21BIA

Interleukin-1 beta (il-1 beta) (mutant with cys 71 replaced by ala) (c71a)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
151
structure length
151
Chain Sequence
VRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSAVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-1 BETA
molecule tags Cytokine
source organism Homo sapiens
total genus 24
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1991-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 21biA00
1BASA 3VSZA 3AKGA 4X37A 3F1RA 5DSSB 3OBTA 1DLLA 4D0ZA 1Q03A 3VSFA 3RMXA 3ZC8A 1I1EA 3HN1A 3I2XA 3BRFA 1IRPA 3BADA 1ONKB 2KI6B 3AH2A 4JKXB 2FGFA 3FJEA 4I4VA 2F2FC 4KBBA 1XYFA 5HPZA 3SNVA 3WMUA 1PZZA 1WBCA 3CRGA 3P6JA 4J2SA 4JRAA 1FQ9A 5D62A 2RSTA 3O4AA 5F8YA 5G00A 3O44A 3IM6A 3ZXGA 1FWVA 2MIBA 1BLDA 1RMLA 2KI4A 2IHOA 3FUOA 2NVHA 4XKIA 2D24A 2ZQOA 1JLXA 2VLCA 1A8DA 2D7IA 2DRYA 1EV2A 1V6WA 1JLYA 1NUNA 4X39A 1DZDA 1S0EA 3Q7YA 4OEFA 4QD2B 1G9BA 3BRDA 3PMEA 4LO0A 1DQGA 1OQLB 3LTQA 2D20A 2RG9B 3ZX7A 3UJ0A 3Q7WA 2D1ZA 3CA6A 5FZUA 4ZFWB 3CA1A 3RTIB 1TP0A 1ISWA 3IAGC 8I1BA 5BQUA 1SR4A 1R8OA 3LLPA 1TOOA 2LIQA 1KNMA 4KEIA 4L4IA 4TLPA 5JLVA 3FJFA 4G6MA 1ISYA 4OWJA 4QBCA 3AKFA 1S0CA 1UPSA 3HBWA 3W9TA 1K5UA 4I7IA 4EB2B 5B2HA 4I1EA 1XZZA 4HA2A 2F2FA 1XHBA 4JP0A 1HWMB 4ISQA 5I1BA 3BA7A 4IYBA 5FZYA 3BX1C 4KC3A 5DZUA 1K5VA 2GZBA 3N0KA 2AQZA 4II0A 3AZWA 4Q9PA 2J3PA 1N4KA 2BEAA 4QC4A 4AN6A 4KEKA 5FZZA 2D43A 3F62B 3BA4A 1RZOB 4I4YA 2D7RA 4ISRA 1MC9A 3BB2A 1IT0A 3A07A 5GAQA 5FNXA 1ITBA 1RG8A 1P63A 4LO7B 5BXSA 2NZ9A 3CA0A 3IM5A 1FMZA 3NBDA 4HR6C 1JT3A 1TFMB 4QALA 3AZVA 4EFPA 2Y9WC 4USOA 3OJVA 4Q9GA 2FFUA 4I37A 2NYYA 3I2AA 3A23A 1DFCA 4OWLA 2ESUA 3C9ZA 4J2YA 3O4BA 4GOYA 5EHAA 4EEEB 4GP3A 1S0LA 4LO1C 3RSJA 3FJBA 1BFBA 3N7JA 3I29B 3OGGA 2FO1A 1AXMA 5EC5A 2DS0A 4I0YA 3UDAA 2HWAA 3O4CA 3PG0A 3BRGC 3V79C 2FDBM 5D63A 1IJTA 3V0AB 3E8LC 4A7KA 1I1BA 4IZEA 1FV2A 4P0JA 4F34A 3RTJB 4IHZA 3POKA 1BLAA 4QBVA 1AVUA 5E24E 3CRIA 2WRYA 2YUGA 1XG6A 4QD2C 3AH4A 4GOVA 3HOMA 1YXWA 3NJ5A 4EKXB 1GGPB 1F31A 1TWMA 3D7WB 1BFFA 2RQ9A 5F90A 1HCDA 3VT2A 4P0LA 3V0BA 1G82A 2Q9XA 1HWPB 3BAUA 3H6QA 5BXRA 3HMYA 3OJMA 4DEPA 2P39A 3HALA 9ILBA 2K4AB 1ISXA 4I3NA 4G1RA 3B9UA 4DCKC 4LO3C 3FJ9A 4GAFA 4G9NA 2E4MA 4GP0A 4QO3A 1V6XA 2AAIB 1S0BA 2BFHA 3CRHA 3CA5A 1JT4A 3VT0A 3ZC9A 2D22A 4EFQA 3NBNA 1BFCA 2VSAA 3UD9A 5BOWA 3O5WB 4ZA3B 2Z48A 3MALA 1JT7A 2K8RA 1YF8B 4I4RA 1JTCA 4LO1A 21BIA 5F8SA 4ZFYB 2LIEA 3N7LA 4I4QA 1CVSA 4X38A 2ZR1B 3FJ8A 3ZXDA 2HWMA 3FJCA 3BA5A 3CA4A 3BAGA 3O4OA 1YYNA 2NP0A 4J2KA 1PWAA 2WBCA 3H6RB 4LO7C 3NBCA 1Z2VA 3NBEA 4J23B 3UD7A 3P53A 3N7MA 5FNWA 3UD8A 3A22A 1ISZA 3A21A 1W3AA 1FGAA 4I1BA 5BP5C 7I1BA 4USPA 4ZGRB 2X2SA 3FJKA 3OJ2A 1S0GA 4I8MA 3WO2A 4OEGA 4ZOTA 3FUQA 1QXMA 2X2TA 3WO3A 1WD3A 4OUJA 4GAIA 41BIA 1II4A 1Q1UA 4CJMA 2R9KB 31BIA 1JQZA 2DREA 4LO3A 1Z4SA 3MPPG 3CU1B 2BEBA 3QR5A 4IY8A 3AKHA 4LO2C 1QQLA 1IRAX 3OBRA 3IM7A 3P6IA 1W3FA 4Z9WB 4DENA 1QQKA 5BXPA 1PUMB 1HWOB 4PC4A 5BVPI 3R4UA 2VUAA 2XOAA 1CE7B 3FFZA 1TWEA 3BAOA 3VWCA 3RMYA 1T9FA 1HCEA 1AF9A 1G9DA 4I4OA 1FMMS 1AVWB 1ISVA 2Y9FA 3V0BB 1DFQA 4XFSA 1T4QA 4JAWA 4YOLA 3BAQA 2D23A 1RY7A 3FJIA 4Z8SB 3JUTA 4IONA 3TC2A 3WO4A 1S0FA 2KH2A 4IY9A 3AJ5A 1EPWA 2IWTB 2L5XA 5D61A 4A7YA 1MD6A 2VSEA 4D8HA 4F83A 1NZKA 3WINC 4I4UA 2HZ9A 3PUBA 1PC8B 3O3QA 1TIEA 3FJAA 1EYLA 2ZQNA 1SZ6B 2VXTI 4WBCA 1VCLA 5BP5A 1TTUA 3VUOA 3QYDA 3JRRA 3S8JA 4D0TA 2F8XC 1HIBA 2ET2A 3VEQA 1V6VA 2UUSA 4ZKTB 3CAHA 3EF2A 1AFCA 4QKSA 3HSMA 3WMVA 3FJJA 5EG6C 3ILAA 3AKIA 1L2HA 1FN0A 4HJJA 4ZLBB 4LO2A 4R6UB 4IQPA 3V0AA 4KEJA 4ZBVB 2P23A 4EFRA 2Y9XE 1HKNA 2ERMA 3AH1A 1AVAC 3WA1A 3BAVA 5DUYA 3O4DA 1EVTA 4OWKA 2AXMA 5F8WA 1IHKA 2QN4A 1JT5A 1R8NA 2KLLA 3FGMA 5DVHA 3T8SA 1BA7A 2NTDA 4I4PA 2VXRA 3H6SE 4JKQA 4H9WA 4ZFUB 6I1BA 4IZXA 1DJSB 3AJ6A 3S8KA 1YBIA 2KKIA 2QYIB 3BAHA 4X3AA 3CQAA 2MC2A 3K1XA 1HWNB 2D44A 1G9AA 1AVXB 1M2TB 3WINA 2VU9A 3UJ4A 3PHZA 2K43A 1Z0HA 1BFGA 4H04A 4OEEA 3BTAA 3O49A 4I4SA 1E0OA 4OW4A 1D0HA 1DZCA 3CA3A 3FJDA 1YTOA 4G9MA 4I6IA 4P6AA 4P0KA 4JQ0A 1ABRB 2MLLB 2Y9GA 2FFVA 3Q7XA 1J0SA 1IOBA 1WBAA 2GO2A 4ENDA 2AFGA 1DQOA 4FVVA 1IILA 4FGFA 2Q3NB 1FWUA 2M49A 4I2SA 3R4SA 1W3GA 4I96A 4XFTA 1DIWA 1G9CA 4J2XA 1JY0A 4I4XA 3OGFA 3VT1A 4JPZA 4A7ZA 3H6RA 3FJHA 4Q91A 5JMCA 1FV3A 3KMVA 1V6UA 4AN7B 4L4HA 4LO0C 2E4MC 2Z49A 5BXTA 1Q04A 4G6JA 1PUUB 1ILR1 2I1BA 1M16A 4XFUA 4LO8B 3IIRA 3N7KA 4QKRA 1S0DA 1WD4A 2DRZA 5BQUC 2HW9A 1BARA 2NM1A 1SR4C
chains in the Genus database with same CATH superfamily
1BASA 3VSZA 3AKGA 4X37A 3F1RA 5DSSB 3OBTA 1DLLA 4D0ZA 1Q03A 3VSFA 3RMXA 3ZC8A 1I1EA 3HN1A 3I2XA 3BRFA 1IRPA 3BADA 1ONKB 2KI6B 3AH2A 4JKXB 2FGFA 3FJEA 4I4VA 2F2FC 4KBBA 1XYFA 5HPZA 3SNVA 3WMUA 1PZZA 1WBCA 3CRGA 3P6JA 4J2SA 4JRAA 1FQ9A 5D62A 2RSTA 3O4AA 5F8YA 5G00A 3O44A 3IM6A 3ZXGA 1FWVA 2MIBA 1BLDA 1RMLA 2KI4A 2IHOA 3FUOA 2NVHA 4XKIA 2D24A 2ZQOA 1JLXA 2VLCA 1A8DA 2D7IA 2DRYA 1EV2A 1V6WA 1JLYA 1NUNA 4X39A 1DZDA 1S0EA 3Q7YA 4OEFA 4QD2B 1G9BA 3BRDA 3PMEA 4LO0A 1DQGA 1OQLB 3LTQA 2D20A 2RG9B 3ZX7A 3UJ0A 3Q7WA 4UY4A 2D1ZA 3CA6A 5FZUA 4ZFWB 3CA1A 3RTIB 1TP0A 1ISWA 3IAGC 8I1BA 5BQUA 1SR4A 1R8OA 3LLPA 1TOOA 2LIQA 1KNMA 4KEIA 4L4IA 4TLPA 5JLVA 3FJFA 4G6MA 1ISYA 4OWJA 4QBCA 3AKFA 1S0CA 1UPSA 3HBWA 3W9TA 1K5UA 4I7IA 4EB2B 5B2HA 4I1EA 1XZZA 4HA2A 2F2FA 1XHBA 4JP0A 1HWMB 4ISQA 5I1BA 3BA7A 4IYBA 5FZYA 3BX1C 4KC3A 5DZUA 1K5VA 2GZBA 3N0KA 2AQZA 4II0A 3AZWA 4Q9PA 2J3PA 1N4KA 2BEAA 4QC4A 4AN6A 4KEKA 5FZZA 2D43A 3F62B 3BA4A 1RZOB 4I4YA 2D7RA 4ISRA 1MC9A 3BB2A 1IT0A 3A07A 5GAQA 5FNXA 1ITBA 1RG8A 1P63A 4LO7B 5BXSA 2NZ9A 3CA0A 4MZGB 3IM5A 1FMZA 3NBDA 4HR6C 1JT3A 1TFMB 4QALA 3AZVA 4EFPA 2Y9WC 4USOA 3OJVA 4Q9GA 2FFUA 4I37A 2NYYA 3I2AA 3A23A 1DFCA 4OWLA 2ESUA 3C9ZA 4J2YA 3O4BA 4GOYA 5EHAA 4EEEB 4GP3A 1S0LA 4LO1C 3RSJA 3FJBA 1BFBA 3N7JA 3I29B 3OGGA 2FO1A 1AXMA 5EC5A 2DS0A 4I0YA 3UDAA 2HWAA 3O4CA 3PG0A 3BRGC 3V79C 2FDBM 5D63A 1IJTA 3V0AB 3E8LC 4A7KA 1I1BA 4IZEA 1FV2A 4P0JA 4F34A 3RTJB 4IHZA 3POKA 1BLAA 4QBVA 1AVUA 5E24E 3CRIA 2WRYA 2YUGA 1XG6A 4QD2C 3AH4A 4GOVA 3HOMA 1YXWA 3NJ5A 4EKXB 1GGPB 1F31A 1TWMA 3D7WB 1BFFA 2RQ9A 5F90A 1HCDA 3VT2A 4P0LA 3V0BA 1G82A 2Q9XA 1HWPB 3BAUA 3H6QA 5BXRA 3HMYA 3OJMA 4DEPA 2P39A 3HALA 9ILBA 2K4AB 1ISXA 4I3NA 4G1RA 3B9UA 4DCKC 4LO3C 3FJ9A 4GAFA 4G9NA 2E4MA 4GP0A 4QO3A 1V6XA 2AAIB 1S0BA 2BFHA 3CRHA 3CA5A 1JT4A 3VT0A 3ZC9A 2D22A 4EFQA 3NBNA 1BFCA 2VSAA 3UD9A 5BOWA 3O5WB 4ZA3B 2Z48A 3MALA 1JT7A 2K8RA 1YF8B 4I4RA 1JTCA 4LO1A 21BIA 5F8SA 4ZFYB 2LIEA 3N7LA 4I4QA 1CVSA 4X38A 2ZR1B 3FJ8A 3ZXDA 2HWMA 3FJCA 3BA5A 3CA4A 3BAGA 3O4OA 1YYNA 2NP0A 4J2KA 1PWAA 2WBCA 3H6RB 4LO7C 3NBCA 1Z2VA 3NBEA 4J23B 3UD7A 3P53A 3N7MA 5FNWA 3UD8A 3A22A 1ISZA 3A21A 1W3AA 1FGAA 4I1BA 5BP5C 7I1BA 4USPA 4ZGRB 2X2SA 3FJKA 3OJ2A 1S0GA 4I8MA 3WO2A 4OEGA 4ZOTA 3FUQA 1QXMA 2X2TA 3WO3A 1WD3A 4OUJA 4GAIA 41BIA 1II4A 1Q1UA 4CJMA 2R9KB 31BIA 1JQZA 2DREA 4LO3A 1Z4SA 3MPPG 3CU1B 2BEBA 3QR5A 4IY8A 3AKHA 4LO2C 1QQLA 1IRAX 4H75A 3OBRA 3IM7A 3P6IA 1W3FA 4Z9WB 4DENA 1QQKA 5BXPA 1PUMB 1HWOB 4PC4A 5BVPI 3R4UA 2VUAA 2XOAA 1CE7B 3FFZA 1TWEA 3BAOA 3VWCA 3RMYA 1T9FA 1HCEA 1AF9A 1G9DA 4I4OA 1FMMS 1AVWB 1ISVA 2Y9FA 3V0BB 1DFQA 4XFSA 1T4QA 4JAWA 4YOLA 3BAQA 2D23A 1RY7A 3FJIA 4Z8SB 3JUTA 4IONA 3TC2A 3WO4A 1S0FA 2KH2A 4IY9A 3AJ5A 1EPWA 2IWTB 2L5XA 5D61A 4A7YA 1MD6A 2VSEA 4D8HA 4F83A 1NZKA 3WINC 4I4UA 2HZ9A 3PUBA 1PC8B 3O3QA 1TIEA 3FJAA 1EYLA 2ZQNA 1SZ6B 2VXTI 4WBCA 1VCLA 5BP5A 1TTUA 3VUOA 3QYDA 2NS2A 3JRRA 3S8JA 4D0TA 2F8XC 1HIBA 2ET2A 3VEQA 1V6VA 2UUSA 4ZKTB 3CAHA 3EF2A 1AFCA 4QKSA 3HSMA 3WMVA 3FJJA 5EG6C 3ILAA 3AKIA 1L2HA 1FN0A 4HJJA 4ZLBB 4LO2A 4R6UB 4IQPA 3V0AA 4MZHA 4KEJA 4ZBVB 2P23A 4EFRA 2Y9XE 1HKNA 2ERMA 3AH1A 1AVAC 3WA1A 3BAVA 5DUYA 3O4DA 1EVTA 4OWKA 2AXMA 5F8WA 1IHKA 2QN4A 1JT5A 1R8NA 2KLLA 3FGMA 5DVHA 3T8SA 1BA7A 2NTDA 4I4PA 2VXRA 3H6SE 4JKQA 4H9WA 4ZFUB 6I1BA 4IZXA 1DJSB 3AJ6A 3S8KA 1YBIA 2KKIA 2QYIB 3BAHA 4X3AA 3CQAA 2MC2A 3K1XA 1HWNB 2D44A 1G9AA 1AVXB 1M2TB 3WINA 2VU9A 3UJ4A 3PHZA 2K43A 1Z0HA 1BFGA 4H04A 4OEEA 3BTAA 3O49A 4I4SA 1E0OA 4OW4A 1D0HA 1DZCA 3CA3A 3FJDA 1YTOA 4G9MA 4I6IA 4P6AA 4P0KA 4JQ0A 1ABRB 2MLLB 2Y9GA 2FFVA 3Q7XA 1J0SA 1IOBA 1WBAA 2GO2A 4ENDA 2AFGA 1DQOA 4FVVA 1IILA 4FGFA 2Q3NB 1FWUA 2M49A 4I2SA 3R4SA 1W3GA 4I96A 4XFTA 1DIWA 4MZFB 1G9CA 1JY0A 4I4XA 3OGFA 4J2XA 3VT1A 4JPZA 4A7ZA 3H6RA 3FJHA 4Q91A 5JMCA 1FV3A 3KMVA 1V6UA 4AN7B 4L4HA 4LO0C 2E4MC 2Z49A 5BXTA 1Q04A 4G6JA 1PUUB 1ILR1 2I1BA 1M16A 4XFUA 4LO8B 3IIRA 3N7KA 4QKRA 1S0DA 1WD4A 2DRZA 5BQUC 2HW9A 1BARA 2NM1A 1SR4C
chains in the Genus database with same CATH topology
1BASA 3VSZA 3AKGA 4X37A 3F1RA 5DSSB 3OBTA 1DLLA 4D0ZA 1Q03A 3VSFA 3RMXA 3ZC8A 1I1EA 3HN1A 3I2XA 3BRFA 1IRPA 3BADA 1ONKB 2KI6B 3AH2A 4JKXB 2FGFA 3FJEA 4I4VA 2F2FC 4KBBA 1XYFA 5HPZA 3SNVA 3WMUA 1PZZA 1WBCA 3CRGA 3P6JA 4J2SA 4JRAA 1FQ9A 5D62A 2RSTA 3O4AA 5F8YA 5G00A 3O44A 3IM6A 3ZXGA 1FWVA 2MIBA 1BLDA 1RMLA 2KI4A 2IHOA 3FUOA 2NVHA 4XKIA 2D24A 2ZQOA 1JLXA 2VLCA 1A8DA 2D7IA 2DRYA 1EV2A 1V6WA 1JLYA 1NUNA 4X39A 1DZDA 1S0EA 3Q7YA 4OEFA 4QD2B 1G9BA 3BRDA 3PMEA 4LO0A 1DQGA 1OQLB 3LTQA 2D20A 2RG9B 3ZX7A 3UJ0A 3Q7WA 4UY4A 2D1ZA 3CA6A 5FZUA 4ZFWB 3CA1A 3RTIB 1TP0A 1ISWA 3IAGC 8I1BA 5BQUA 1SR4A 1R8OA 3LLPA 1TOOA 2LIQA 1KNMA 4KEIA 4L4IA 4TLPA 5JLVA 3FJFA 4G6MA 1ISYA 4OWJA 4QBCA 3AKFA 1S0CA 1UPSA 3HBWA 3W9TA 1K5UA 4I7IA 4EB2B 5B2HA 4I1EA 1XZZA 4HA2A 2F2FA 1XHBA 4JP0A 1HWMB 4ISQA 5I1BA 3BA7A 4IYBA 5FZYA 3BX1C 4KC3A 5DZUA 1K5VA 2GZBA 3N0KA 2AQZA 4II0A 3AZWA 4Q9PA 2J3PA 1N4KA 2BEAA 4QC4A 4AN6A 4KEKA 5FZZA 2D43A 3F62B 3BA4A 1RZOB 4I4YA 2D7RA 4ISRA 1MC9A 3BB2A 1IT0A 3A07A 5GAQA 5FNXA 1ITBA 1RG8A 1P63A 4LO7B 5BXSA 2NZ9A 3CA0A 4MZGB 3IM5A 1FMZA 3NBDA 4HR6C 1JT3A 1TFMB 4QALA 3AZVA 4EFPA 2Y9WC 4USOA 3OJVA 4Q9GA 2FFUA 4I37A 2NYYA 3I2AA 3A23A 1DFCA 4OWLA 2ESUA 3C9ZA 4J2YA 3O4BA 4GOYA 5EHAA 4EEEB 4GP3A 1S0LA 4LO1C 3RSJA 3FJBA 1BFBA 3N7JA 3I29B 3OGGA 2FO1A 1AXMA 5EC5A 2DS0A 4I0YA 3UDAA 2HWAA 3O4CA 3PG0A 3BRGC 3V79C 2FDBM 5D63A 1IJTA 3V0AB 3E8LC 4A7KA 1I1BA 4IZEA 1FV2A 4P0JA 4F34A 3RTJB 4IHZA 3POKA 1BLAA 4QBVA 1AVUA 5E24E 3CRIA 2WRYA 2YUGA 1XG6A 4QD2C 3AH4A 4GOVA 3HOMA 1YXWA 3NJ5A 4EKXB 1GGPB 1F31A 1TWMA 3D7WB 1BFFA 2RQ9A 5F90A 1HCDA 3VT2A 4P0LA 3V0BA 1G82A 2Q9XA 1HWPB 3BAUA 3H6QA 5BXRA 3HMYA 3OJMA 4DEPA 2P39A 3HALA 9ILBA 2K4AB 1ISXA 4I3NA 4G1RA 3B9UA 4DCKC 4LO3C 3FJ9A 4GAFA 4G9NA 2E4MA 4GP0A 4QO3A 1V6XA 2AAIB 1S0BA 2BFHA 3CRHA 3CA5A 1JT4A 3VT0A 3ZC9A 2D22A 4EFQA 3NBNA 1BFCA 2VSAA 3UD9A 5BOWA 3O5WB 4ZA3B 2Z48A 3MALA 1JT7A 2K8RA 1YF8B 4I4RA 1JTCA 4LO1A 21BIA 5F8SA 4ZFYB 2LIEA 3N7LA 4I4QA 1CVSA 4X38A 2ZR1B 3FJ8A 3ZXDA 2HWMA 3FJCA 3BA5A 3CA4A 3BAGA 3O4OA 1YYNA 2NP0A 4J2KA 1PWAA 2WBCA 3H6RB 4LO7C 3NBCA 1Z2VA 3NBEA 4J23B 3UD7A 3P53A 3N7MA 5FNWA 3UD8A 3A22A 1ISZA 3A21A 1W3AA 1FGAA 4I1BA 5BP5C 7I1BA 4USPA 4ZGRB 2X2SA 3FJKA 3OJ2A 1S0GA 4I8MA 3WO2A 4OEGA 4ZOTA 3FUQA 1QXMA 2X2TA 3WO3A 1WD3A 4OUJA 4GAIA 41BIA 1II4A 1Q1UA 4CJMA 2R9KB 31BIA 1JQZA 2DREA 4LO3A 1Z4SA 3MPPG 3CU1B 2BEBA 3QR5A 4IY8A 3AKHA 4LO2C 1QQLA 1IRAX 4H75A 3OBRA 3IM7A 3P6IA 1W3FA 4Z9WB 4DENA 1QQKA 5BXPA 1PUMB 1HWOB 4PC4A 5BVPI 3R4UA 2VUAA 2XOAA 1CE7B 3FFZA 1TWEA 3BAOA 3VWCA 3RMYA 1T9FA 1HCEA 1AF9A 1G9DA 4I4OA 1FMMS 1AVWB 1ISVA 2Y9FA 3V0BB 1DFQA 4XFSA 1T4QA 4JAWA 4YOLA 3BAQA 2D23A 1RY7A 3FJIA 4Z8SB 3JUTA 4IONA 3TC2A 3WO4A 1S0FA 2KH2A 4IY9A 3AJ5A 1EPWA 2IWTB 2L5XA 5D61A 4A7YA 1MD6A 2VSEA 4D8HA 4F83A 1NZKA 3WINC 4I4UA 2HZ9A 3PUBA 1PC8B 3O3QA 1TIEA 3FJAA 1EYLA 2ZQNA 1SZ6B 2VXTI 4WBCA 1VCLA 5BP5A 1TTUA 3VUOA 3QYDA 2NS2A 3JRRA 3S8JA 4D0TA 2F8XC 1HIBA 2ET2A 3VEQA 1V6VA 2UUSA 4ZKTB 3CAHA 3EF2A 1AFCA 4QKSA 3HSMA 3WMVA 3FJJA 5EG6C 3ILAA 3AKIA 1L2HA 1FN0A 4HJJA 4ZLBB 4LO2A 4R6UB 4IQPA 3V0AA 4MZHA 4KEJA 4ZBVB 2P23A 4EFRA 2Y9XE 1HKNA 2ERMA 3AH1A 1AVAC 3WA1A 3BAVA 5DUYA 3O4DA 1EVTA 4OWKA 2AXMA 5F8WA 1IHKA 2QN4A 1JT5A 1R8NA 2KLLA 3FGMA 5DVHA 3T8SA 1BA7A 2NTDA 4I4PA 2VXRA 3H6SE 4JKQA 4H9WA 4ZFUB 6I1BA 4IZXA 1DJSB 3AJ6A 3S8KA 1YBIA 2KKIA 2QYIB 3BAHA 4X3AA 3CQAA 2MC2A 3K1XA 1HWNB 2D44A 1G9AA 1AVXB 1M2TB 3WINA 2VU9A 3UJ4A 3PHZA 2K43A 1Z0HA 1BFGA 4H04A 4OEEA 3BTAA 3O49A 4I4SA 1E0OA 4OW4A 1D0HA 1DZCA 3CA3A 3FJDA 1YTOA 4G9MA 4I6IA 4P6AA 4P0KA 4JQ0A 1ABRB 2MLLB 2Y9GA 2FFVA 3Q7XA 1J0SA 1IOBA 1WBAA 2GO2A 4ENDA 2AFGA 1DQOA 4FVVA 1IILA 4FGFA 2Q3NB 1FWUA 2M49A 4I2SA 3R4SA 1W3GA 4I96A 4XFTA 1DIWA 4MZFB 1G9CA 1JY0A 4I4XA 3OGFA 4J2XA 3VT1A 4JPZA 4A7ZA 3H6RA 3FJHA 4Q91A 5JMCA 1FV3A 3KMVA 1V6UA 4AN7B 4L4HA 4LO0C 2E4MC 2Z49A 5BXTA 1Q04A 4G6JA 1PUUB 1ILR1 2I1BA 1M16A 4XFUA 4LO8B 3IIRA 3N7KA 4QKRA 1S0DA 1WD4A 2DRZA 5BQUC 2HW9A 1BARA 2NM1A 1SR4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAS A;  3VSZ A;  3AKG A;  4X37 A;  3F1R A;  5DSS B;  3OBT A;  1DLL A;  4D0Z A;  1Q03 A;  3VSF A;  3RMX A;  3ZC8 A;  1I1E A;  3HN1 A;  3I2X A;  3BRF A;  1IRP A;  3BAD A;  1ONK B;  2KI6 B;  3AH2 A;  4JKX B;  2FGF A;  3FJE A;  4I4V A;  2F2F C;  4KBB A;  1XYF A;  5HPZ A;  3SNV A;  3WMU A;  1PZZ A;  1WBC A;  3CRG A;  3P6J A;  4J2S A;  4JRA A;  1FQ9 A;  5D62 A;  2RST A;  3O4A A;  5F8Y A;  5G00 A;  3O44 A;  3IM6 A;  3ZXG A;  1FWV A;  2MIB A;  1BLD A;  1RML A;  2KI4 A;  2IHO A;  3FUO A;  2NVH A;  4XKI A;  2D24 A;  2ZQO A;  1JLX A;  2VLC A;  1A8D A;  2D7I A;  2DRY A;  1EV2 A;  1V6W A;  1JLY A;  1NUN A;  4X39 A;  1DZD A;  1S0E A;  3Q7Y A;  4OEF A;  4QD2 B;  1G9B A;  3BRD A;  3PME A;  4LO0 A;  1DQG A;  1OQL B;  3LTQ A;  2D20 A;  2RG9 B;  3ZX7 A;  3UJ0 A;  3Q7W A;  2D1Z A;  3CA6 A;  5FZU A;  4ZFW B;  3CA1 A;  3RTI B;  1TP0 A;  1ISW A;  3IAG C;  8I1B A;  5BQU A;  1SR4 A;  1R8O A;  3LLP A;  1TOO A;  2LIQ A;  1KNM A;  4KEI A;  4L4I A;  4TLP A;  5JLV A;  3FJF A;  4G6M A;  1ISY A;  4OWJ A;  4QBC A;  3AKF A;  1S0C A;  1UPS A;  3HBW A;  3W9T A;  1K5U A;  4I7I A;  4EB2 B;  5B2H A;  4I1E A;  1XZZ A;  4HA2 A;  2F2F A;  1XHB A;  4JP0 A;  1HWM B;  4ISQ A;  5I1B A;  3BA7 A;  4IYB A;  5FZY A;  3BX1 C;  4KC3 A;  5DZU A;  1K5V A;  2GZB A;  3N0K A;  2AQZ A;  4II0 A;  3AZW A;  4Q9P A;  2J3P A;  1N4K A;  2BEA A;  4QC4 A;  4AN6 A;  4KEK A;  5FZZ A;  2D43 A;  3F62 B;  3BA4 A;  1RZO B;  4I4Y A;  2D7R A;  4ISR A;  1MC9 A;  3BB2 A;  1IT0 A;  3A07 A;  5GAQ A;  5FNX A;  1ITB A;  1RG8 A;  1P63 A;  4LO7 B;  5BXS A;  2NZ9 A;  3CA0 A;  3IM5 A;  1FMZ A;  3NBD A;  4HR6 C;  1JT3 A;  1TFM B;  4QAL A;  3AZV A;  4EFP A;  2Y9W C;  4USO A;  3OJV A;  4Q9G A;  2FFU A;  4I37 A;  2NYY A;  3I2A A;  3A23 A;  1DFC A;  4OWL A;  2ESU A;  3C9Z A;  4J2Y A;  3O4B A;  4GOY A;  5EHA A;  4EEE B;  4GP3 A;  1S0L A;  4LO1 C;  3RSJ A;  3FJB A;  1BFB A;  3N7J A;  3I29 B;  3OGG A;  2FO1 A;  1AXM A;  5EC5 A;  2DS0 A;  4I0Y A;  3UDA A;  2HWA A;  3O4C A;  3PG0 A;  3BRG C;  3V79 C;  2FDB M;  5D63 A;  1IJT A;  3V0A B;  3E8L C;  4A7K A;  1I1B A;  4IZE A;  1FV2 A;  4P0J A;  4F34 A;  3RTJ B;  4IHZ A;  3POK A;  1BLA A;  4QBV A;  1AVU A;  5E24 E;  3CRI A;  2WRY A;  2YUG A;  1XG6 A;  4QD2 C;  3AH4 A;  4GOV A;  3HOM A;  1YXW A;  3NJ5 A;  4EKX B;  1GGP B;  1F31 A;  1TWM A;  3D7W B;  1BFF A;  2RQ9 A;  5F90 A;  1HCD A;  3VT2 A;  4P0L A;  3V0B A;  1G82 A;  2Q9X A;  1HWP B;  3BAU A;  3H6Q A;  5BXR A;  3HMY A;  3OJM A;  4DEP A;  2P39 A;  3HAL A;  9ILB A;  2K4A B;  1ISX A;  4I3N A;  4G1R A;  3B9U A;  4DCK C;  4LO3 C;  3FJ9 A;  4GAF A;  4G9N A;  2E4M A;  4GP0 A;  4QO3 A;  1V6X A;  2AAI B;  1S0B A;  2BFH A;  3CRH A;  3CA5 A;  1JT4 A;  3VT0 A;  3ZC9 A;  2D22 A;  4EFQ A;  3NBN A;  1BFC A;  2VSA A;  3UD9 A;  5BOW A;  3O5W B;  4ZA3 B;  2Z48 A;  3MAL A;  1JT7 A;  2K8R A;  1YF8 B;  4I4R A;  1JTC A;  4LO1 A;  21BI A;  5F8S A;  4ZFY B;  2LIE A;  3N7L A;  4I4Q A;  1CVS A;  4X38 A;  2ZR1 B;  3FJ8 A;  3ZXD A;  2HWM A;  3FJC A;  3BA5 A;  3CA4 A;  3BAG A;  3O4O A;  1YYN A;  2NP0 A;  4J2K A;  1PWA A;  2WBC A;  3H6R B;  4LO7 C;  3NBC A;  1Z2V A;  3NBE A;  4J23 B;  3UD7 A;  3P53 A;  3N7M A;  5FNW A;  3UD8 A;  3A22 A;  1ISZ A;  3A21 A;  1W3A A;  1FGA A;  4I1B A;  5BP5 C;  7I1B A;  4USP A;  4ZGR B;  2X2S A;  3FJK A;  3OJ2 A;  1S0G A;  4I8M A;  3WO2 A;  4OEG A;  4ZOT A;  3FUQ A;  1QXM A;  2X2T A;  3WO3 A;  1WD3 A;  4OUJ A;  4GAI A;  41BI A;  1II4 A;  1Q1U A;  4CJM A;  2R9K B;  31BI A;  1JQZ A;  2DRE A;  4LO3 A;  1Z4S A;  3MPP G;  3CU1 B;  2BEB A;  3QR5 A;  4IY8 A;  3AKH A;  4LO2 C;  1QQL A;  1IRA X;  3OBR A;  3IM7 A;  3P6I A;  1W3F A;  4Z9W B;  4DEN A;  1QQK A;  5BXP A;  1PUM B;  1HWO B;  4PC4 A;  5BVP I;  3R4U A;  2VUA A;  2XOA A;  1CE7 B;  3FFZ A;  1TWE A;  3BAO A;  3VWC A;  3RMY A;  1T9F A;  1HCE A;  1AF9 A;  1G9D A;  4I4O A;  1FMM S;  1AVW B;  1ISV A;  2Y9F A;  3V0B B;  1DFQ A;  4XFS A;  1T4Q A;  4JAW A;  4YOL A;  3BAQ A;  2D23 A;  1RY7 A;  3FJI A;  4Z8S B;  3JUT A;  4ION A;  3TC2 A;  3WO4 A;  1S0F A;  2KH2 A;  4IY9 A;  3AJ5 A;  1EPW A;  2IWT B;  2L5X A;  5D61 A;  4A7Y A;  1MD6 A;  2VSE A;  4D8H A;  4F83 A;  1NZK A;  3WIN C;  4I4U A;  2HZ9 A;  3PUB A;  1PC8 B;  3O3Q A;  1TIE A;  3FJA A;  1EYL A;  2ZQN A;  1SZ6 B;  2VXT I;  4WBC A;  1VCL A;  5BP5 A;  1TTU A;  3VUO A;  3QYD A;  3JRR A;  3S8J A;  4D0T A;  2F8X C;  1HIB A;  2ET2 A;  3VEQ A;  1V6V A;  2UUS A;  4ZKT B;  3CAH A;  3EF2 A;  1AFC A;  4QKS A;  3HSM A;  3WMV A;  3FJJ A;  5EG6 C;  3ILA A;  3AKI A;  1L2H A;  1FN0 A;  4HJJ A;  4ZLB B;  4LO2 A;  4R6U B;  4IQP A;  3V0A A;  4KEJ A;  4ZBV B;  2P23 A;  4EFR A;  2Y9X E;  1HKN A;  2ERM A;  3AH1 A;  1AVA C;  3WA1 A;  3BAV A;  5DUY A;  3O4D A;  1EVT A;  4OWK A;  2AXM A;  5F8W A;  1IHK A;  2QN4 A;  1JT5 A;  1R8N A;  2KLL A;  3FGM A;  5DVH A;  3T8S A;  1BA7 A;  2NTD A;  4I4P A;  2VXR A;  3H6S E;  4JKQ A;  4H9W A;  4ZFU B;  6I1B A;  4IZX A;  1DJS B;  3AJ6 A;  3S8K A;  1YBI A;  2KKI A;  2QYI B;  3BAH A;  4X3A A;  3CQA A;  2MC2 A;  3K1X A;  1HWN B;  2D44 A;  1G9A A;  1AVX B;  1M2T B;  3WIN A;  2VU9 A;  3UJ4 A;  3PHZ A;  2K43 A;  1Z0H A;  1BFG A;  4H04 A;  4OEE A;  3BTA A;  3O49 A;  4I4S A;  1E0O A;  4OW4 A;  1D0H A;  1DZC A;  3CA3 A;  3FJD A;  1YTO A;  4G9M A;  4I6I A;  4P6A A;  4P0K A;  4JQ0 A;  1ABR B;  2MLL B;  2Y9G A;  2FFV A;  3Q7X A;  1J0S A;  1IOB A;  1WBA A;  2GO2 A;  4END A;  2AFG A;  1DQO A;  4FVV A;  1IIL A;  4FGF A;  2Q3N B;  1FWU A;  2M49 A;  4I2S A;  3R4S A;  1W3G A;  4I96 A;  4XFT A;  1DIW A;  1G9C A;  4J2X A;  1JY0 A;  4I4X A;  3OGF A;  3VT1 A;  4JPZ A;  4A7Z A;  3H6R A;  3FJH A;  4Q91 A;  5JMC A;  1FV3 A;  3KMV A;  1V6U A;  4AN7 B;  4L4H A;  4LO0 C;  2E4M C;  2Z49 A;  5BXT A;  1Q04 A;  4G6J A;  1PUU B;  1ILR 1;  2I1B A;  1M16 A;  4XFU A;  4LO8 B;  3IIR A;  3N7K A;  4QKR A;  1S0D A;  1WD4 A;  2DRZ A;  5BQU C;  2HW9 A;  1BAR A;  2NM1 A;  1SR4 C; 
#chains in the Genus database with same CATH topology
 1BAS A;  3VSZ A;  3AKG A;  4X37 A;  3F1R A;  5DSS B;  3OBT A;  1DLL A;  4D0Z A;  1Q03 A;  3VSF A;  3RMX A;  3ZC8 A;  1I1E A;  3HN1 A;  3I2X A;  3BRF A;  1IRP A;  3BAD A;  1ONK B;  2KI6 B;  3AH2 A;  4JKX B;  2FGF A;  3FJE A;  4I4V A;  2F2F C;  4KBB A;  1XYF A;  5HPZ A;  3SNV A;  3WMU A;  1PZZ A;  1WBC A;  3CRG A;  3P6J A;  4J2S A;  4JRA A;  1FQ9 A;  5D62 A;  2RST A;  3O4A A;  5F8Y A;  5G00 A;  3O44 A;  3IM6 A;  3ZXG A;  1FWV A;  2MIB A;  1BLD A;  1RML A;  2KI4 A;  2IHO A;  3FUO A;  2NVH A;  4XKI A;  2D24 A;  2ZQO A;  1JLX A;  2VLC A;  1A8D A;  2D7I A;  2DRY A;  1EV2 A;  1V6W A;  1JLY A;  1NUN A;  4X39 A;  1DZD A;  1S0E A;  3Q7Y A;  4OEF A;  4QD2 B;  1G9B A;  3BRD A;  3PME A;  4LO0 A;  1DQG A;  1OQL B;  3LTQ A;  2D20 A;  2RG9 B;  3ZX7 A;  3UJ0 A;  3Q7W A;  4UY4 A;  2D1Z A;  3CA6 A;  5FZU A;  4ZFW B;  3CA1 A;  3RTI B;  1TP0 A;  1ISW A;  3IAG C;  8I1B A;  5BQU A;  1SR4 A;  1R8O A;  3LLP A;  1TOO A;  2LIQ A;  1KNM A;  4KEI A;  4L4I A;  4TLP A;  5JLV A;  3FJF A;  4G6M A;  1ISY A;  4OWJ A;  4QBC A;  3AKF A;  1S0C A;  1UPS A;  3HBW A;  3W9T A;  1K5U A;  4I7I A;  4EB2 B;  5B2H A;  4I1E A;  1XZZ A;  4HA2 A;  2F2F A;  1XHB A;  4JP0 A;  1HWM B;  4ISQ A;  5I1B A;  3BA7 A;  4IYB A;  5FZY A;  3BX1 C;  4KC3 A;  5DZU A;  1K5V A;  2GZB A;  3N0K A;  2AQZ A;  4II0 A;  3AZW A;  4Q9P A;  2J3P A;  1N4K A;  2BEA A;  4QC4 A;  4AN6 A;  4KEK A;  5FZZ A;  2D43 A;  3F62 B;  3BA4 A;  1RZO B;  4I4Y A;  2D7R A;  4ISR A;  1MC9 A;  3BB2 A;  1IT0 A;  3A07 A;  5GAQ A;  5FNX A;  1ITB A;  1RG8 A;  1P63 A;  4LO7 B;  5BXS A;  2NZ9 A;  3CA0 A;  4MZG B;  3IM5 A;  1FMZ A;  3NBD A;  4HR6 C;  1JT3 A;  1TFM B;  4QAL A;  3AZV A;  4EFP A;  2Y9W C;  4USO A;  3OJV A;  4Q9G A;  2FFU A;  4I37 A;  2NYY A;  3I2A A;  3A23 A;  1DFC A;  4OWL A;  2ESU A;  3C9Z A;  4J2Y A;  3O4B A;  4GOY A;  5EHA A;  4EEE B;  4GP3 A;  1S0L A;  4LO1 C;  3RSJ A;  3FJB A;  1BFB A;  3N7J A;  3I29 B;  3OGG A;  2FO1 A;  1AXM A;  5EC5 A;  2DS0 A;  4I0Y A;  3UDA A;  2HWA A;  3O4C A;  3PG0 A;  3BRG C;  3V79 C;  2FDB M;  5D63 A;  1IJT A;  3V0A B;  3E8L C;  4A7K A;  1I1B A;  4IZE A;  1FV2 A;  4P0J A;  4F34 A;  3RTJ B;  4IHZ A;  3POK A;  1BLA A;  4QBV A;  1AVU A;  5E24 E;  3CRI A;  2WRY A;  2YUG A;  1XG6 A;  4QD2 C;  3AH4 A;  4GOV A;  3HOM A;  1YXW A;  3NJ5 A;  4EKX B;  1GGP B;  1F31 A;  1TWM A;  3D7W B;  1BFF A;  2RQ9 A;  5F90 A;  1HCD A;  3VT2 A;  4P0L A;  3V0B A;  1G82 A;  2Q9X A;  1HWP B;  3BAU A;  3H6Q A;  5BXR A;  3HMY A;  3OJM A;  4DEP A;  2P39 A;  3HAL A;  9ILB A;  2K4A B;  1ISX A;  4I3N A;  4G1R A;  3B9U A;  4DCK C;  4LO3 C;  3FJ9 A;  4GAF A;  4G9N A;  2E4M A;  4GP0 A;  4QO3 A;  1V6X A;  2AAI B;  1S0B A;  2BFH A;  3CRH A;  3CA5 A;  1JT4 A;  3VT0 A;  3ZC9 A;  2D22 A;  4EFQ A;  3NBN A;  1BFC A;  2VSA A;  3UD9 A;  5BOW A;  3O5W B;  4ZA3 B;  2Z48 A;  3MAL A;  1JT7 A;  2K8R A;  1YF8 B;  4I4R A;  1JTC A;  4LO1 A;  21BI A;  5F8S A;  4ZFY B;  2LIE A;  3N7L A;  4I4Q A;  1CVS A;  4X38 A;  2ZR1 B;  3FJ8 A;  3ZXD A;  2HWM A;  3FJC A;  3BA5 A;  3CA4 A;  3BAG A;  3O4O A;  1YYN A;  2NP0 A;  4J2K A;  1PWA A;  2WBC A;  3H6R B;  4LO7 C;  3NBC A;  1Z2V A;  3NBE A;  4J23 B;  3UD7 A;  3P53 A;  3N7M A;  5FNW A;  3UD8 A;  3A22 A;  1ISZ A;  3A21 A;  1W3A A;  1FGA A;  4I1B A;  5BP5 C;  7I1B A;  4USP A;  4ZGR B;  2X2S A;  3FJK A;  3OJ2 A;  1S0G A;  4I8M A;  3WO2 A;  4OEG A;  4ZOT A;  3FUQ A;  1QXM A;  2X2T A;  3WO3 A;  1WD3 A;  4OUJ A;  4GAI A;  41BI A;  1II4 A;  1Q1U A;  4CJM A;  2R9K B;  31BI A;  1JQZ A;  2DRE A;  4LO3 A;  1Z4S A;  3MPP G;  3CU1 B;  2BEB A;  3QR5 A;  4IY8 A;  3AKH A;  4LO2 C;  1QQL A;  1IRA X;  4H75 A;  3OBR A;  3IM7 A;  3P6I A;  1W3F A;  4Z9W B;  4DEN A;  1QQK A;  5BXP A;  1PUM B;  1HWO B;  4PC4 A;  5BVP I;  3R4U A;  2VUA A;  2XOA A;  1CE7 B;  3FFZ A;  1TWE A;  3BAO A;  3VWC A;  3RMY A;  1T9F A;  1HCE A;  1AF9 A;  1G9D A;  4I4O A;  1FMM S;  1AVW B;  1ISV A;  2Y9F A;  3V0B B;  1DFQ A;  4XFS A;  1T4Q A;  4JAW A;  4YOL A;  3BAQ A;  2D23 A;  1RY7 A;  3FJI A;  4Z8S B;  3JUT A;  4ION A;  3TC2 A;  3WO4 A;  1S0F A;  2KH2 A;  4IY9 A;  3AJ5 A;  1EPW A;  2IWT B;  2L5X A;  5D61 A;  4A7Y A;  1MD6 A;  2VSE A;  4D8H A;  4F83 A;  1NZK A;  3WIN C;  4I4U A;  2HZ9 A;  3PUB A;  1PC8 B;  3O3Q A;  1TIE A;  3FJA A;  1EYL A;  2ZQN A;  1SZ6 B;  2VXT I;  4WBC A;  1VCL A;  5BP5 A;  1TTU A;  3VUO A;  3QYD A;  2NS2 A;  3JRR A;  3S8J A;  4D0T A;  2F8X C;  1HIB A;  2ET2 A;  3VEQ A;  1V6V A;  2UUS A;  4ZKT B;  3CAH A;  3EF2 A;  1AFC A;  4QKS A;  3HSM A;  3WMV A;  3FJJ A;  5EG6 C;  3ILA A;  3AKI A;  1L2H A;  1FN0 A;  4HJJ A;  4ZLB B;  4LO2 A;  4R6U B;  4IQP A;  3V0A A;  4MZH A;  4KEJ A;  4ZBV B;  2P23 A;  4EFR A;  2Y9X E;  1HKN A;  2ERM A;  3AH1 A;  1AVA C;  3WA1 A;  3BAV A;  5DUY A;  3O4D A;  1EVT A;  4OWK A;  2AXM A;  5F8W A;  1IHK A;  2QN4 A;  1JT5 A;  1R8N A;  2KLL A;  3FGM A;  5DVH A;  3T8S A;  1BA7 A;  2NTD A;  4I4P A;  2VXR A;  3H6S E;  4JKQ A;  4H9W A;  4ZFU B;  6I1B A;  4IZX A;  1DJS B;  3AJ6 A;  3S8K A;  1YBI A;  2KKI A;  2QYI B;  3BAH A;  4X3A A;  3CQA A;  2MC2 A;  3K1X A;  1HWN B;  2D44 A;  1G9A A;  1AVX B;  1M2T B;  3WIN A;  2VU9 A;  3UJ4 A;  3PHZ A;  2K43 A;  1Z0H A;  1BFG A;  4H04 A;  4OEE A;  3BTA A;  3O49 A;  4I4S A;  1E0O A;  4OW4 A;  1D0H A;  1DZC A;  3CA3 A;  3FJD A;  1YTO A;  4G9M A;  4I6I A;  4P6A A;  4P0K A;  4JQ0 A;  1ABR B;  2MLL B;  2Y9G A;  2FFV A;  3Q7X A;  1J0S A;  1IOB A;  1WBA A;  2GO2 A;  4END A;  2AFG A;  1DQO A;  4FVV A;  1IIL A;  4FGF A;  2Q3N B;  1FWU A;  2M49 A;  4I2S A;  3R4S A;  1W3G A;  4I96 A;  4XFT A;  1DIW A;  4MZF B;  1G9C A;  1JY0 A;  4I4X A;  3OGF A;  4J2X A;  3VT1 A;  4JPZ A;  4A7Z A;  3H6R A;  3FJH A;  4Q91 A;  5JMC A;  1FV3 A;  3KMV A;  1V6U A;  4AN7 B;  4L4H A;  4LO0 C;  2E4M C;  2Z49 A;  5BXT A;  1Q04 A;  4G6J A;  1PUU B;  1ILR 1;  2I1B A;  1M16 A;  4XFU A;  4LO8 B;  3IIR A;  3N7K A;  4QKR A;  1S0D A;  1WD4 A;  2DRZ A;  5BQU C;  2HW9 A;  1BAR A;  2NM1 A;  1SR4 C; 
#chains in the Genus database with same CATH homology
 1BAS A;  3VSZ A;  3AKG A;  4X37 A;  3F1R A;  5DSS B;  3OBT A;  1DLL A;  4D0Z A;  1Q03 A;  3VSF A;  3RMX A;  3ZC8 A;  1I1E A;  3HN1 A;  3I2X A;  3BRF A;  1IRP A;  3BAD A;  1ONK B;  2KI6 B;  3AH2 A;  4JKX B;  2FGF A;  3FJE A;  4I4V A;  2F2F C;  4KBB A;  1XYF A;  5HPZ A;  3SNV A;  3WMU A;  1PZZ A;  1WBC A;  3CRG A;  3P6J A;  4J2S A;  4JRA A;  1FQ9 A;  5D62 A;  2RST A;  3O4A A;  5F8Y A;  5G00 A;  3O44 A;  3IM6 A;  3ZXG A;  1FWV A;  2MIB A;  1BLD A;  1RML A;  2KI4 A;  2IHO A;  3FUO A;  2NVH A;  4XKI A;  2D24 A;  2ZQO A;  1JLX A;  2VLC A;  1A8D A;  2D7I A;  2DRY A;  1EV2 A;  1V6W A;  1JLY A;  1NUN A;  4X39 A;  1DZD A;  1S0E A;  3Q7Y A;  4OEF A;  4QD2 B;  1G9B A;  3BRD A;  3PME A;  4LO0 A;  1DQG A;  1OQL B;  3LTQ A;  2D20 A;  2RG9 B;  3ZX7 A;  3UJ0 A;  3Q7W A;  4UY4 A;  2D1Z A;  3CA6 A;  5FZU A;  4ZFW B;  3CA1 A;  3RTI B;  1TP0 A;  1ISW A;  3IAG C;  8I1B A;  5BQU A;  1SR4 A;  1R8O A;  3LLP A;  1TOO A;  2LIQ A;  1KNM A;  4KEI A;  4L4I A;  4TLP A;  5JLV A;  3FJF A;  4G6M A;  1ISY A;  4OWJ A;  4QBC A;  3AKF A;  1S0C A;  1UPS A;  3HBW A;  3W9T A;  1K5U A;  4I7I A;  4EB2 B;  5B2H A;  4I1E A;  1XZZ A;  4HA2 A;  2F2F A;  1XHB A;  4JP0 A;  1HWM B;  4ISQ A;  5I1B A;  3BA7 A;  4IYB A;  5FZY A;  3BX1 C;  4KC3 A;  5DZU A;  1K5V A;  2GZB A;  3N0K A;  2AQZ A;  4II0 A;  3AZW A;  4Q9P A;  2J3P A;  1N4K A;  2BEA A;  4QC4 A;  4AN6 A;  4KEK A;  5FZZ A;  2D43 A;  3F62 B;  3BA4 A;  1RZO B;  4I4Y A;  2D7R A;  4ISR A;  1MC9 A;  3BB2 A;  1IT0 A;  3A07 A;  5GAQ A;  5FNX A;  1ITB A;  1RG8 A;  1P63 A;  4LO7 B;  5BXS A;  2NZ9 A;  3CA0 A;  4MZG B;  3IM5 A;  1FMZ A;  3NBD A;  4HR6 C;  1JT3 A;  1TFM B;  4QAL A;  3AZV A;  4EFP A;  2Y9W C;  4USO A;  3OJV A;  4Q9G A;  2FFU A;  4I37 A;  2NYY A;  3I2A A;  3A23 A;  1DFC A;  4OWL A;  2ESU A;  3C9Z A;  4J2Y A;  3O4B A;  4GOY A;  5EHA A;  4EEE B;  4GP3 A;  1S0L A;  4LO1 C;  3RSJ A;  3FJB A;  1BFB A;  3N7J A;  3I29 B;  3OGG A;  2FO1 A;  1AXM A;  5EC5 A;  2DS0 A;  4I0Y A;  3UDA A;  2HWA A;  3O4C A;  3PG0 A;  3BRG C;  3V79 C;  2FDB M;  5D63 A;  1IJT A;  3V0A B;  3E8L C;  4A7K A;  1I1B A;  4IZE A;  1FV2 A;  4P0J A;  4F34 A;  3RTJ B;  4IHZ A;  3POK A;  1BLA A;  4QBV A;  1AVU A;  5E24 E;  3CRI A;  2WRY A;  2YUG A;  1XG6 A;  4QD2 C;  3AH4 A;  4GOV A;  3HOM A;  1YXW A;  3NJ5 A;  4EKX B;  1GGP B;  1F31 A;  1TWM A;  3D7W B;  1BFF A;  2RQ9 A;  5F90 A;  1HCD A;  3VT2 A;  4P0L A;  3V0B A;  1G82 A;  2Q9X A;  1HWP B;  3BAU A;  3H6Q A;  5BXR A;  3HMY A;  3OJM A;  4DEP A;  2P39 A;  3HAL A;  9ILB A;  2K4A B;  1ISX A;  4I3N A;  4G1R A;  3B9U A;  4DCK C;  4LO3 C;  3FJ9 A;  4GAF A;  4G9N A;  2E4M A;  4GP0 A;  4QO3 A;  1V6X A;  2AAI B;  1S0B A;  2BFH A;  3CRH A;  3CA5 A;  1JT4 A;  3VT0 A;  3ZC9 A;  2D22 A;  4EFQ A;  3NBN A;  1BFC A;  2VSA A;  3UD9 A;  5BOW A;  3O5W B;  4ZA3 B;  2Z48 A;  3MAL A;  1JT7 A;  2K8R A;  1YF8 B;  4I4R A;  1JTC A;  4LO1 A;  21BI A;  5F8S A;  4ZFY B;  2LIE A;  3N7L A;  4I4Q A;  1CVS A;  4X38 A;  2ZR1 B;  3FJ8 A;  3ZXD A;  2HWM A;  3FJC A;  3BA5 A;  3CA4 A;  3BAG A;  3O4O A;  1YYN A;  2NP0 A;  4J2K A;  1PWA A;  2WBC A;  3H6R B;  4LO7 C;  3NBC A;  1Z2V A;  3NBE A;  4J23 B;  3UD7 A;  3P53 A;  3N7M A;  5FNW A;  3UD8 A;  3A22 A;  1ISZ A;  3A21 A;  1W3A A;  1FGA A;  4I1B A;  5BP5 C;  7I1B A;  4USP A;  4ZGR B;  2X2S A;  3FJK A;  3OJ2 A;  1S0G A;  4I8M A;  3WO2 A;  4OEG A;  4ZOT A;  3FUQ A;  1QXM A;  2X2T A;  3WO3 A;  1WD3 A;  4OUJ A;  4GAI A;  41BI A;  1II4 A;  1Q1U A;  4CJM A;  2R9K B;  31BI A;  1JQZ A;  2DRE A;  4LO3 A;  1Z4S A;  3MPP G;  3CU1 B;  2BEB A;  3QR5 A;  4IY8 A;  3AKH A;  4LO2 C;  1QQL A;  1IRA X;  4H75 A;  3OBR A;  3IM7 A;  3P6I A;  1W3F A;  4Z9W B;  4DEN A;  1QQK A;  5BXP A;  1PUM B;  1HWO B;  4PC4 A;  5BVP I;  3R4U A;  2VUA A;  2XOA A;  1CE7 B;  3FFZ A;  1TWE A;  3BAO A;  3VWC A;  3RMY A;  1T9F A;  1HCE A;  1AF9 A;  1G9D A;  4I4O A;  1FMM S;  1AVW B;  1ISV A;  2Y9F A;  3V0B B;  1DFQ A;  4XFS A;  1T4Q A;  4JAW A;  4YOL A;  3BAQ A;  2D23 A;  1RY7 A;  3FJI A;  4Z8S B;  3JUT A;  4ION A;  3TC2 A;  3WO4 A;  1S0F A;  2KH2 A;  4IY9 A;  3AJ5 A;  1EPW A;  2IWT B;  2L5X A;  5D61 A;  4A7Y A;  1MD6 A;  2VSE A;  4D8H A;  4F83 A;  1NZK A;  3WIN C;  4I4U A;  2HZ9 A;  3PUB A;  1PC8 B;  3O3Q A;  1TIE A;  3FJA A;  1EYL A;  2ZQN A;  1SZ6 B;  2VXT I;  4WBC A;  1VCL A;  5BP5 A;  1TTU A;  3VUO A;  3QYD A;  2NS2 A;  3JRR A;  3S8J A;  4D0T A;  2F8X C;  1HIB A;  2ET2 A;  3VEQ A;  1V6V A;  2UUS A;  4ZKT B;  3CAH A;  3EF2 A;  1AFC A;  4QKS A;  3HSM A;  3WMV A;  3FJJ A;  5EG6 C;  3ILA A;  3AKI A;  1L2H A;  1FN0 A;  4HJJ A;  4ZLB B;  4LO2 A;  4R6U B;  4IQP A;  3V0A A;  4MZH A;  4KEJ A;  4ZBV B;  2P23 A;  4EFR A;  2Y9X E;  1HKN A;  2ERM A;  3AH1 A;  1AVA C;  3WA1 A;  3BAV A;  5DUY A;  3O4D A;  1EVT A;  4OWK A;  2AXM A;  5F8W A;  1IHK A;  2QN4 A;  1JT5 A;  1R8N A;  2KLL A;  3FGM A;  5DVH A;  3T8S A;  1BA7 A;  2NTD A;  4I4P A;  2VXR A;  3H6S E;  4JKQ A;  4H9W A;  4ZFU B;  6I1B A;  4IZX A;  1DJS B;  3AJ6 A;  3S8K A;  1YBI A;  2KKI A;  2QYI B;  3BAH A;  4X3A A;  3CQA A;  2MC2 A;  3K1X A;  1HWN B;  2D44 A;  1G9A A;  1AVX B;  1M2T B;  3WIN A;  2VU9 A;  3UJ4 A;  3PHZ A;  2K43 A;  1Z0H A;  1BFG A;  4H04 A;  4OEE A;  3BTA A;  3O49 A;  4I4S A;  1E0O A;  4OW4 A;  1D0H A;  1DZC A;  3CA3 A;  3FJD A;  1YTO A;  4G9M A;  4I6I A;  4P6A A;  4P0K A;  4JQ0 A;  1ABR B;  2MLL B;  2Y9G A;  2FFV A;  3Q7X A;  1J0S A;  1IOB A;  1WBA A;  2GO2 A;  4END A;  2AFG A;  1DQO A;  4FVV A;  1IIL A;  4FGF A;  2Q3N B;  1FWU A;  2M49 A;  4I2S A;  3R4S A;  1W3G A;  4I96 A;  4XFT A;  1DIW A;  4MZF B;  1G9C A;  1JY0 A;  4I4X A;  3OGF A;  4J2X A;  3VT1 A;  4JPZ A;  4A7Z A;  3H6R A;  3FJH A;  4Q91 A;  5JMC A;  1FV3 A;  3KMV A;  1V6U A;  4AN7 B;  4L4H A;  4LO0 C;  2E4M C;  2Z49 A;  5BXT A;  1Q04 A;  4G6J A;  1PUU B;  1ILR 1;  2I1B A;  1M16 A;  4XFU A;  4LO8 B;  3IIR A;  3N7K A;  4QKR A;  1S0D A;  1WD4 A;  2DRZ A;  5BQU C;  2HW9 A;  1BAR A;  2NM1 A;  1SR4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...