 1T7CA 1Y3YA 1P57B 1HIAA 5C5OA 1RIWC 1BTXA 2DUCA 3AW0A 1SGIB 3OY6U 1QBOA 1PJPA 2XC5A 3ATIA 5FX5A 2ZP0H 1TNLA 4YM9A 4X1SU 1DXWA 2ANKH 3PMJA 1CSOE 4O3UA 2VGCC 1H1BA 1ZPCA 1FN6A 2BDAA 2NU1E 2C93B 2ZDMA 2ZCLP 2F9BH 1LVYA 4M7GA 3ZVCA 1QL8A 1QB9A 1P09A 2PV9B 5DK1A 4X6MA 4AORA 1DVAH 3RXEA 1GMDG 1TMUH 1KDQB 1BMAA 2G4TA 1YPKH 2FOGA 2FPZA 3TGJE 1XUKA 5HMAA 4OS5A 1GJ4H 2Z7FE 3TGIE 4B75A 1L4DA 3UNQA 4Y76A 4D9QA 3CP7A 2Q1JA 2V6NA 3C27B 4ZHLU 3L6PA 1JBUH 2AFQB 2OCVB 1WCZA 4MNWA 1EOLA 1ELTA 3IITA 5B6OA 3T2NA 1SSXA 5EQSA 1EP5A 4K60A 1F0TA 1QNJA 3OX7U 2UUYA 4HFPB 1V2LT 4INKA 1O39A 2BD4A 3CS7A 3GCTG 2FOMB 1OPHB 4NFEA 1DICA 2ZHQH 5DP3A 4OS2A 3AAUA 1LDTT 4X8SH 2VINA 2GP9B 4NCYA 2XNIA 1KTTB 3RXOA 3QZRA 1SOTA 1O36A 1FQ3A 4ISOA 2BDIA 2TBSA 1TPPA 3KCGH 3PV4A 2AGIX 3TK5A 3LONA 1C2LA 3B9FH 1NPMA 2R2WU 3M3SA 3D65E 3V13A 1FDPA 1TGNA 1W0YH 2PGBB 2DE8A 3GISB 3TNSA 1EJNA 1BRAA 1YPMH 3QUMP 4NZLA 2A7JA 1TONA 1ZJKA 1BMLA 2G00A 2UWOA 2C8WB 1L2EA 2BDBA 1CQQA 1F5KU 4FUHA 4WXVA 3LJJA 1MCVA 2O8TA 1AFEH 5HXFA 4YOIA 1LTOA 3SNAA 1UK4A 1MAXA 2PW8H 1Q2WA 4MLFB 2P8OB 3ZZ4A 3RXAA 1LPZB 1O2HA 4CRAA 4CH8B 1A1RA 3UIRA 3VB7A 3S7KB 3MMGA 1GGDB 1N1LA 4BAQB 2ZIQH 3A86A 1ZRBA 4U2WA 2BXUH 1GVZA 5FHTA 1OP2A 2H6MA 1TNHA 4BOHA 1XUHA 4AFSA 1A5HA 1JMOH 1CA0C 1SGQE 4NA7A 3FZZA 2Q6GA 3SV7A 3VB5A 5JB9S 4Y10E 5C1XA 1VCQA 1ARBA 4O97A 2FOHA 4X1QU 3ZZCA 2B9LA 3KQDA 1S0QA 4CRBA 1O2QA 5HM2A 3BTGE 2ASUB 1EXFA 1M9UA 1B0EA 4ZXXH 4SGBE 4GPGA 1XUFA 4DW2U 2HNTC 1C9TA 1CGJE 4UFGH 3BG4B 1OP8A 3E0PB 1TQ7B 2AH4X 3DFLA 2A7HA 4I7YH 3A7WA 4ZXYH 1JRSA 3H7OA 4FUIA 2NU0E 3LH3A 1V2WT 4O03A 3PLPA 4X2WA 1AU8A 3SU2A 4MNXA 3RC4A 3E16B 1EPTC 2FI4E 3UOPA 2R0LA 1GDUA 1FAXA 2CJIA 1GJ7B 3BTWE 5EXLA 1NRNH 4MPXA 1OXGA 3M3TA 2O8UA 2VH0A 1OWDA 2OQUA 2XYAA 1O2KA 3EYDA 4KTSA 3K2UA 3SNDA 2VVVA 1D3TB 1D3PB 2ZC9H 4R8TB 4MTBA 1SLUB 1SGPE 2BLVA 2FLRH 2FYQA 4CHAB 2SNVA 1T8MA 1V2ST 4F49A 1F0RA 3MO6A 4FUFA 1YGCH 1WTGH 3GCOA 1QBVH 5E0HA 2A4QA 3T26A 1C5OH 1UVSH 4XE4A 4JZEH 1SGTA 2BB4A 2WPHS 4DT7B 2ZCKP 3U98H 2W3KA 1QR3E 8ESTE 3PMBB 6ESTA 4D9RA 1UTMA 4ZKNU 1GHAF 5EOKA 4U30A 1RTFB 2ZFSA 3RMOH 1V3XA 2FEQH 2ZU3A 1N6XA 1E35B 2UWPA 1LHCH 4UFEH 2W3IA 3RXRA 4X2YA 4HI3A 2H9TH 2XCFA 1ZMJA 3LIWA 1C1SA 3RM0H 1G3EA 4J2YB 4K8YA 1SHYA 1CE5A 3UOUA 1QB1A 2J2UA 3KQEA 4DOQA 3RLWH 1GJ5H 3LGYA 4JCNA 4NIVA 1AHTH 1SGYE 1DY9A 1LHDH 1NRSH 2V3OH 2PSXA 1Y3UA 3MU5A 1Z1JA 1LHEH 1HJAC
chains in the Genus database with same CATH superfamily
2BD8A 1IQFA 3MH7A 3SQEE 4YT6H 2ZPRA 1TIOA 1Z6EA 1DWCH 5EODA 1AKSA 2QV1A 1LQDB 2YMSD 2PKSB 2ZFRH 3RU4D 2BY9X 1GCDA 2L74A 1GI9B 3A85A 3MO9A 5EPNA 2AYWA 2GVFA 1V2JT 1UVOA 9ESTA 1XXFA 2AHME 3BTTE 5K7RA 3SQHE 2BD9A 2XBWA 2RDEA 1HNEE 3QN7A 4ASHA 2FOBA 1H8DH 4Q80A 2G4UA 1S0RA 1MBMA 1O3DA 3TH2H 3TK9A 1HAHH 1EKBB 1O3FA 4RI0A 1H9IE 5FXLA 4KP0A 2B0FA 4Y79A 2FODA 4IS5A 5I25A 3I77A 1V2VT 1TQ0B 1YLNA 5BPEA 5JBCS 1GMHG 1SGFA 1ANBA 1GJAB 3RMLH 4NIYA 1C1TA 1O2JA 3HGPA 1RXPA 3SJOA 3VFEA 1AVWA 3SU5A 1T4VH 1OYQA 1D6WA 2UUFB 1HPGA 3SZNA 1VITF 2GV6A 1SQAA 2Z94A 1PQ8A 2H5CA 4DJZB 1D9IA 3F0OA 1TNGA 1SGNE 3VB4A 1SFQB 3RXHA 2HOBA 1QBNA 2XRCA 3U1JB 2ZG0H 1SGCA 2Z3DA 3BTHE 1XX9A 1KSNA 1GHXH 4RSPA 1GVLA 3A80A 5JDUB 1G36A 4WJG2 1Y5BT 2SNWA 1DWBH 2CMYA 3B8JA 6CHAC 4OS6A 3G01A 4TPIZ 5LH8A 1C5XB 2BOHB 1BDAA 1LKAA 5EG4A 1DXPA 2J4IA 4B2CA 1O3EA 3FZDA 1O2OA 1MD8A 1CT4E 2FS9A 2W6JD 1VCPA 3PWCA 1GI5A 2H9EH 3MNXA 1W10U 2ZU1A 3M5NA 1OWEA 1TB6H 2Z9LA 1O34A 1IQGA 1A5IA 4E7RG 1GI4A 2Y5FA 1DSTA 5EQRA 1MCTA 2BDHA 2F9VA 2FXRA 1G2MA 1E38B 3AAVA 1THRH 2WPIS 2Z3CA 5GDSH 2GT8A 3SHCH 3ATKA 4AOQA 1CHOF 1OS8A 5PTPA 1NTPA 4AFUA 1GGDC 4H4FA 1HIAB 3SUFA 1Z6JH 2WV9A 1HAIH 4GAWA 1O5CB 2ZA5A 1GBDA 2YNAA 2WSSD 2OXSA 2AMQA 3C1KA 1AY6H 1LCYA 4ZCNA 1SGRE 4Q7YA 2VWOA 3NPSA 1XKAC 4R0IA 3IG6B 1BOQA 1A4WH 3OEED 3SI4H 2M2AA 1P2IA 1LPKB 1SC8U 2WV4A 3KYFA 3FP6E 1MTWA 3SGAE 5C2ZA 4TYDA 1PFXC 5F53A 1E36B 4Y7AA 4YESB 2BVRH 2ZPQA 1MABB 1O3CA 4DIIH 3T62A 1KIGH 1UVUH 1ETSH 1QQ4A 2FOAA 4CREA 4X1PU 1AE8H 1EAUA 4B2AA 2BHGA 2Z9KA 4HZHA 3A7YA 6GCHF 1FUJA 1XUIA 1KXAA 2YMSC 1C2IA 4TWWA 3STIA 2BVSH 3SYJA 2QE7D 2AMDA 4ZAEA 3MNSA 3LJOA 4DCDA 1WQVH 2ZECA 1K0HA 3T5FH 3KQCA 2TGTA 1FXYA 1J14A 2BY5X 3F1SB 5K0HA 1O2MA 3L3TA 4AFQA 2P3UB 1PPBH 1TOMH 1UK2A 2WPLS 4YTAA 3BEUA 8GCHF 1LVOA 1UTPA 3AASA 4CR9A 4CRDA 2CF8H 1YY3A 1ZMLA 2BOKA 1YPLH 1K22H 3RC6A 4LOYH 2H9HA 1LPGB 1BTYA 3QGJA 1WSSH 3URCA 4INLA 2AMPA 4GSOA 2ZKSA 2KCOA 1FY5A 3RXMA 3SUDA 4B6EA 2F91A 1QGFA 3OEHD 4UONA 3UR6A 1DWDH 1EAIA 2QY0B 2P3TB 3S7HB 1TOCB 4BAOB 3RXDA 4KTUA 3SGBE 1FPHH 1YCPH 3TPIZ 5IYTA 1O32A 1YCPK 2RDLA 2F9OA 4AB9A 4I8JA 1AVGH 1DPOA 2RA0A 4WH6A 4X6OA 5GNDA 2ZDLA 3TLOA 3SUGA 4Y71A 3LGIA 1O3LA 2BY6X 1FAKH 1UTOA 2PKAB 1UVTH 2J92A 2H2ZA 1GBJA 1BA8B 1KMHB 2BD7A 2P95A 5EIYA 3N7OA 4TWYA 4U32A 1NBMD 2ZGJA 2V35A 1BTPA 1G9IE 1GHYH 3I29A 1HAVA 3LC3A 2EY4C 1ELBA 3RXTA 4B1TA 4ABIA 1GJ8B 3MU8A 1ESAA 5FAHA 3ZYDA 1JOUB 1GG6B 1V6DA 4FETA 5EJZA 2A5IA 1LHFH 3BTDE 3A8BA 5EJLA 1THPB 1PPZA 1G32B 3S69A 4YOJA 3E1XB 1PYTD 1IQNA 1H8IH 2XCNA 2GZ7A 3B23B 5CMXH 1P9UA 1SFIA 2QIQA 5DP5A 1GBLA 3QDZB 5GIBA 3KQBA 3MOCA 2LP6A 1KLIH 2SGEE 3EAJA 5JB8S 2QC2A 1V2NT 5HM9A 2JH6D 1C5WB 1VJAU 3SOSA 4X1RU 4UD9H 2Z6BD 4M9FA 1AIXH 3UUZA 5L6NH 1C5PA 1OWKA 1Z8RA 3TVJB 3GDVA 5FCKA 3S0NA 2F9PA 5CHAC 4XBDA 1ZZZA 4XFQA 4D7GA 4IN2A 4K2YA 2JETC 2WPJS 2ZTXA 1O3AA 2TGDA 3UNRA 1C5QA 2ZCHP 4AFZA 2XNDD 1O38A 2UUJB 2GKVE 1Z71A 1WQSA 1MTNC 2CN0H 2A1DB 4ZROA 1YC0A 3ATMA 2Y6TA 1GJ6A 3ZVBA 1O3MA 4IC5A 5EU8A 5GCHG 4UFDH 5HIZA 4LZ4B 1P06A 1N8OC 3A82A 1PQ5A 3BTFE 1S84A 1TYNA 4AGKA 1XUJA 3SV2H 2PWXA 1NFYA 3MH5A 1BMMH 1IQKA 4ZMAH 1ZJDA 1WTHD 3NCLA 1PPEE 2TGAA 1YLDA 4KGAA 1RTKA 1BJUA 2WUBA 3RDZA 2A2QH 1GDNA 3NKKA 1ORFA 1EZSC 5GJ4B 1ZGVA 5FCRA 1CGHA 1FV9A 3GDSA 5A8YA 1YBWA 1TBQH 2BTCE 1TPOA 2DE9A 1P0SH 2GV7A 3E3TA 3TJVA 1AB9B 1AD8H 1AZ8A 3E6PH 4K8BA 2R3UA 2H5DA 1C2DA 1F5LA 3TGKE 4GCHF 1UO6A 1FLEE 4A5TS 1C4U2 3LDXH 2ZU2A 3M7QA 1GBBA 4I31A 3E91A 3MYWA 3M3VA 3PRDA 4JZDH 4Q7XA 1DUAA 3OSYA 1EUFA 4DG4A 3ZZ6A 1A7SA 2PTCE 1TNKA 5J4SA 3VGCB 2CV3A 2ILNA 2QXHA 4NZQA 1GHWH 1C2KA 4ABBA 1NFWA 1FY1A 2ZU4A 4F55A 3E8LA 2Y5GA 4NSYA 4Z0KA 4RKOB 3EE7A 3MO3A 3MWIU 2A5KA 1O3NA 4NFFA 3NK8A 2J9NA 1SOZA 3ZYEA 4H42U 1CBWB 5DN6D 5C67A 5E8EH 2C8YB 1DITH 2PLXA 1ZR0A 1YLCA 1BRCE 1P3CA 2ANMH 2G8TA 1YPJH 2ZHFH 4ESTE 1DY8A 1HAZB 2BZ6H 3ATWA 3UREA 4WMFA 5JBAS 1AKSB 4AC9A 1AVXA 2A32A 1PPGE 1SMFE 4X2VA 3U1IB 1DDJA 5FPTA 3GY2A 2Y7ZA 3V3MA 1DSUA 1TX8A 3A7XA 3MU0A 1OWJA 5L2ZH 4I32A 5EJ1A 1ANEA 1VGCB 1GI6A 1RGQA 1O2UA 2PKAA 2A5AA 4MQAA 1EPTA 3DSGA 1O3JA 1C4V2 2VU8E 4A1VA 2XC4A 1O31A 1QJ1B 1UTLM 3QTVH 5C17A 1P3EA 5B6LA 4K1TA 3A87A 1BITA 2OC1A 2V7QD 3PRBA 1W0KD 1MAYA 1A2CH 1QIXB 2PSYA 2GGVB 1AGJA 1ZGIA 2FS8A 1UTKA 1AUTC 2O8WA 1DE7H 1A5GH 3RM2H 4RN6A 4P00A 5T1VA 1QY6A 3RC5A 2LELA 3F68H 2W6ID 1O3GA 2BD2A 2PHBA 3UNSA 1EJMA 2LNCA 1DT2A 1F0SA 3KGPA 3M5MA 4E06H 1EASA 1G3DA 5L30H 1QRXA 1C1QA 2QN5T 2ODYB 3WWFA 3ZZBA 1ZTKA 1G30B 4DT4A 1EZUC 1C5VA 1L1GA 1O3IA 3SU1A 7KMEH 3QGNB 1CGIE 1GI0A 3V12A 4MVNA 2SGDE 3TH4H 1Y3XA 4X6NA 4KKDA 3N99A 1HBTH 1SLXB 1GBCA 1ELEE 3DSPA 4HGCA 4ABGA 3SNBA 1A0JA 2OBOA 2HVYB 3NRLA 4F48B 2B8OH 1EQ9A 4BXWA 1B0FA 1O35A 1TPAE 1MKWH 4Z6AH 1V2RT 4NIWA 1MKWK 1MTUA 4MPVA 2FOEA 2C90B 2RA3A 1AFQC 1CT2E 3LPRA 5A2MH 3HKIB 2ZO3H 3LH1A 4FUBA 5C1UA 4YXWD 2TPIZ 4OS1A 3FAOA 2FIRH 3F2GA 1HJ9A 1SPJA 2SGPE 3D49H 1VCWA 1K1OA 4YT7H 1WUNH 2ALVA 2VB0A 3QTOH 3P8NA 3V7TA 5E2PA 4AN7A 2A2XH 2GCHF 2F83A 4TY6A 5HIYA 1T8NA 1DANH 1NO9H 1HGTH 2QXGA 3SJ8A 1C5NH 3OY5U 3SI3H 2GMTC 1DOJA 4IGDA 2ZI2H 3MH4A 2XWBI 1TLDA 2J98B 2VIPA 1NFXA 2BXTH 2QF4A 5FPYA 3EQ0H 1TA2A 1UMAH 1O2TA 2GDDA 3K65B 1QZ8A 3VEQB 2BX3A 2ZDAH 1ZPBA 4BAKB 5DP8A 1OP0A 5I46H 3A89A 3QWCH 3WWBA 5TJXA 1A3BH 2AS9A 2GZ9A 2XW9A 1BRBE 5C0UA 3NXPA 3IWMA 2EI8A 3ODDA 4BAMB 5ESTE 4I33A 2BY7X 3KN2A 4NA9H 2WYJA 2D8WA 3FP7E 1NN6A 3GCHC 4JZIA 1QJ6B 1XVOA 3TIUA 1Y5AT 3SNEA 3PMHB 1GHAG 1QRZA 3DT0H 3K9XB 5KEDA 1AQ7A 1E34B 1ELAA 3F9GA 3KHVA 4B6FA 2YNBA 2WUCA 1YCPM 1S5SA 1KLTA 2AIQA 4Y8XA 1KXBA 4ZHMU 5F6MA 1O3KA 2CHAC 2GD4B 2QAAA 4AG2A 1DWEH 1O5FH 3Q3KA 2UWLA 3EGKH 3UY9A 1C2GA 2XTTB 4GVUA 1AZZA 2GCTB 2J5UA 1F7ZA 3HATH 2PFEA 5AHGH 4CBNA 6LPRA 2NWNA 4BXSA 3E0NB 3F2FA 1EX3A 2Y7XA 3SNCA 1O5GH 3ZVFA 1NC6A 1UJ1A 2R3YA 1W14U 2GZ8A 2ZQ1A 2OK5A 2VIDA 5KGOA 4THNH 1V2KT 1WYKA 2HALA 3P8FA 2ZFPH 1O5AB 1Q3XA 3ZZ5A 3QZQA 1NROH 3AW1A 2NU4E 4ISLA 1BUIA 1BTWA 1IHTH 2ZGBH 3PB1E 4BAHB 5EPYA 3KL6A 3VXEH 3RU4T 4YO9A 2P3FH 4YLUA 2W7UA 3TJUA 3UPEA 2GDEH 4GLYA 1GMHF 1JIMA 5T3HA 3VXFH 1IQLA 1T4UH 3BEIB 1BIOA 1P04A 1BBRE 4FU9A 4FUCA 4BANB 2GJGA 1CU1A 3TK6A 5A8ZA 3SJ9A 1QA7A 5HGGA 5DP6A 1EP6A 1RIWB 1HAVB 4GHQA 3PWBA 1UTJA 1NU7B 2O8LA 1Y8TA 2Z9JA 3RXSA 1P01A 1DLKB 2BQ6B 3CNRA 4MG3A 2R2MB 2FI5E 1SQRA 2ALPA 3SV9A 5JYIA 2OP9A 3LGVA 1GHBF 1DS2E 3P8OA 4LZ1H 1C1MA 1BBRH 2VGCB 1VITG 5EGMA 1BBRK 5J4QA 3GCNA 1O2XA 4A1TA 2EI6A 5F8ZA 3PTBA 2ZDNA 2ZDKA 3M7TA 1LKBA 4X1NU 8KME2 3GYMA 3FO8D 3ZVGA 1K1JA 2O8MA 1TALA 2FOCA 1GCTB 1EATA 4X8TH 2A31A 5C20A 2FO9A 4B74A 1HLTH 1XMNB 3QLPH 1HAOH 4FUDA 4TT3D 1T32A 3T28A 1O2VA 1L4ZA 1SGFG 1MKXH 1QL9A 2ZU5A 1YM0A 1MKXK 2FTLE 1Q31A 1UHBA 2KAIB 3AVZA 4YLQH 2STAE 1NFUA 4BTUB 2CXVA 5EW1H 3Q76A 1Z7KA 1HAPH 1TA6A 5FPSA 2P8OC 4KTCA 2PTNA 4Q4LA 3A84A 1O2WA 4I8KA 1EOJA 1Y3VA 2BDGA 2XBYA 1O0DH 3NWUA 3MNBA 4A7IB 2OLGA 2J98A 2AIPA 1QCPA 1K1PA 1BTUA 3PV5A 2A4OA 3HKJB 5TCAA 5F8XA 3RXLA 3RMMH 1MD7A 4SGAE 3LGUA 4Y8ZA 2WINI 5LPEA 3FOAA 1L1JA 1CHOG 5DP9A 3LOXA 3H09A 5CHBA 2K8IA 3FFGA 1TRYA 1J8AA 1EAWA 1NS3A 2PUQH 1W7XH 2HLDD 4INHA 2RG3A 5FX6A 5H4IB 1RS0A 1FI8A 3SN8A 4FU8A 1NESE 5E2OA 1MZDA 5AF9H 1UVPA 1QRWA 4NIXA 1UTNA 4WH8A 2BZAA 2BDCA 4LXBH 4ASUD 1FONA 1AMHA 1INCA 1EAXA 2ZHDA 3BG4C 1ZSJA 4I8GA 1YPHE 3ATLA 1AE5A 1DM4B 3F9EA 2GT7A 3SGQE 2KM0A 2JIZD 3VB3A 3PTNA 3K6ZA 1ZYOA 4FOUC 1EFRD 1TGTA 3ZV9A 1PPHE 2ZFFH 4Y0ZE 1C2HA 1CA0B 1RJXB 2QXJA 2VIQA 1VJ9U 2C8ZB 1P8VC 3RLYH 4H6SB 5T6FA 1C5UA 7GCHF 1Z1IA 1C2EA 2ZPSA 2IN2A 1YF4A 5DPAA 8GCHG 1H9LB 3ZVDA 2ZDVH 5C0TA 4CHAC 2Y80A 4GHTA 1CVWH 1Y59T 3SJKA 5FBIA 1ELDE 1MBQA 4O3TA 1OWIA 3GOVB 1V2TT 4DVAU 4ZUHA 1ZRKA 1KYNA 1HXFH 2VWMA 1SG8B 4WMEA 1ZOMA 2THFB 4MPWA 2Z9GA 3DFJA 1GJ9B 5GXPA 5DO4H 3U8OH 1EPTB 1FJSA 1GI8B 1GMCG 2Y81A 3ZZ7A 2SGFE 3SU0A 2BYAX 8LPRA 1K1LA 2NU3E 3M36A 3LGTA 3U9AH 3QO6A 1O2SA 4JYUH 5L2YH 4A92A 4GUXA 1BCUH 3SHAH 3KQ5A 1P2QA 1SB1H 2ZFQH 3A8AA 4ABHA 3JZ1B 4JK5A 4CRCA 3VPKA 1O5EH 3PLKA 3RXBA 3MHWU 1IQJA 1TBZH 4J1YA 1RFNA 3KEEA 4AYVB 5IK2D 2BMGB 1QFKH 1GHZA 2A4GA 2P94A 5E0JA 4B73A 2YOLA 5AFZH 4Q7ZA 2UUKB 1FZZA 1V2OT 4Y7BA 3EA7A 2VVUA 4WWYA 4A6LA 1CA8B 5JBBS 2FI3E 1KY9A 1TRMA 3Q3XA 2HRVA 2PKSC 2ZGXH 3T27A 2K1QA 1BTHH 1G3BA 1S85A 1XM1A 3URDA 1W0ZU 2D1JA 2QYIA 3GS9A 2KAIA 1A46H 3P8GA 1GPZA 1SHHB 2WV5A 1TBRH 3L33A 2JJ2D 2J38A 1GVKB 3TJOA 4XBCA 2VWLA 1BHXF 1TX6A 2EA3A 3F9FA 3SV6A 3LC5A 2BVXH 2HPQH 2XC0A 1GBTA 1D6RA 1P2OA 3RMNH 5GCHF 1LO6A 1UK3A 1KXDA 1C2FA 2A45B 4X8UH 4JZFH 1GBKA 2JH0D 2VNTA 2G5NA 2Y5HA 4E05H 4K5ZA 3BIUH 2GTBA 2XBXA 4XDEA 3ZZ8A 2O9QA 2A0QB 3MNCA 1HJAB 2AGGX 2P16A 1FPCH 1Z8JB 1IQHA 1TWXB 1P9SA 1SGEE 2HLCA 1U6QA 4Y6DA 3HGNA 3M7UA 4BTIB 1ZHRA 3T29A 4WXIA 3RUOA 3EDXB 1FY3A 3PO1B 2D2DA 4TSFD 1O3HA 2BM2A 2VWNA 4Y0YE 1GMDF 1B5GH 1IHSH 2JH5D 2ZEBA 3RXJA 2WPKS 3I78A 1SKYE 2IJOB 2ZQ2A 5G4BA 3MFJA 3BEFB 1BMNH 5EQQA 4RT0A 3GYLB 1OOKB 3F3BA 2VJ1A 1TNJA 3UQVA 2C4FH 3CENA 3MU1A 1K1NA 1RD3B 2HGTH 4RKJB 2CGAA 2KR7A 1C1RA 1ESBA 5C3NA 1C1VH 4D7FA 3BTQE 1GBIA 1O2PA 1GCTC 4MDSA 4ZH8A 2RFKC 1W0JD 1UCYE 3KF2A 4GCHG 4JK6A 1O33A 1P2MA 1D3QB 3K6YA 3D23A 5HYOA 3GCTF 1ZLRA 4NG9H 3UB0A 3PMAB 2QF3A 1XXDA 2OC7A 4XOJA 3SUEA 3SZEA 1AN1E 3SW2B 1WAYB 3GDUA 5IDKA 2BD5A 1C1WH 1W2KH 3EA8A 1JIRA 2BLWA 1JXPA 2PUXB 1UCYH 1UCYK 1G3CA 2AGEX 4BNRA 3EE0B 4BTTB 2AEIH 1IOEA 2KCYA 4ISHH 2HWLB 5ESBA 5DP7A 1O37A 3UWIA 5DSFA 3M35A 4CRGA 5JBTA 6CHAB 2Y82A 4H6TA 1IQIA 1THSH 1GJDB 4DGJA 4AGJA 1SR5C 4YOGA 5A8XA 1AWHB 1J17T 2PGQB 4UE7H 2P93A 1JWTA 2FLBH 3O8RA 3ELAH 1PYTC 2XWAA 2H1UA 2QGRA 4OS4A 5T6DA 4WVPE 7LPRA 4AX9H 3A7ZA 4B2BA 4PROA 2HNTF 2OQ5A 1P10A 1XKBC 1X7AC 4K1EA 4CRFA 2KZ4A 3RXKA 3OTPA 1ACBE 1IQEA 2QF0A 1G2LA 3ZZDA 1C5TA 1K28D 2JKHA 3W94A 1DLEA 2QF5A 3RXFA 2ODPA 1YKTA 2FZZA 4Y11E 1TMTH 3O8BA 1GI2A 2QA9E 1P2JA 1OHHD 2EI7A 4XBBA 1K1MA 2F3CE 1AO5A 3OFND 1P11E 4K69A 2ZZUH 2HVXA 4DY7B 1YP9A 4D8NA 4FXGH 4ABJA 1K1IA 3BV9B 1C5ZB 1GBFA 1SQTA 1QHRB 1XUGA 5JPMH 1TRNA 5LGOA 1LHGH 1FN8A 1L0ZA 1W7GH 2FM2A 5E0GA 4E7NA 2FMJA 4TPYA 4OGYA 5DGJA 3S9AA 1OSSA 1LVMA 4WY3A 4JYTA 2FP7B 3Q00A 2G55A 4QT8C 1Z8GA 1ELCA 3BN9A 2JJ1D 4KELA 5DKMA 3ZV8A 1C9PA 3RXVA 3F9HA 3SU3A 1H9HE 3P95A 4VGCB 4X8VH 3SJIA 4AB8A 3ZZAA 5EW2H 1LVBA 2IOTA 1MZAA 2YMSB 3DSOA 2SGQE 1MTSA 1O2LA 3OTJE 1P12E 2B5TB 2J34A 2W26A 2BQWB 1IAUA 2XBVA 4LK4A 1C5SA 1UHBB 3A88A 2F9UA 2ZWLH 1HDTH 3LU9B 1LQEA 3P70B 1ETRH 1ZTLA 1P02A 4IMZA 1NM6A 5DJ7A 5C5NA 2P59A 3BTEE 2A7CA 1BB0B 3A8DA 1NZQH 1IQMA 4K3JA 1Y3WA 4FUJA 3EA9A 2Z3EA 1NU9A 3QX5H 1ZPZA 2GCHG 2FESH 3LGWA 3BTME 1MH0A 1GG6C 2I6SA 1GWAA 1SGDE 1GI3A 1SLWB 2PP6A 3UR9A 1ELVA 4UFFH 1BJVA 4FVDA 1O5BB 2V3HH 5CE1A 2HNTE 2SGAA 1C4Y2 2J94A 1MQ6A 3A7TA 1P05A 1EJAA 2FTMA 1MU6B 2ANYA 4ABDA 1DUEA 2FX4A 4IC6A 3TNTA 3DUXH 1HUTH 3U8TH 1KDQA 4AZ2B 1YPEH 1PPFE 1TFXA 2Q6DA 1WV7H 2BD3A 1LMWB 4ZHAA 3RXIA 2Q6FA 1KXFA 5SGAE 1YPGH 1ABIH 1NT1A 1BZXE 2ZF0H 1MU8B 3BF6H 4ABEA 3VB6A 3W1EA 5T6GA 1BTZA 1S6HA 3JZ2B 3BG8A 4IW4E 3O8CA 1BRUP 1MQ5A 2L6OA 1SVPA 3OYPA 1S82A 2FYRA 3RXQA 3ODFA 4CBOA 3E90B 3ITIA 4OGXA 4NA8A 5CDFE 3BTKE 1SI5H 2KCPA 1C2MA 3FVFB 3RXCA 1A0HB 1A61H 2F4LA 1W8BH 5EXNA 1S6FA 2W5EA 1A3EH 3R0FA 2OUAA 1SQOA 2WHXA 4P02A 5F03A 1ANCA 1KXEA 1C1UH 1HB0B 1ESTA 2AERH 2G81E 4WF8A 5C94A 5HKKD 3GY7A 2OC0A 3KIDU 1QTFA 2SFAA 2V0BA 2XXLA 2ZHWH 3LT3A 3TJNA 5TCCA 3PO1C 5CHAB 4IMQA 1TE0A 4ABAA 5LPRA 1AB9C 2JETB 1FIWA 1FY4A 3MI4A 3W95A 7ESTE 1MUEB 1HAGE 1MTNB 4F4OC 2BLQA 1O5DH 1GL0E 2VH6A 1QB6A 1BQYA 2RCEA 2VIVA 3ZZ9A 1N8OB 1T8LA 1C5RA 3HK6B 5DG6A 4ZKSU 4Y8YA 3DA9B 3PYHA 3V0XA 3VGCC 1ANDA 1PQAA 1TGSZ 1HCGA 1O3BA 1C5YB 1HFDA 1GJBB 3RXPA 2OD3B 3HK3B 3GY6A 1OWHA 3OU0A 4A1XA 3ESTA 1AUJA 3U8RH 2VVCA 2V3MA 1F5RA 4NGAH 2ZFTA 3SO3A 1E1RD 1BHXB 1J15A 1CBWC 3SORA 4O9VA 1KTSB 1AWFH 4ABFA 4B76A 1C2JA 1EB1H 1T8OA 2VIOA 2G5VA 5AFYH 1O2ZA 1C1PA 2TRMA 5A0AE 3UWJH 4NWKA 1GHBG 3PM3A 4D76A 1O2NA 3CS0A 1HYLA 2C3SA 3GY8A 4ISNA 4JZ1A 2ZTZA 1F2SE 1O3OA 1EZQA 2OTVA 3MU4A 5A09A 3S9BA 5EXMA 2M5TA 1NRRH 1S81A 2OC8A 1CO7E 2IPHA 2BLOA 1BMFD 1SLVB 3FP8E 4MPUA 1SBWA 3ZZ3A 1CHGA 1D4PB 2D26C 1PPCE 1V2QT 2BX4A 1DFPA 1VGCC 2Z9IA 4AYYB 1L1NA 3F0PA 1E37B 1P2KA 1TGBA 4JYVH 4CR5A 1QA0A 3UTUH 4FUGA 2KX4A 5A0BA 1WOFA 2R9PA 1YPHC 3FANA 3BIVH 1GBHA 5GWZA 1SL3A 3SU6A 3GY3A 1H4WA 3RP2A 1GBAA 1RRKA 3PROA 1NRPH 2ODQA 3GY4A 3A81A 4WMDA 4FUEA 2HPPH 2ZNKH 5LPFA 3U69H 4ZKRU 1D3DB 1ABJH 2QCYA 1HV7A 1Y5UT 2STBE 1VZQH 1WDIA 3F6UH 2C8XB 2FDAA 3HPTB 4ZKOU 4HTCH 1GI7B 1W13U 3A83A 3MH6A 4CH2B 1TX7A 3A7VA 1G37A 2G51A 1FIZA 1WU1A 5A0CA 1T31A 2GX4A 4XD7D 3DD2H 1MMJN 5FL7D 1C1NA 4FVBA 4I8LA 3Q77A 3ENSB 4K1SA 2QXIA 4YZUA 4JMYA 1FMGA 3BSQA 2I6QA 1HAYB 1CT0E 1VKYA 3Q3YA 1TABE 3M37A 1JRTA 1GL1A 1NY22 1BT7A 1B7XB 4MNVA 3NUMA 1EB2A 3STJA 1QL7A 4FU7A 1HJ8A 5F8TA 4XSKU 3QK1A 2ZGHA 3D62A 1ARCA 1QJ7B 1C5LH 3WY8A 3FN8A 1C1OA 1ZHPA 2BY8X 2F9NA 2LPRA 2R0KA 2WYGA 3DHKH 1K2I1 4VGCC 5GPIB 1V2MT 6GCHG 2BDYA 1HXEH 2CK3D 3S9CA 2PR3A 1FNIA 1TPSA 3M5OA 2FWWA 1V2PT 4X0WU 1O2RA 3P17H 4UEHH 3WW7A 2WPMS 1HAXB 4UDWH 1ZSKA 4NWLA 5BRRE 1O30A 1S83A 1GBEA 1O2GH 2TIOA 4IN1A 3GICB 1VITH 1NRQH 4IBLH 1OKXA 2VIWA 1DX5M 1AI8H 1EZXC 1W12U 3H5CB 3A8CA 1ZTJA 3GY5A 2B7DH 4B71A 4TY7A 1OX1A 3R3GB 3OE7D 7GCHG 1GHVH 4MNYA 3OAAD 5ABWA 2FOFA 1S6LA 4I86A 3P92A 1E0FD 1TMBH 9LPRA 1GDQA 4X2XA 2BQ7B 1P2NA 2VBCA 1ID5H 4Q2KA 1AFQB 2J95A 3KNXA 5FBEA 1GMCF 4NSVA 3RXUA 1K9OE 3RU4E 2KFWA 3M5LA 1TAWA 3UAIC 1XVMA 1C5MD 3SU4A 1TNIA 2TGPZ 1GBMA 1W11U 3ZVAA 1O2YA 1RTLA 3SBKA 5ETXA 1F0UA 3H7TA 1J9CH 2GMTB 1W3CA 2OBQA 4OS7A 2OINA 1TGCA 3NZIA 3SV8A 1J16A 2EC9H 1ELGA 2W7SA 5AVDA 2ULLA 2ZHEH 3N7DA 3ZVEA 1KXCA 1VR1H 2GCTC 2ANWA 3O8DA 3RXGA 3TITA 2EEKA 3UFAA 1COWD 1YYY1 1ETTH 1ELFA 1F92A 1FY8E 2CF9H 1ZSLA 4DURA 2FX6A 5C1YA 3U28C 1N6YA 3TH3H 1KLJH 2NU2E 1HRTH 3UQOA 1A0LA 1GJCB 2A4RA 1UTQA 1K21H 1P03A 1WBGB 4DIHH 3GCHB 3MTYA 4ISIH 2G52A 3P6ZB 4X6PA 1O2IA 1PQ7A 1MTVA 2ZTYA 3TU7H 4U01A 1GI1A 5DP4A 2ESTE 1QQUA 4AG1A 1Z8IB 3PLBA 1OYTH 2CHAB 3T25A 2ZGCA 1V2UT 3M61U 1O3PB 1ZMNA 3PV2A 4ACAA 4I8HA 1QURH 1ZHMA 3LKWA 1T7CA 3ZIAD 1Y3YA 1P57B 1HIAA 5C5OA 1RIWC 1BTXA 2DUCA 3AW0A 1SGIB 3OY6U 2F43B 1QBOA 1PJPA 2IPQX 2XC5A 3ATIA 5FX5A 2ZP0H 4Z1MD 1TNLA 4YM9A 4X1SU 1DXWA 2ANKH 3PMJA 1CSOE 3KYGA 2WZQA 4O3UA 2VGCC 1H1BA 1ZPCA 1FN6A 2BDAA 2NU1E 2C93B 2ZDMA 2ZCLP 2F9BH 1LVYA 4M7GA 3ZVCA 1QL8A 1QB9A 3F2HA 1P09A 2PV9B 5DK1A 4X6MA 4AORA 1DVAH 3RXEA 1GMDG 1TMUH 1KDQB 1BMAA 2G4TA 1YPKH 2FOGA 2FPZA 3TGJE 1XUKA 5HMAA 4OS5A 1GJ4H 2Z7FE 3TGIE 4B75A 1L4DA 3UNQA 4Y76A 4D9QA 3CP7A 2Q1JA 2V6NA 3C27B 4ZHLU 3L6PA 1JBUH 2AFQB 2OCVB 1WCZA 4MNWA 1EOLA 1ELTA 3IITA 5B6OA 3T2NA 1SSXA 5EQSA 1EP5A 4K60A 1F0TA 1QNJA 3OX7U 2UUYA 4HFPB 1V2LT 4INKA 1O39A 2BD4A 3CS7A 3GCTG 2FOMB 1OPHB 4NFEA 1DICA 2ZHQH 5DP3A 1E79D 4OS2A 3AAUA 1LDTT 4X8SH 2VINA 2GP9B 4NCYA 2XNIA 1KTTB 3RXOA 3QZRA 1SOTA 1O36A 1FQ3A 4ISOA 3N7EA 2BDIA 2TBSA 1TPPA 3KCGH 3PV4A 2AGIX 3TK5A 3LONA 1C2LA 3B9FH 1NPMA 2R2WU 3M3SA 3D65E 3V13A 1FDPA 3AK5A 1TGNA 1W0YH 2PGBB 2DE8A 3GISB 3TNSA 1E1QD 1EJNA 1BRAA 1YPMH 3QUMP 4NZLA 2A7JA 1TONA 1ZJKA 1BMLA 2G00A 2UWOA 2C8WB 1L2EA 2BDBA 1CQQA 1F5KU 4FUHA 4WXVA 3LJJA 1MCVA 2O8TA 1AFEH 5HXFA 4YOIA 1LTOA 3SNAA 1UK4A 1MAXA 2PW8H 1Q2WA 4MLFB 2P8OB 3ZZ4A 3RXAA 1LPZB 1O2HA 4CRAA 4CH8B 1A1RA 3UIRA 3VB7A 3S7KB 3MMGA 1GGDB 1N1LA 4BAQB 2ZIQH 3A86A 1ZRBA 4U2WA 2BXUH 1GVZA 5FHTA 1OP2A 2H6MA 1TNHA 4BOHA 1XUHA 4AFSA 1H8ED 1A5HA 1JMOH 1CA0C 1SGQE 4NA7A 1FX0B 3FZZA 2Q6GA 3SV7A 3VB5A 5JB9S 4Y10E 5C1XA 1NBME 1VCQA 2JDID 3MQKC 1ARBA 4O97A 2FOHA 4X1QU 3ZZCA 2WPDD 2B9LA 3KQDA 1S0QA 4CRBA 1O2QA 5HM2A 2IJD1 3BTGE 5KECA 2ASUB 1EXFA 1M9UA 1B0EA 4ZXXH 4SGBE 4GPGA 1XUFA 4DW2U 2HNTC 1C9TA 1CGJE 4UFGH 3BG4B 1OP8A 3E0PB 1TQ7B 2AH4X 3DFLA 2A7HA 4I7YH 3A7WA 4ZXYH 1JRSA 3H7OA 4FUIA 2NU0E 3LH3A 1V2WT 4O03A 3PLPA 4X2WA 1AU8A 3SU2A 4MNXA 3RC4A 3E16B 1EPTC 2FI4E 3UOPA 2R0LA 1GDUA 4RT1A 1FAXA 2CJIA 1GJ7B 3BTWE 5EXLA 1NRNH 4MPXA 1OXGA 3VG8A 3M3TA 2O8UA 2KCAA 2VH0A 1OWDA 2OQUA 2XYAA 1O2KA 3EYDA 4KTSA 1UW7A 3K2UA 3SNDA 2VVVA 1D3TB 1D3PB 2ZC9H 4R8TB 4MTBA 1SLUB 1SGPE 2BLVA 3FKSD 2FLRH 2K0QA 2FYQA 4CHAB 2SNVA 1T8MA 3DCLA 2EQNA 2J97A 1V2ST 4F49A 1F0RA 3MO6A 4FUFA 1YGCH 1WTGH 3GCOA 1QBVH 5E0HA 2A4QA 3T26A 2XOKD 1C5OH 1UVSH 4XE4A 4JZEH 4OM9A 1YWUA 1SGTA 2BB4A 2WPHS 4DT7B 2ZCKP 3U98H 2W3KA 1QR3E 8ESTE 3PMBB 6ESTA 4D9RA 1UTMA 4ZKNU 4XRNA 1GHAF 5EOKA 4U30A 1RTFB 2ZFSA 3RMOH 1V3XA 2FEQH 2ZU3A 1N6XA 1E35B 1H8HD 2UWPA 1LHCH 4UFEH 2W3IA 3RXRA 4X2YA 4HI3A 4ACBA 2H9TH 2XCFA 1ZMJA 3LIWA 1C1SA 3RM0H 1G3EA 4J2YB 4K8YA 4Q63A 1SHYA 1WXRA 1CE5A 3UOUA 1QB1A 2J2UA 3KQEA 4DOQA 3RLWH 1GJ5H 3LGYA 4JCNA 4NIVA 1AHTH 1SGYE 1DY9A 1LHDH 1NRSH 2V3OH 2PSXA 1Y3UA 4HG6A 3MU5A 1Z1JA 1LHEH 1HJAC
chains in the Genus database with same CATH topology
2BD8A 1IQFA 3MH7A 3SQEE 4YT6H 2ZPRA 1TIOA 1Z6EA 1DWCH 5EODA 1AKSA 2QV1A 1LQDB 2PKSB 2ZFRH 3RU4D 2BY9X 1GCDA 1GI9B 3A85A 3MO9A 5EPNA 2AYWA 2GVFA 1V2JT 1UVOA 9ESTA 1XXFA 3BTTE 5K7RA 3SQHE 2BD9A 2XBWA 1HNEE 3QN7A 4ASHA 2FOBA 1H8DH 4Q80A 2G4UA 1S0RA 1MBMA 1O3DA 3TH2H 3TK9A 1HAHH 1EKBB 1O3FA 1H9IE 5FXLA 4KP0A 2B0FA 4Y79A 2FODA 4IS5A 5I25A 3I77A 1V2VT 1TQ0B 5BPEA 5JBCS 1GMHG 1SGFA 1ANBA 1GJAB 3RMLH 4NIYA 1C1TA 1O2JA 3HGPA 1RXPA 3SJOA 3VFEA 1AVWA 3SU5A 1T4VH 1OYQA 1D6WA 2UUFB 1HPGA 3SZNA 1VITF 2GV6A 1SQAA 2Z94A 1PQ8A 2H5CA 4DJZB 1D9IA 1TNGA 1SGNE 3VB4A 1SFQB 3RXHA 2HOBA 1QBNA 2XRCA 3U1JB 2ZG0H 1SGCA 2Z3DA 3BTHE 1XX9A 1KSNA 1GHXH 4RSPA 1GVLA 3A80A 5JDUB 1G36A 4WJG2 1Y5BT 2SNWA 1DWBH 2CMYA 3B8JA 6CHAC 4OS6A 3G01A 4TPIZ 5LH8A 1C5XB 2BOHB 1BDAA 1LKAA 5EG4A 1DXPA 2J4IA 4B2CA 1O3EA 3FZDA 1O2OA 1MD8A 1CT4E 2FS9A 1VCPA 3PWCA 1GI5A 2H9EH 3MNXA 1W10U 2ZU1A 3M5NA 1OWEA 1TB6H 2Z9LA 1O34A 1IQGA 1A5IA 4E7RG 1GI4A 2Y5FA 1DSTA 5EQRA 1MCTA 2BDHA 2F9VA 2FXRA 1G2MA 1E38B 3AAVA 1THRH 2WPIS 2Z3CA 5GDSH 2GT8A 3SHCH 3ATKA 4AOQA 1CHOF 1OS8A 5PTPA 1NTPA 4AFUA 1GGDC 4H4FA 1HIAB 3SUFA 1Z6JH 4GAWA 1HAIH 1O5CB 2ZA5A 1GBDA 2YNAA 2OXSA 2AMQA 3C1KA 1AY6H 1LCYA 1SGRE 4Q7YA 2VWOA 3NPSA 1XKAC 4R0IA 3IG6B 1BOQA 1A4WH 3SI4H 1P2IA 1LPKB 1SC8U 2WV4A 3FP6E 1MTWA 3SGAE 5C2ZA 4TYDA 1PFXC 1E36B 4Y7AA 4YESB 2BVRH 2ZPQA 1O3CA 4DIIH 3T62A 1KIGH 1UVUH 1ETSH 1QQ4A 2FOAA 4CREA 4X1PU 1AE8H 1EAUA 4B2AA 2BHGA 2Z9KA 4HZHA 3A7YA 6GCHF 1FUJA 1XUIA 1KXAA 1C2IA 4TWWA 3STIA 2BVSH 2AMDA 4ZAEA 3MNSA 3LJOA 4DCDA 1WQVH 2ZECA 3T5FH 3KQCA 2TGTA 1FXYA 1J14A 2BY5X 3F1SB 5K0HA 1O2MA 3L3TA 4AFQA 2P3UB 1PPBH 1TOMH 1UK2A 2WPLS 4YTAA 3BEUA 8GCHF 1LVOA 1UTPA 3AASA 4CR9A 4CRDA 2CF8H 1ZMLA 2BOKA 1YPLH 1K22H 3RC6A 4LOYH 2H9HA 1LPGB 1BTYA 3QGJA 1WSSH 3URCA 4INLA 2AMPA 4GSOA 2ZKSA 1FY5A 3RXMA 3SUDA 2F91A 1QGFA 4UONA 3UR6A 1DWDH 1EAIA 2QY0B 2P3TB 3S7HB 1TOCB 4BAOB 3RXDA 4KTUA 3SGBE 1FPHH 1YCPH 3TPIZ 5IYTA 1O32A 1YCPK 2RDLA 2F9OA 4AB9A 4I8JA 1AVGH 1DPOA 2RA0A 4WH6A 4X6OA 2ZDLA 3TLOA 3SUGA 4Y71A 3LGIA 1O3LA 2BY6X 1FAKH 1UTOA 2PKAB 1UVTH 2J92A 2H2ZA 1GBJA 1BA8B 2BD7A 2P95A 3N7OA 4TWYA 4U32A 2ZGJA 2V35A 1BTPA 1G9IE 1GHYH 3I29A 1HAVA 3LC3A 1ELBA 3RXTA 4B1TA 4ABIA 1GJ8B 3MU8A 1ESAA 5FAHA 3ZYDA 1JOUB 1GG6B 1V6DA 2A5IA 1LHFH 3BTDE 3A8BA 1THPB 1PPZA 1G32B 3S69A 4YOJA 3E1XB 1PYTD 1IQNA 1H8IH 2XCNA 2GZ7A 3B23B 5CMXH 1P9UA 1SFIA 2QIQA 5DP5A 1GBLA 3QDZB 5GIBA 3KQBA 3MOCA 1KLIH 2SGEE 3EAJA 5JB8S 2QC2A 1V2NT 5HM9A 2JH6D 1C5WB 1VJAU 3SOSA 4X1RU 4UD9H 2Z6BD 1AIXH 3UUZA 5L6NH 1C5PA 1OWKA 1Z8RA 3TVJB 3GDVA 5FCKA 3S0NA 2F9PA 5CHAC 4XBDA 1ZZZA 4XFQA 4D7GA 4IN2A 4K2YA 2JETC 2WPJS 2ZTXA 1O3AA 2TGDA 3UNRA 1C5QA 2ZCHP 4AFZA 1O38A 2UUJB 2GKVE 1Z71A 1WQSA 1MTNC 2CN0H 2A1DB 4ZROA 1YC0A 3ATMA 2Y6TA 1GJ6A 3ZVBA 1O3MA 4IC5A 5EU8A 5GCHG 4UFDH 4LZ4B 1P06A 1N8OC 3A82A 1PQ5A 3BTFE 1S84A 1TYNA 4AGKA 1XUJA 3SV2H 2PWXA 1NFYA 3MH5A 1BMMH 1IQKA 4ZMAH 1ZJDA 1WTHD 3NCLA 1PPEE 2TGAA 1YLDA 4KGAA 1RTKA 1BJUA 2WUBA 3RDZA 2A2QH 1GDNA 3NKKA 1ORFA 1EZSC 5GJ4B 1ZGVA 5FCRA 1CGHA 1FV9A 3GDSA 5A8YA 1YBWA 1TBQH 2BTCE 1TPOA 2DE9A 1P0SH 2GV7A 3E3TA 3TJVA 1AB9B 1AD8H 1AZ8A 3E6PH 4K8BA 2R3UA 2H5DA 1C2DA 1F5LA 3TGKE 4GCHF 1UO6A 1FLEE 4A5TS 1C4U2 3LDXH 2ZU2A 3M7QA 1GBBA 4I31A 3E91A 3MYWA 3M3VA 4JZDH 4Q7XA 1DUAA 3OSYA 1EUFA 4DG4A 3ZZ6A 1A7SA 2PTCE 1TNKA 5J4SA 3VGCB 2CV3A 2ILNA 2QXHA 4NZQA 1GHWH 1C2KA 4ABBA 1NFWA 1FY1A 2ZU4A 3E8LA 2Y5GA 4NSYA 4Z0KA 4RKOB 3MO3A 3MWIU 2A5KA 1O3NA 4NFFA 3NK8A 2J9NA 1SOZA 3ZYEA 4H42U 1CBWB 5C67A 5E8EH 2C8YB 1DITH 2PLXA 1ZR0A 1YLCA 1BRCE 1P3CA 2ANMH 2G8TA 1YPJH 2ZHFH 4ESTE 1DY8A 1HAZB 2BZ6H 3ATWA 3UREA 4WMFA 5JBAS 1AKSB 1AVXA 2A32A 1PPGE 1SMFE 4X2VA 3U1IB 1DDJA 5FPTA 3GY2A 2Y7ZA 3V3MA 1DSUA 1TX8A 3A7XA 3MU0A 1OWJA 5L2ZH 4I32A 1ANEA 1VGCB 1GI6A 1RGQA 1O2UA 2PKAA 2A5AA 4MQAA 1EPTA 1O3JA 1C4V2 2VU8E 4A1VA 2XC4A 1O31A 1QJ1B 1UTLM 3QTVH 1P3EA 4K1TA 3A87A 1BITA 2OC1A 1MAYA 1A2CH 1QIXB 2PSYA 2GGVB 1AGJA 1ZGIA 2FS8A 1UTKA 1AUTC 2O8WA 1DE7H 1A5GH 3RM2H 4RN6A 3RC5A 1QY6A 3F68H 1O3GA 2BD2A 2PHBA 3UNSA 1EJMA 2LNCA 1DT2A 1F0SA 3KGPA 3M5MA 4E06H 1EASA 1G3DA 5L30H 1QRXA 1C1QA 2QN5T 2ODYB 3ZZBA 1ZTKA 1G30B 1EZUC 1C5VA 1L1GA 1O3IA 3SU1A 7KMEH 3QGNB 1CGIE 1GI0A 3V12A 4MVNA 2SGDE 3TH4H 1Y3XA 4X6NA 4KKDA 1HBTH 1SLXB 1GBCA 1ELEE 4HGCA 4ABGA 3SNBA 1A0JA 2OBOA 2B8OH 1EQ9A 4BXWA 1B0FA 1O35A 1TPAE 1MKWH 4Z6AH 1V2RT 4NIWA 1MKWK 1MTUA 4MPVA 2FOEA 2C90B 2RA3A 1AFQC 1CT2E 3LPRA 5A2MH 3HKIB 2ZO3H 3LH1A 4FUBA 5C1UA 2TPIZ 4OS1A 3FAOA 2FIRH 1HJ9A 1SPJA 2SGPE 3D49H 1VCWA 1K1OA 4YT7H 1WUNH 2ALVA 2VB0A 3QTOH 3P8NA 3V7TA 5E2PA 4AN7A 2A2XH 2GCHF 2F83A 4TY6A 1T8NA 1DANH 1NO9H 1HGTH 2QXGA 3SJ8A 1C5NH 3OY5U 3SI3H 2GMTC 1DOJA 4IGDA 2ZI2H 3MH4A 2XWBI 1TLDA 2VIPA 1NFXA 2BXTH 5FPYA 3EQ0H 1TA2A 1UMAH 1O2TA 2GDDA 3K65B 3VEQB 2BX3A 2ZDAH 1ZPBA 4BAKB 5DP8A 1OP0A 5I46H 3A89A 3QWCH 5TJXA 1A3BH 2AS9A 2GZ9A 2XW9A 1BRBE 3NXPA 3IWMA 2EI8A 3ODDA 4BAMB 5ESTE 4I33A 2BY7X 3KN2A 4NA9H 2WYJA 2D8WA 3FP7E 1NN6A 3GCHC 4JZIA 1QJ6B 1XVOA 3TIUA 1Y5AT 3SNEA 3PMHB 1GHAG 1QRZA 3DT0H 3K9XB 1AQ7A 1E34B 1ELAA 3F9GA 3KHVA 2YNBA 2WUCA 1YCPM 1S5SA 1KLTA 2AIQA 4Y8XA 1KXBA 4ZHMU 5F6MA 1O3KA 2CHAC 2GD4B 2QAAA 4AG2A 1DWEH 1O5FH 3Q3KA 2UWLA 3EGKH 3UY9A 1C2GA 2XTTB 4GVUA 1AZZA 2GCTB 1F7ZA 3HATH 2PFEA 5AHGH 4CBNA 6LPRA 2NWNA 4BXSA 3E0NB 1EX3A 2Y7XA 3SNCA 1O5GH 3ZVFA 1NC6A 1UJ1A 2R3YA 1W14U 2GZ8A 2ZQ1A 2VIDA 4THNH 1V2KT 1WYKA 2HALA 3P8FA 2ZFPH 1O5AB 1Q3XA 3ZZ5A 3QZQA 1NROH 3AW1A 2NU4E 4ISLA 1BUIA 1BTWA 1IHTH 2ZGBH 3PB1E 4BAHB 5EPYA 3KL6A 3VXEH 3RU4T 4YO9A 2P3FH 4YLUA 2W7UA 3TJUA 3UPEA 2GDEH 4GLYA 1GMHF 1JIMA 5T3HA 3VXFH 1IQLA 1T4UH 3BEIB 1BIOA 1P04A 1BBRE 4FU9A 4FUCA 4BANB 1CU1A 3TK6A 5A8ZA 3SJ9A 1QA7A 5HGGA 5DP6A 1EP6A 1RIWB 1HAVB 4GHQA 3PWBA 1UTJA 1NU7B 2O8LA 1Y8TA 2Z9JA 3RXSA 1P01A 1DLKB 2BQ6B 4MG3A 2R2MB 2FI5E 2ALPA 3SV9A 5JYIA 2OP9A 3LGVA 1GHBF 1DS2E 3P8OA 4LZ1H 1C1MA 1BBRH 2VGCB 1VITG 5EGMA 1BBRK 5J4QA 3GCNA 1O2XA 4A1TA 2EI6A 5F8ZA 3PTBA 2ZDNA 2ZDKA 3M7TA 1LKBA 4X1NU 8KME2 3GYMA 3ZVGA 1K1JA 2O8MA 1TALA 2FOCA 1GCTB 1EATA 4X8TH 2A31A 5C20A 2FO9A 4B74A 1HLTH 1XMNB 3QLPH 1HAOH 4FUDA 1T32A 3T28A 1O2VA 1L4ZA 1SGFG 1MKXH 1QL9A 2ZU5A 1YM0A 1MKXK 2FTLE 1Q31A 1UHBA 2KAIB 3AVZA 4YLQH 2STAE 1NFUA 4BTUB 2CXVA 5EW1H 3Q76A 1Z7KA 1HAPH 1TA6A 5FPSA 2P8OC 4KTCA 2PTNA 3A84A 1O2WA 4I8KA 1EOJA 1Y3VA 2BDGA 2XBYA 1O0DH 3NWUA 3MNBA 4A7IB 2OLGA 2AIPA 1QCPA 1K1PA 1BTUA 2A4OA 3HKJB 5TCAA 5F8XA 3RXLA 3RMMH 1MD7A 4SGAE 3LGUA 4Y8ZA 2WINI 5LPEA 1L1JA 1CHOG 5DP9A 3LOXA 3FFGA 1TRYA 1J8AA 1EAWA 1NS3A 2PUQH 1W7XH 4INHA 2RG3A 5FX6A 5H4IB 1RS0A 1FI8A 3SN8A 4FU8A 1NESE 5E2OA 1MZDA 5AF9H 1UVPA 1QRWA 4NIXA 1UTNA 4WH8A 2BZAA 2BDCA 4LXBH 1FONA 1AMHA 1INCA 1EAXA 2ZHDA 3BG4C 1ZSJA 4I8GA 1YPHE 3ATLA 1AE5A 1DM4B 3F9EA 2GT7A 3SGQE 3VB3A 3PTNA 3K6ZA 1ZYOA 1TGTA 3ZV9A 1PPHE 2ZFFH 4Y0ZE 1C2HA 1CA0B 1RJXB 2QXJA 2VIQA 1VJ9U 2C8ZB 1P8VC 3RLYH 4H6SB 5T6FA 1C5UA 7GCHF 1Z1IA 1C2EA 2ZPSA 2IN2A 1YF4A 5DPAA 8GCHG 1H9LB 3ZVDA 2ZDVH 4CHAC 2Y80A 4GHTA 1CVWH 1Y59T 3SJKA 5FBIA 1ELDE 1MBQA 4O3TA 1OWIA 3GOVB 1V2TT 4DVAU 4ZUHA 1ZRKA 1KYNA 1HXFH 2VWMA 1SG8B 4WMEA 1ZOMA 2THFB 4MPWA 2Z9GA 3DFJA 1GJ9B 5GXPA 5DO4H 3U8OH 1EPTB 1FJSA 1GI8B 1GMCG 2Y81A 3ZZ7A 2SGFE 3SU0A 2BYAX 8LPRA 1K1LA 2NU3E 3M36A 3LGTA 3U9AH 3QO6A 1O2SA 4JYUH 5L2YH 4A92A 4GUXA 1BCUH 3SHAH 1P2QA 1SB1H 2ZFQH 3A8AA 4ABHA 3JZ1B 4JK5A 4CRCA 3VPKA 1O5EH 3PLKA 3RXBA 3MHWU 1IQJA 1TBZH 4J1YA 1RFNA 3KEEA 4AYVB 2BMGB 1QFKH 1GHZA 2A4GA 2P94A 5E0JA 4B73A 2YOLA 5AFZH 4Q7ZA 2UUKB 1FZZA 1V2OT 4Y7BA 3EA7A 2VVUA 4WWYA 4A6LA 1CA8B 5JBBS 2FI3E 1KY9A 1TRMA 3Q3XA 2HRVA 2PKSC 2ZGXH 3T27A 2K1QA 1BTHH 1G3BA 1S85A 1XM1A 3URDA 1W0ZU 2D1JA 2QYIA 2KAIA 1A46H 3P8GA 1GPZA 1SHHB 2WV5A 1TBRH 3L33A 2J38A 1GVKB 3TJOA 4XBCA 2VWLA 1BHXF 1TX6A 2EA3A 3F9FA 3SV6A 3LC5A 2BVXH 2HPQH 2XC0A 1GBTA 1D6RA 1P2OA 3RMNH 5GCHF 1LO6A 1UK3A 1KXDA 1C2FA 2A45B 4X8UH 4JZFH 1GBKA 2JH0D 2VNTA 2G5NA 2Y5HA 4E05H 4K5ZA