221PA

Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEESYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of H-ras p21 mutants: molecular basis for their inability to function as signal switch molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
molecule keywords H-RAS P21 PROTEIN
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1991-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 221pA00
1PLLA 4HDCA 4DLTA 4PANA 1OIWA 4HZUA 4I1OA 5FPYA 4Q1BA 1R7RA 1S9HA 3QVVA 3GP8A 1YKSA 1D5CA 4QGFA 4NPHA 4XJXA 1W2HA 2ZPTX 2KBFA 4YMSA 2RB4A 3CRW1 5EE5B 3FGNA 1UBGA 1RW4A 4OK5A 1P7CA 2WMNB 3K9GA 3ZZ0A 1J2JA 1NVVQ 3FFAA 1OB5A 1YU9A 4HLQB 2FEOA 4DCNA 3EWSA 2ZREA 3DM9B 2D2EA 1SVKA 3I8SA 4PHFA 3SJZA 4C0QC 4TLCA 1OFTA 3FHCB 4Q9IA 1E0KA 2FN4A 4JVMA 1UDXA 2RGDA 5FTLA 4PQYA 1G3IA 2FWRA 3WY9A 1CXZA 1W0KD 3EPHA 1T5IA 1XP8A 1G5PA 2QRNA 2YINC 4TT3A 1L4UA 4DLUA 4WXRA 4URYR 3IBGA 3T5DA 2WKRA 4DHEA 2QSZA 1G1MA 2BWJA 1AGPA 3RAPR 3AVXA 1HT2E 1T4GA 2AK3A 1F2TA 2BMDA 4P0TA 1AS3A 1JR6A 3KFVA 4DKXA 2V9PA 4C30A 5KUTA 5C1BA 4Z51A 3P1JA 2XEXA 1BKDR 4XIGS 1DAIA 2DWQA 3B5JA 1A82A 1T8TA 1W5TA 3P4YA 2W6ID 3JVVA 4LRWA 4QBFA 3NTUA 2WVJA 5UKDA 2IXEA 1W49A 1XFAA 3KXKA 4P4TA 5B30A 3RS7A 3PXGA 1KK3A 2ZE6A 3ZVLA 4A15A 4TTPA 1W4AA 3CX6A 4AY2A 1KK2A 3CWZA 1BOFA 3BD9A 4I81A 2VHJA 2VSOA 1IXZA 2JLQA 5E4FA 3W90A 3GLIB 4LJ5A 1JR3E 2IWRA 1PJRA 2O8DA 4I1VA 5TV2A 5KO2A 1NIJA 4YDHB 1OYYA 2JDID 1EGAA 1II9A 2DR3A 1W0JD 1YR6A 3KKMA 1I4DD 3EPKA 2QSYA 5F9FA 3IHLA 1ZM4A 1Q22A 4MA4A 4A0GA 1W7AA 3X1XA 1CR2A 3PIRA 4R98A 2OE2A 4JYBA 3SOPA 3F0TA 4D82A 1YHNA 2PMDA 1ZIOA 4KFRA 4ZCLA 2G0TA 2PL3A 4TWZA 1WMSA 5EXTA 3SN6A 2J9RA 4MUAA 2CL0X 2FFHA 2OEPA 4ZKDA 1WCV1 3GD7A 5FFMA 1N0VC 3NXSA 4U00A 1R8QA 3L2OB 3GJ3A 1KO4A 4HZIA 1KI2A 2GILA 1EFUA 4JIMA 1LY1A 2QBYB 4LBYA 3GFPA 3OAAA 1D9XA 1WXQA 4TMZA 4BRWA 1ZNWA 1KI8A 3P32A 4B3XA 4B34A 2ATXA 1S9DA 1Z47A 2PLFA 2QAGB 4B44A 4HAWA 2F55A 1R8SA 3A4MA 1NBMD 4PSAA 4BZXA 5GVRA 4WIAA 1FUUA 5DN6A 1Z29A 1RIFA 3WP1B 3PFIA 3TIFA 2WIBA 3V4RA 1TMKA 3BIFA 3I3SR 3SYNA 1K6MA 4LX0A 4BQSA 1KI3A 2RH5A 4LHZA 3R7WB 5JJKA 4KITB 4KHZA 4LV5B 2GJSA 5AUPB 2ORIA 3EZ2A 4Q1AA 1UKEA 1F2UB 4CZ2A 5EXXA 4C9BA 1QDEA 1E6CA 2ZSAA 5KSZA 2YWFA 1Q1BA 1M34E 3K0FA 1G8PA 3A1WA 4HB4A 2BJVA 1WBDA 2XXAA 2YOHA 4YC7A 5KNBA 1E1QA 4UNPA 2FH5B 1SXJE 4BUJA 4QJ5A 4MGZR 1KDTA 2D2FA 2XOKA 3B2EA 2FG5A 3HR8A 3LLUA 2C2HA 3TNFA 4RJLA 2JLRA 2ZANA 1UDWA 4RKEA 2A5DA 3KDSE 1OLOA 4TMWA 2IUUA 1XXHE 3GLIE 4P32A 4PSVA 1E9DA 2H17A 1G6HA 5DE3A 1BO6A 1YVDA 3SNHA 2FGKA 4DCTA 5F2EA 2IXGA 1AA9A 4ILEA 4EQ6A 1DAEA 1FQJA 4C0LA 3BH0A 1NVXQ 3KQLA 2CXXA 2GA8A 1SULA 1VCIA 2WHXA 2H8KA 2Z5FA 4JLMA 1G7SA 1U90A 4GT1A 2NZ8A 2GCOB 3OE7D 1WQ1R 2ZTSA 3A1UA 2V4ZA 4YMVA 3FOZA 1E2GA 4QOSA 2IYRA 4DXAA 5JWRA 3R8FA 1OSNA 2BEKA 2RGAA 4KO8A 2QMEA 1GKUB 1CBUA 4G5QA 4Y0VA 1Z6GA 2IK8A 1ZRHA 4WW0A 4LPKA 1FMLA 3T15A 1G3MA 3KTAB 4LBZA 1BMFA 4HAUA 5JEEA 1N2CE 3E1SA 1GITA 1TUIA 1EX7A 1G18A 3FB4A 4H1UA 4TYQA 5JRZA 1VCMA 3AVUA 1W0KA 1X1SA 3Q3JB 3SC3A 1DELA 2ZSEA 4IDPA 3KUCA 1P3JA 3W3AA 4IEIA 4CEJA 4HAVA 3CM0A 1KYIA 4UNSA 2O0HA 3L8ZA 1DVRA 1G3QA 1XJ0A 2DFNA 2UKDA 3P26A 3RC3A 1CJKC 4JMPA 3C8UA 2WSSA 2ZEJA 3EW9A 4IDHA 1YZTA 3QIAA 2QP4A 5JMTA 3ADDA 2GJ9A 4ZV4A 3PQCA 4JKYA 1UPTA 2WJVA 3NBFA 3PCRB 4NCNA 2PT5A 2W0MA 4ZO4A 3WYAA 3TRFA 4AD8A 4YMTA 3BK7A 2IS4A 2AKAB 3QXXA 4ZIRB 5EE1A 1LTQA 3VX4A 5LD2B 2XAUA 2WJYA 3CLVA 4NH0A 3SYKA 4Q66C 3BC1A 3W8NA 1FTSA 1GWNA 4IDNA 2AL7A 2QE7D 2X8AA 5AJZA 1K5DA 2QAGC 3G5UA 1FX0B 1I4LD 1Z0IA 2GEUA 2VBCA 4PZZA 3X2SA 1NBME 4R71A 1HUQA 621PA 5KDDA 2C9CA 4ASUD 4ZI2A 1GSIA 1XPUA 1DAFA 4LHWA 2EW1A 1OHHD 3PVSA 3FMFA 4Q7LA 4C3ZA 3VKHA 1NI3A 5FUVA 1SXJC 3WYFA 3P4XA 2ZSFA 3K0EA 4PX9A 4Z1MD 4F7WA 3EA5A 4MGKR 3BXZA 4KLNA 2IEZA 4A2PA 1XPRA 1OH8A 4Q02A 5EUMA 2YC2C 4G1UC 4AIIA 1JBKA 2V7QD 3SI7A 5IK2D 3DMNA 2WWXA 2ZRGA 3QSYA 1OV4A 4J0QA 2VP6A 5FPHA 4TTRA 2I3BA 3W34A 1ESMA 4DUGA 1D9ZA 4OI0A 2WKPA 2Z83A 4FI3C 1RC8A 1KY2A 3QPUA 4R2IA 4D0GA 2EFHB 3Q72A 4DSOA 4HUQB 3L43A 4G5GA 4XTRA 1MR3F 2RKOA 1SQ5A 3FYHA 2VP4A 3LVQE 5B57C 1UBEA 1JPJA 4DSNA 2IYVA 2VEDA 2OUKA 2HYIC 4UXJA 2HJVA 3DKPA 2ZRCA 2KSQA 1W47A 2FPLA 1OKKA 1VG0B 2PH1A 2ZI7A 3QPWA 4DSUA 4PR0A 1Q44A 4KI0A 3MRSA 5J47A 1OKKD 4I1SA 4PXAA 4RZ3A 3QKUA 5DSZA 4B6FA 5GADl 1KJZA 4C2UA 3D8BA 4HYYA 2E9SA 2QT1A 2FSGA 5DIFA 3U7GA 4IOLA 3IIKA 1Q3TA 2VP2A 4B3FX 1IXSB 5FUXA 4BFWA 1D2MA 5DI3B 5KTYA 4ON9A 1R5BA 2Q0HA 3A37A 2HV8A 3QKSA 4HLUA 2O8CB 4OQXA 4RD0A 3TQFA 2OBNA 1QBKC 1LS1A 3AUYA 5KU1A 1GOTA 4QBGB 2BEJA 3BGWA 1XB2A 3LBNA 4ACAA 3A1TA 1Q20A 1UKYA 5EQTA 2GXQA 4URUR 1UFQA 1Y63A 3SEAA 2ZIAA 5GJVC 1R2QA 5FBQB 2J46A 2QT0A 2ZROA 3I72A 5EE0A 4BLSA 5KPDA 2CNWD 2NZJA 4MDEA 3M1IA 5EP1A 3THYA 3AVYA 3VR3A 1ZC4A 4M53A 4Q21A 1OH5A 3SJBA 1E9FA 1QVAA 5TARA 4C0BA 4HLUC 1XBTA 2GETA 1XTRA 5AJYA 2A5FA 4JL8A 4M9SA 1JAHA 1VYTA 1XD8A 3KQHA 1OH7A 3R9IA 3Q7PA 1OIVA 5JLJA 1IXRC 1T3HA 2C9YA 3B78A 3PITA 2H5EA 4Q4LA 1MO5A 3ND9A 2FZ4A 4V0LA 2QM8A 2UZ3A 3GFTA 2QU8A 3IO3A 1F3OA 4TSFA 3DOFA 4QHSA 2J59A 4M1SA 3MSXA 3CF6R 3LO5A 5FOSA 4ZI3A 2ONKA 4TSFD 2OZEA 1NN0A 4KBFA 2O8EB 4GP7A 5KDOA 2ZSDA 3W6PA 1XWIA 5JCZA 2ZS8A 1US8B 2WSMA 2XZOA 1KSGA 4D4LA 5HZHA 1E9CA 2WPDA 4CEHA 1G5TA 2X19A 3CNOA 3T35A 3ZYCA 2EVWX 4KSBA 1XEXB 2EQBA 3TVDA 3QXJA 3IILA 3MWJA 3NHBA 1S0UA 3QPVA 3V4FA 3TUIC 1SZPA 5KNCA 4Q1EA 1UBFA 5FOUA 3AVWA 4FMBB 1JQLB 5ELXA 1XJQA 2Q3MA 3LDAA 5B64A 4IKEA 1EX6A 2VHQA 5DYIA 1KAOA 4W5HA 2CLDX 1ZYUA 3HJNA 4IFBA 3DEFA 4O0MA 4Q4JB 4Q03A 1J99A 5DI3A 4JYCA 4LI0A 2NGRA 2IEYA 3W8RA 4BLTA 2HLDA 4U5XA 1N6LA 4W7SA 4MRVA 4F92B 4B71A 1ZVQA 3UMFA 2XZLA 4PC2A 2XGJA 5EE3A 4QM7A 4FMDF 4JBYA 3VHXA 4DDUA 2QG6A 1FL9A 5KHOC 1T3LA 2EWWA 4ZIRA 4MYUA 5BYJA 4V0OA 1S3GA 1H8EA 5FTKA 1G9XA 5H70A 5C18A 3L82B 3AF4A 3LQRA 1XZPA 1VHTA 4P4SA 1KMQA 2Y8EA 1GVNB 2CJWB 3PG5A 4E03A 1ONBA 1R10A 3CNNA 4RZ2A 3SJAA 4Z54A 4URVR 4DDTA 3C15C 3ADCA 3MLEA 2G0NA 3NC1C 2IS6A 1E1QD 3TSZA 3QXHA 1OFUX 2J3EA 1XTQA 1A4RA 4KYIB 5EUQB 2OLJA 2KWIA 4LJYA 3EA0A 3WP0A 2NIPA 2NMVA 4K81B 3F5FA 3SJCA 4DB4A 5SZJA 3VR4A 4NU0A 1PV4A 1VCNA 1U8YA 3KQUA 1D2NA 2W0SA 3GEHA 2ZYVX 3EC1A 3K1JA 4FMCF 4TTQA 3CB4A 3K0AB 1IBRA 1KI6A 5FTMA 1E2IA 3LW8A 2WBLC 2HJGA 4MITA 4CIDA 3RDPA 1BYUA 1P2TA 1YZNA 5EXPA 5C46F 2P5TB 4Q7KA 3KJIA 4PZLA 3NH6A 2DBYA 4QKQA 2JIZA 3MGCA 4HAYA 1NY6A 3AV0B 1TF5A 2G9NA 5HPYB 3FPAA 2WIAA 1JECA 1OXXK 2BOVA 1EWRA 1LV7A 2C5LA 2JLWA 1U9IA 3UMSA 4D26A 2FGJA 1JEEA 5LD2C 1RYFA 1HA3A 1COWD 3GLIA 4D4KA 3GLFA 5TXGA 4BECA 4Q9JA 4IHQA 1Q1EA 4TL6A 1XF9A 3BBPA 4FMDB 3S1AA 3KX2A 2F3RA 2IX3A 4W5JA 4G5SA 3U4QA 2P67A 1GKYA 4II7A 2ZR9A 5L3QB 2PX3A 3IBYA 5E3HA 4O3MA 2YV5A 3I4LA 1OB2A 1ZAKA 1YZGA 2ZRJA 3OEED 4HLDA 4LOAA 2FV8A 2QPTA 3AF3A 3U3KA 4DCSA 4IVQA 4WAUA 4CEJB 4G0NA 3A4LA 721PA 4LJ9A 4OQFA 1OXVA 1ZUNB 1TUEA 2J1LA 3LW7A 5D3MB 5DH9A 2JLXA 3NH9A 3U7HB 1WF3A 1JNYA 3IPYA 1FW6A 5EP2A 4A82A 3O8BA 1FUKA 4MRRA 4PC7A 3U3RA 4RY2A 1DEKA 1E79D 4BFZA 3BH7A 4NYJQ 2DFLA 2D7CA 2REOA 2OXCA 1P62B 5FPSA 2DYKA 1Z0AA 3KJGA 2QPOA 3CIOA 4JLJA 3PEWA 2ZI9A 2ZXUA 1OHHA 2UZIR 3FVQA 4MRPA 4PPNA 4LYHA 4JSYA 3QG1A 2H16A 3GLFB 3GLHB 1SXJB 2F9LA 2BM1A 3KKPA 1N6HA 2WWWA 3OEHD 3QF4B 4OHWA 3RVBA 3B1ZA 1Z22A 2JEOA 2C03A 1S4QA 2QMHA 3B1YA 1IY0A 4N1AA 1G17A 4NHOA 4NL4H 1GNPA 3TSOA 4BEJA 5JRJA 3RSLA 2ZI6A 4X8HA 3K09C 1WRBA 4EQ6B 1W2GA 4G5RA 4RD4A 1AZSC 1N6NA 1IN4A 4PPQA 3X1YA 5JHHB 1CEEA 4W9MC 4M1TA 3SU8A 1DG3A 1W36B 4JT2A 1KI6B 4BRUA 1SKQA 3NWJA 4E09A 3QKTA 4OKSA 1ZD1A 1CLUA 1K5GA 5G3ZA 3GLGE 1A1VA 3AH8A 1U99A 2GCPA 4M8NE 4NP6A 4U02A 3T1OA 5DGXA 4ZCMA 4WBSA 1MRNA 5FTJA 2J87A 2N46A 5AJWA 3AVOA 1ESNA 2ATVA 1VG1A 2CLSA 3NBZC 5FI1B 1SHZA 1NL3A 1FP6A 3EC2A 4GL2A 1RRCA 4XD7D 2JASA 3PJRA 5KPJA 1OPXA 3U6KA 4FW9A 1MH1A 4O2LA 1NSFA 1AZTA 1GL6A 2A3RA 2A7QA 3QBTA 4F91B 1IOZA 4EJSC 3VKGA 5A4JA 2ZI3A 3EIQA 4KJZA 4YMUA 4DIDA 1W36C 3ZJYA 1TQ4A 3LXRA 4UNRA 4PC6A 3K70B 3CF0A 1RRPA 1P6XA 5AK0A 2YZ2A 2FSFA 3R9XA 4QL3A 4FCWA 2IWHA 5BN5A 4TZ0A 3Q5EA 3GJ6A 2HF9A 1EFCA 4JLDA 3N2IA 5C4MA 3ETLA 4D4JA 2WWHA 2VHCA 4PO9A 2ODWA 3B8HA 3SDZA 1FMJA 1E2NA 2IBMA 4NYIQ 4JLVA 4DLYA 5EP4A 3RS3A 1TTTA 1AJEA 1AIPA 4L4UA 1NSTA 5CLLA 5L3RA 2CVHA 2GBLA 2LKCA 2N1BA 2JLYA 1GAJA 2CVFA 4DDVA 3KZ1E 4Q00A 3GPLA 1OT3A 2RMKA 3THWA 5FI0B 2R9VA 3L0OA 4ZDWA 2PJZA 4M1OA 5H1YA 1G7RA 4N0DA 3CR7A 4QHTA 1T8UA 4A92A 4FMCB 4EIWA 4OJKA 4ACBA 1KK0A 4Q7MB 3OIWA 3E5HA 4XSHA 1ZNYA 121PA 1LF5A 1QHIA 1XDBA 4B3CA 2QQ0A 2RCNA 3ONWA 4D81A 3CO5A 1E1RD 1P60A 1KKLA 1QF9A 5C4GB 1WDTA 5F98A 1LNZA 4BE7B 3BORA 3CKLA 3FHTA 3EZ9A 4PC1A 4RZUA 5F3WB 1SKYE 2P6RA 1X8LA 3PR1A 4N3NA 4UXIA 1E0AA 5IT5A 3TLXA 1BH2A 3CRMA 1NN5A 4GP6A 4UNNA 2R62A 3EPLA 5LBIA 4C0AC 3THXB 1PVOA 1U0HC 4S2EA 2IC5A 4OYHA 3RRNA 5JSZA 2FE4A 3MCAA 2AK2A 4Q7JB 4G01B 2CJWA 1W4BA 2EYUA 2IYQA 5CB6A 3OHMA 5JBQA 1GG2A 2C96A 2VYFA 5JFGA 1OF1A 2ZE5A 2OHFA 3EG5A 4NYIR 4EPYA 2V3CC 2C77A 3WBJA 2XNDA 2CBZA 1CJVC 2FSIA 4UNQA 1F48A 2CNWA 3B60A 1CR1A 3CBQA 4A8JC 2CCGA 1ZNXA 4C0HA 1UADA 2GKSA 2RGCA 2DWPA 3QOFA 2IT1A 1CR4A 4URWR 1OIXA 3K70C 4OI4A 2OAP1 2WWFA 2X2FA 3SE0A 1A2KC 4LC1A 4BFYA 1X86B 3CH5A 1N5KA 4LPSA 4CDGA 3VKWA 3AVQA 4YXWA 4ARZB 5JI3E 2O5VA 4CRWB 5LB4A 1B23P 3KB1A 2O8CA 2ZE8A 1SVSA 3IEUA 1ZM2A 4JL6A 4PAMA 2JJ1D 2FX3A 2K5UA 1S2MA 5CITA 2GXSA 4PO8A 3ZS8A 1N6OA 4DEXA 2GWHA 2JDIA 4A2QA 2VP9A 1QHHA 5CK4A 1N6IA 3I5XA 1KMHA 3HU2A 4PTLA 2HT6A 4OHVA 5FBWB 2JLZA 4NYMQ 1EWQA 2R65A 2VL7A 1NLYA 3HP1A 3FHOA 3CPJB 2C99A 2HXSA 5SZKB 3CNLA 4L9SA 4JVLA 3ZQ6A 3LA6A 3I62A 4OHYA 1DAHA 4IOMA 5FH9A 1HURA 3CPHA 2WSSD 1MKYA 2ZJBA 2VH5R 5FOWA 3VHLB 2QN6A 1I4TD 2DB3A 2BMFA 3BFKA 4B3GA 2MMGA 2A5JA 4FXPA 3Q85A 2NTYC 1GRRA 2W58A 4GBMA 2F43B 4MYHA 3ZDQA 3BAFA 3LFUA 3GJ5A 3HU1A 2CL7X 2ZU6A 3QNUA 3A4NA 1RPZA 3BB4A 3TAHA 5JI2E 1DG1G 3FFBA 2BM0A 1E9SA 4V0NA 5DO9A 4BPBA 1XZQA 1KSJA 4GZMA 1ZCBA 1GTVA 2F43A 1RRFA 5GJCA 3SFZA 5B2ZA 1RZ3A 2F1IA 2QE7A 2QI9C 3OIUA 5P21A 4XTCS 4Y0AA 1YR8A 4EPWA 3DO6A 5F9HA 5CYOA 1KZ7B 4BLRA 3U44A 5HCIA 1XMJA 2GCOA 1U81A 2YKGA 2QZ4A 2BMJA 1NG1A 2L0XA 3FMIA 4B2LA 3LX5A 1IQPA 1Z0JA 2ZS7A 4NONA 3ZVMA 2GF9A 3CR8A 3QY0A 5CJPA 5AJXA 4W5WA 3B7GA 3N2EA 4RKFA 3UATA 1P2SA 3FMOB 1T91A 1Y3AA 1HEIA 2V6IA 2VHTA 2ZRDA 4RCZA 2IL1A 4X8OA 3X1WA 4AKEA 2QL6A 2WTUA 2O0JA 2YOGA 3KQNA 3NVAA 3OEEA 2RHMA 2JJ2A 3TGPA 3VNUA 2VRWA 2XZPA 3MJHA 4HDOB 2BBOA 1MO6A 4M4SA 3DMDA 5FL7D 4FCTA 2IF0A 3TKLA 4F93B 2VHUA 4P3YA 4IOJA 3PUWA 4B2PA 1ZUIA 1KJYA 2DFTA 1FX0A 1XD9A 3AVVA 1G7TA 1FFHA 5FOVA 4JLOA 5E7IA 1Z0DA 3NIBA 3WRYC 3GJ7A 2FOLA 1A5TA 3AGPA 4K8OA 3SBEA 3RWOA 3GJXC 1US8A 1AS0A 2ZR7A 5D3QA 2JLSA 4LZZA 4XWAA 1VMAA 3CX8A 3EZ7A 4C7OB 1WBBA 4E07A 2H57A 1F5NA 3Q7QA 1XD2A 1NBMA 3DZDA 3LD9A 1PLJA 1IN8A 2IYLD 4HATA 4ZCIA 2PMKA 5JWOA 1QHNA 1KOFA 2JIZD 3ZIAD 4I4LA 3TMKA 1XEWX 3BFVA 2R6DA 5DI9A 4QGGA 3W9YA 4UQOA 1EFHA 4B43A 1DAMA 4KFUA 1NMZA 3BH6A 4OQNA 4TMXA 4UJ3A 2VTKA 5K8IA 1R6BX 4ABYA 5J5CA 2QUZA 3PUYA 1C9KA 4B32A 4AI6A 1JALA 1KMHB 2WMOB 4JS0A 1V5WA 2QBYA 2OG2A 4KVGA 4F4CA 4AC9A 3G82C 5CYPA 3U7EB 3QF7A 3F3YA 4NCJA 3OFNA 3LBIA 4EFMA 4IDQA 4NCIA 4EJSB 3NC0C 1KNXA 3QXCA 2G3YA 3ECCA 3L0PA 3Q8XB 2B8TA 2KI5A 4D80A 4MKHA 1ZINA 5FTNA 1YZLA 2PJRA 3IO5A 4QC2A 2G83A 1UBCA 3TH5A 2J41A 3R8CA 1DAKA 4E5UA 2JGNA 1Z0FA 1G3RA 1E2EA 3K0CC 1XXHB 3A8TA 2IHBA 1VECA 4FWTA 2CDNA 3DOEA 3O47A 4JLPA 3PUVA 4MGIR 4UJ5A 5TDHA 3C7KA 2ERYA 4GOKA 1F2UA 2FZLA 4B2IA 1I2MA 2QRZA 2JJ1A 4L16A 4I99A 3OE7A 3SZRA 4PFSA 1X8JA 5TVKA 1GNRA 221PA 3NBXX 1E2MA 2NO7A 3MAAC 2H1LA 4HB0A 1KO1A 4MKFA 1QZXA 2RAPA 1XEWY 4QFMA 3RWMB 3J81k 3GLGB 1NVVR 1IJFA 2ZJZA 5JEDA 3IEVA 2XNSA 2FFBA 1RE0A 2YWHA 4TMVA 4M1KA 3L0SA 3E2IA 2VPPA 4C0KA 3K9HA 2CE2X 3BRWD 3B85A 5LB2A 5AUOB 4TT3D 3RNLA 3DKVA 2D4HA 2BIFA 2G77B 4IVPA 3QEOA 1XTSA 1MOZA 4Q01A 1J7KA 1GRNA 2B7CA 1ZD8A 3ZZTA 2QMOA 1T3SA 1X3SA 4R9UC 4BZQA 2FSHA 4LBWA 4Q19A 3RC8A 2GAOA 2GJ8A 4QBIA 1MV5A 4YQFA 1P75A 2AWOA 3X1DA 1G291 4TLDA 1VTKA 2IYTA 1NNEA 2Q9AA 1Z6YA 2VO1A 1MT0A 1Q57A 4KLZA 3ZD6A 1AQYA 1Z2AA 3C14C 4PZYA 4HB3A 2QGNA 2C98A 2HCBA 3VAAA 4QM6A 4XD7A 1E2HA 4XVUA 4B73A 3U5ZB 3P20A 3PEYA 1DO0A 3AB3A 5AR1A 4BWYA 3PENA 2XTZA 5AUNB 1GKIA 2AFIE 4OI1A 4BLQA 1CJTC 4CT5A 1Q12A 4V03A 4OBEA 1Z6TA 2I1VB 3QENA 1TQ2A 5B58C 3LQQA 1GIAA 1KAGA 2VF7A 3GEIA 4EUNA 2ZUDA 1HQYE 2NO1A 3RRZA 5JZVA 3ZGXA 4DB2A 1R5OA 1LF0A 4EPVA 1BIFA 1NG9A 3K0FB 4WVFA 5J4LA 4OI2A 5FPKA 5K8TA 3SYLA 1PLKA 2ZQ5A 4AG5A 3C5CA 3T61A 2AHOA 3QKRB 1LS6A 1XTJA 5CIQA 3B82A 1D8TA 2IUSA 2B7BA 4LJ6A 4B6EA 2BBTA 3JZAA 4OL0A 3HU3A 2V1XA 1S1MA 1HE1C 4IOKA 4HUQA 4F4IA 1UAAA 1PUJA 2C95A 2GDJA 4X8LA 4EPTA 2G6BA 1Q1ZA 2Q9CA 5BN4A 5JCPA 1MO4A 1Z06A 1RJ9B 1IN7A 1G5RA 4DT1A 4A0FA 3CPEA 2W2TA 3Q9LA 3TW4A 1LVGA 1M8PA 3BFXA 4KVAA 4CVNA 2J45A 3PEUA 3FKQA 2ZJYA 4M1MA 1S3SA 2G88A 3A36A 3ADKA 4A0RA 1VDZA 5CB8A 4C2TA 3UG6A 1MABA 4IFEA 1DAGA 1R5NA 2CHGA 2C8VA 3HWSA 1CTQA 8OHMA 4ZPXA 4BZPA 5L3VA 5BN3A 2GF0A 3M0EA 3C4JA 2IYSA 5JS7A 2LWIA 1G4AE 3QUSA 1T5LA 3MWKA 4H9GA 2G1JA 2XITA 3KKOA 1G16A 3DPUA 4LYJA 4EJSA 2CCJA 1D6JA 1XU4A 2FA9A 2NQ2C 4M9ZA 2KE5A 2IUTA 2B21A 4C0JA 5J4YA 3SQWA 4WA7A 2OAQ1 2HF8A 1COWA 2GCNA 3TVTA 4PAOA 2D3WA 2ZM5A 3NBYC 4NBSA 2OBLA 1RYHA 2H7VA 1T0JB 3GQBA 2J0UA 4A6XA 1VG8A 4M1WA 3D3QA 3R20A 421PA 4S35A 4XVRA 1XTKA 4TYWA 2LCFA 3TE6A 4IW3B 1XNJA 3ZVNA 2IF2A 2P6NA 1CJUC 2C9OA 1AM4D 1TQ6A 4POAA 4RCYA 3GLFE 1PZNA 4JZKA 4WZ6A 1Z8FA 1UEIA 2E1RA 4I1UA 1SHKA 4FD2A 2RGNA 5DNYB 2IW3A 3LX8A 5JSZB 2HDNB 2ZJOA 1RRGA 2R2AA 3UMRA 1H8HA 2V54A 1JPNA 4OK6A 3U3MA 4NCKA 1N6RA 2A30A 1GL7A 2GK7A 2REXB 1SGWA 3AVPA 3SHFA 1IHUA 2O8FB 2BMEA 1JXOA 4L8GA 2WKQA 1Q3HA 2QEQA 4LV8B 4RFSB 3MWYW 4KV9A 2F1JA 4BFVA 1Q1QA 4ZDJA 3THYB 1KO8A 1SVIA 4DZZA 4BLPA 2WWYA 1QRAA 3UANA 2BV3A 1KZGB 5BXQC 2RGXA 3TSWA 2QPAA 1WE2A 3IDQA 1OFHA 1ZU5A 2GEDA 1ZCAA 2P65A 1NIPA 3U3JA 1E2KA 4DCUA 2P5SA 2W00A 3G0HA 2QA5A 3AVTA 1ZM3A 1W4CA 3C41J 2CHVA 4IXMA 3GLHA 3L8YA 4IVRA 3THWB 2ZSBA 1OYWA 2PT7A 1J8YF 2JATA 2X2EA 2XB4A 3SR0A 4XWKA 2ZETA 2ZR0A 1GM5A 2W6IA 1AK2A 3A1SA 1N5LA 1QHGA 2YHSA 1XEXA 1NKTA 4A8JB 3IQXA 4ASUA 3HPQA 4YONB 5BW8A 4PHHA 3TUZC 1KI9A 1WB9A 4ARZA 4EAQA 3ICQB 4JJKA 2OBMA 4D0LB 2BKEA 3QEJA 4BFSA 1ZW6A 1U9IC 2QENA 4Q9HA 2ZRBA 3WHLA 3W6OA 2OFOA 3E70C 2WWGA 4GFDA 4LYFA 1E2LA 2GZAA 2PEZA 4Q4AA 2PCLA 1WA5A 3B1XA 4P4UA 4Q1FA 4AYTA 4GI7A 4CGZA 1F2TB 1UEJA 4NCHA 2IXFA 4WZBE 1II8A 4DEYA 5HZKA 1TX4B 2NG1A 2BJWA 4LJ8A 4RD2A 1R4AA 1IM2A 2NOAA 3V9PA 2QP9X 4US1R 3RS0A 4TZ6A 4ESVA 2HEIA 3CONA 5JJLA 3EZ6A 4TQAA 4DLRA 2XSZD 2QTVB 1OFIA 2QY9A 4QJ4A 3U60B 4L15A 1E9EA 3KKQA 5CM8B 3TUJC 4A0HA 5KSOA 2J5XA 4XOIA 4GMDA 2Q9BA 2ERXA 4IEEA 2I4IA 3AF1A 2IYYA 2GBLC 2R8RA 4LJ7A 4LV6A 4ERNA 3O8CA 2O8BA 2QTHA 3GJ8A 1TNDA 4RSGA 1KK1A 4M22A 3NKVA 3ZLJA 4QNRA 3FDIA 3H0KA 4LYAA 2AXNA 4LY6A 4ZDIA 2DCUA 3CW2A 1GFIA 1E9AA 2YNMA 2XJ9A 1KI1A 3AGQA 2PBRA 3H1TA 4DCVA 4V0ME 4DSTA 5HE9A 2ORVA 2YYZA 2IS2A 1B0UA 3DHWC 4A1FA 3IIJA 3OF5A 2GTPA 2GXAA 3U44B 5EJEA 1KDRA 1S8FA 3KL4A 4KU4A 3B9QA 5FBLB 3TR0A 4QBHA 4HZUB 4MGYR 2OESA 4BLOA 4WOPA 1SVMA 3ZQJA 2RGGA 1F60A 2QAJA 2J7PA 4B3DA 5IDVA 4AURA 1Z07A 4TQUS 2ZRMA 2YC4C 3GLGA 1SKYB 4PO1A 2HUPA 1NLZA 1OJLA 4HSEA 2ZJ8A 1NF3A 3FMPB 3GCGA 3Q5DA 3KB2A 1QG2A 4LGMA 1AS2A 1AQUA 2PEYA 4MYTA 3WMGA 1IONA 2FEMA 5J4VA 1L8QA 3LY5A 5IRCD 1E2FA 4US2R 2JA1A 1OXUA 2Z4SA 3WNBA 2DFKB 3SS8A 1Q0UA 1HV8A 5HTKA 2YJTD 1NJGA 2VA8A 3AP1A 1G8HA 1ODFA 3EZFA 5KOYA 3LNCA 4JLNA 1CP2A 5HKKD 3RHFA 2E87A 4GPTA 5FUYA 2W6JD 1ZJ6A 2OCYC 1EG7A 3K09A 1SVLA 1T0HB 4YXWD 3CZPA 4DWJA 2ZUBA 1RFLA 4TYYA 4MYCA 1BYIA 1N6KA 4FCVA 2QTFA 1JB1A 4B33A 2GZHA 4AYXA 4EDHA 1Z0KA 1FOEB 1VG9B 2B6HA 3QQ5A 4M0LA 5J4KA 2GNOA 5KSPA 5FL3A 1CULC 3AKCA 3LVRE 3FKSD 1E69A 4B47A 2VLIA 3O8DA 2D62A 2AWNA 3MJRA 3OZXA 1P9WA 3RS2A 2PCJA 3WMFA 5IK2A 3N5CA 1R0XA 1E9BA 2HCJB 3VR5A 4MRSA 1NVUQ 1FZQA 1YZKA 1Z2CA 1DADA 4QHYA 4B48A 3B9PA 1ZNZA 3D7MA 1XCGB 1DTSA 1KHTA 2Z43A 1NP6A 4NDZA 3WMEA 5A5GA 4AG6A 1U0LA 1T6NA 1YZQA 1TL7C 2OFXA 3DVLA 4TMKA 5D3MA 3VU9B 5TMPA 2O8EA 3HDTA 1HT1E 2AR7A 2REBA 1ETUA 2IYWA 1E4YA 2YVUA 4HAXA 1HQCA 2RHDA 3IKJA 4JSTA 1OH6A 3KXIA 3TJZA 5LDDC 1HH4A 1H8ED 3IPXA 4DLXA 3ZVRA 1KIMA 1KSFX 3GMTA 3WHKA 4WXPA 2WJIA 4JJZA 1XX6A 3VR1A 1Z5ZA 1NMXA 1YR7A 1AKEA 2F9MA 3LH5A 4HAZA 1EESA 2P3SA 2NO9A 1KO5A 4YMWA 4RD1A 4A9AA 2V1UA 1JAIA 1JEDA 5FBVB 3ND8A 4OQLA 4TLBA 2JJ8A 4TL9A 4DUGD 1P2VA 1XXHA 3N70A 2IYUA 2ZRIA 3I61A 1EFRD 2F1RA 4GSYA 3K8YA 3LAWA 2GVZC 2GRJA 3WNCA 2NO6A 3OIVA 1DOAA 2VIIA 1I2DA 2V8OA 2W83A 1DBSA 1W48A 4BEBA 3K70D 2ODBA 4BGDA 1N25A 2PZGA 1QHHB 3LV8A 5DHAA 5H68A 4M21A 2J0QA 2EYQA 4LSGA 5HCNA 3PUZA 3EIHA 2GJKA 3OESA 1JJVA 4DLVA 4JLAA 5JHGB 4V0MA 3THOA 2XXAB 3JVUA 2QNRA 4QXAA 3IHWA 5EZ6B 2GVDC 3UWOA 4NMMA 1VPLA 1FTNA 1SXJA 3QF4A 2Z4RA 4M9QA 4GZLA 3EPJA 1E98A 2ZS9A 1Z3IX 2CEAA 4AYWA 1N3BA 4Q1CA 3ADBA 4F38A 2A5GA 2A78A 3ZS9A 3AM1A 2ZRAA 3I73A 4WZAE 3W3ZB 4LUCA 3AKYA 3I32A 2CK3A 3IIMA 3QKRA 5M04A 2ANCA 3FE2A 3U2QA 2BCGY 2ECKA 3THXA 2ZI5A 2XTMA 4Q47A 3BB3A 3IGFA 1J8MF 3VMFA 1P4SA 2Q6TA 4C7OA 4EFLA 4JBXA 5DLQC 1E2QA 2ZITA 4JVSB 1DE0A 3WBKA 1XMIA 2ZRPA 2AX4A 5GJBA 4MQBA 2FPKA 4L5BA 4M1YA 4CW7A 1ZU4A 2EU8A 1CKEA 3KXLA 3OFND 4CF7A 2BBSA 2WOOA 3GJ4A 1OW3B 1TPZA 2LKDA 4G5OA 4D6PA 1FNMA 4NTZA 4B75A 1HE8B 2HT1A 2HLDD 1TEVA 3UPUA 4TL7A 3PEVA 2ZYWX 3MWLA 2A2ZA 2GJAA 4Q9LA 5G40A 1YE8A 2SHKA 3CRRA 2WM9B 3QG5A 4Z8YA 5AJVB 3W5IA 4A2WA 2WWIA 1NVWQ 3AF0A 1ANKA 1FNNA 4ZKEA 3EAQA 2GESA 2ASEA 1W5SA 5FOTA 5CJ2A 3W6NA 4U7DA 1M7HA 3RYTC 3SBDA 2OLKA 4L9WA 1PUIA 3VFDA 1R0ZA 4Q1DA 1XEFA 4C0SA 1G7CA 2DWOA 5KYKA 1YRBA 3R9WA 3NEYA 5SZHB 4KXFB 4TQ9A 1W1WA 4PAQA 2CL6X 2R6FA 6Q21A 1G21E 1W36D 4LJAA 1ELOA 2XB2A 1W0JA 2CHQA 3B1VA 2P6UA 3T5GA 5FR2A 2WJGA 3QE0A 5G41A 1QG4A 4BASA 5FL7A 1RJ9A 4DT1B 5L3SA 1G8FA 1TADA 5FR1A 4BFXA 1M7BA 5CIWA 3MG9A 1C1YA 1KO7A 4QJ3A 3CUEF 4MKIA 1MABB 1KTVA 4Q18A 1TQDA 4RD6A 2J0SA 2QP3A 3RLFA 1GUAA 3KJEA 5GJWC 1KGDA 1AKYA 2Q21A 2FJUA 3A1VA 3MMPA 4GOXA 2X1VA 2P2LA 1E1RA 4P33A 1DARA 2WICA 4CT4B 2CE7A 3AQ4A 1XCPA 3OAAD 5AUQA 3ASYA 4DLZA 1X8KA 3UG7A 4DDWA 3TAUA 3S1AB 1ZP6A 3VTKA 2WOJA 1W46A 3AKDA 3UXMA 2OCAA 3KUDA 4HUTA 2D74A 1E0SA 4B76A 2J0UB 821PA 4PC3A 1HY3A 4ITRC 3TQCA 3CX7A 2F1HA 3GFOA 3BOSA 4UXHA 3AP3A 1XRJA 2R6AA 4OK3A 3TR5A 2ZJ2A 2ZRLA 3I92A 5IHPA 3LRPA 2AN9A 2KBEA 3T1QA 2BVNA 1XMSA 2EFEB 2Q3HA 1LW7A 4GNKA 2XNDD 2MSEB 5TB5A 1K8RA 5EE9A 3V00A 5AWFC 1ZC3A 2XOKD 2V55B 3AUXA 4RFSA 1VYUA 2O8BB 2W2XA 3DM5A 3CRQA 1MRSA 3RSOA 1CRPA 4M9XA 5L8VA 3RABA 1R0WA 1E2PA 4JLBA 4AK9A 2GZDA 5HKKA 4CEIA 1XPOA 4KCGA 1N0UA 1RVDA 4Q9KA 3BWDD 4PPGA 1IN6A 3EIEA 1YJ5A 1WP9A 2HYDA 4NYMR 2ANBA 4DVGA 4V02A 3U61B 1U8AA 4OHZA 3MD0A 2IA5A 4LK2A 4LWZA 2GHIA 3ZIAA 4KAXA 4KYUA 2R44A 4AKIA 5DYGA 4CEIB 2WAXA 5CK5A 2BHRA 2IHYA 4NZYA 5JWHA 4DIEA 1SXJD 5JJIA 1TF2A 2OILA 1GDDA 3F8TA 2HXYA 2ONJA 3X1ZA 2ZJ5A 4EKDA 4D25A 1TF7A 1O3YA 1ZM9A 2A5YB 1XCMA 2QAGA 3K9NA 1N5IA 4LJ4A 4TN1A 4A36A 1Z6AA 1O87A 1YQTA 3KQKA 1CRQA 4OHXA 4Q4AB 3ASZA 1BS1A 2P0EA 4LCBA 3REFA 4B3BA 4TYNA 1QHXA 4O25A 3RS4A 1CF4A 1P9NA 1MO3A 2W2VA 2WPDD 4DBLC 1VIYA 2F3TA 1E3MA 2EFCB 4IRUB 1N0WA 4N0EA 3K0SA 3H84A 5G3YA 4XH9B 2VP5A 2DY1A 4ZDKA 2OCBA 2ODEA 3NDPA 2B92A 3AEZA 3HPRA 3QXSA 5FUWA 5E7MA 1KSHA 4FWIB 3ZD7A 2W6JA 4Q4HB 3GLHE 2UVQA 4HI0E 1AN0A 4B74A 1M1YE 2VSXA 1VYVA 4QRHA 2ZU0C 3JZMA 1P5ZB 2JLUA 4QG7A 2R6GA 4GOJA 4PQFA 1YR9A 4URZR 1GZSA 1H8HD 1JR3D 5BQ5A 3VNVA 1Z08A 1ZBDA 1XJCA 3R7WA 4GDFA 1SVOA 2NPIA 2OCPA 3SFVA 2OFWA 1JR3A 1D2EA 2OV2A 1NY5A 4RD3A 5BYKA 1KY3A 1KJWA 4Q5IA 1P72A 3NEJA 2F7SA 2V7QA 1E99A 2AFHE 2BDTA 1IY2A 4Z1MA 5CDFA 1BMFD 5C2JB 1M2OB 2VP0A 5CLQA 3TW8B 5FPTA 2H92A 3CRVA 4DLSA 1E0JA 1ZD9A 1LFDB 2QMUA 4TLAA 3FKSA 4X8MA 2D7DA 1AGRA 4R2HA 2G1KA 2N42A 1CS4C 4QGAA 4ESHA 4LHVA 4LDJA 2QORA 1E9RA 3O8RA 3K9LA 3KKNA 3TBKA 4KODA 3KTAA 3FWYA 3EX7C 2FPMA 3RANA 1GP2A 2AKYA 3NDBB 5FBRB 1L2TA 1A2BA 4LHYA 4US0R 3A6PC 3ICEA 2WZQA 4K46A 3U3OA 4HB2A 4KFTA 1J90A 2ZRHA 1EK0A 1YRAA 4PQRA 3T1VA 3CF2A 3FTQA 3I8XA 4JL5A 2VQSA 2EWVA 3BJIC 1G41A 3QKSB 4LHXA 3DDCA 2XJ4A 2C78A 2Z6VA 4RVCA 3CWQA 4CYMA 3GJ0A 3SQXA 3IQWA 4M2LA 2D06A 4NE2A 3UK6A 1KKMA 2YWEA 4YDSA 1IY1A 3HYRA 3LWNA 2CK3D 2ORWA 3LXXA 1FPMA 3NHAA 4GRAA 2ZAMA 4MUBA 1U94A 1UJ2A 2IYZA 2ZRFA 4LBVA 4CEHB 3K0AA 2RGBA 2RGNC 4PSKA 1CIPA 4G3XA 3RRYA 1ZM7A 3VR6A 5K8LA 4O2RA 2O8FA 3K0CA 4MH0R 2RGEA 2JJ2D 3WRXC 4PHTA 3LLMA 5DHFA 1TU3A 2H18A 5SZIA 3WXMA 5EZ5A 3AKEA 2AD1A 4A4DA 4JKIA 1Z28A 4BFTA 2FNAA 1RKBA 4C4PA 1KNQA 2X77A 1P61B 1NJFA 3MFYA 4A6PA 3DZ8A 3DL0A 2XTNA 1GNQA 2GAAA 1NLFA 5KSYA 4IDOA 3QI2A 1L7VC 2BC9A 2ODNA 1G8GA 4D2IA 1N5JA 4EFNA 2V6JA 3T34A 1Z63A 1NKSA 4OJQA 4F4JA 1EFTA 3EARA 2YOFA 1E32A 2BCJQ 2TMKA 2WV9A 3M4YA 3RS5A 1Q21A 1OXSC 4GMXA 5BWMA 3U4QB 4AKGA 4FN5A 2WAYA 3BB1A 1X1RA 1M7GA 2OO7A 4UKDA 2EFDB 5J4HA 1W44A 1E79A 2ZVPX 3OEHA 1E2DA 1E4VA 3EWAA 3VU9A 4Q4HA 2J0VA 1JQJC 1E94E 3C5HA 4TL8A 1JI0A 2ZJAA 2GXUA 1LB1B 3C16C 1P2UA 1P73A 3H4MA 1W4RA 1F6BA 4D0NA 2XX3A 5IF9A 1DPFA 4QNMA 4HLCA 5JECA 4FINA 3BE4A 2QM7A 4DC9A 4EPRA 2OXRA 4E22A 3EXAA 3M6AA 3I1FA 3BS4A 1ZUHA 3AF2A 3TK1A 3UKDA 3WNDA 3VQTA 1VCOA 4XWOA 1UF9A 1UM8A 1U2RA 1CR0A 2BKUA 2VSFA 2A9KA 2J7PD 1S96A 1G19A 4YLGA 3UWKA 1IN5A 2J7KA 1G6OA 3T1TA 2ZI4A 5CM9C 1R0YA 1QVRA 3VX3A 1HYQA 4EPXA 1FQKA 3WYGA 4KBGA 5GVSA 2CCKA 1M74A 2JAQA 5DISB 2AD5A 2FDCA 1NMYA 3UIEA 4RZXA 4RFVA 3P27A 2Z0MA 3CZQA 5CDFE 1L4YA 1JXMA 3QBVA 2IS1A 4IJMA 4Z8XA 3REGA 1N6PA 4HDQB 1OXTA 5A0FA 3VR2A 2YWGA 1ZIPA 2BBWA 1II8B 1P9RA 3A58B 1G20E 2FFAA 2PZEA 1CJMA 4MRNA 1G64A 2FF7A 2R6CA 4PHGA 4D4MA 5EP3A 4DRZA 2ZYTX 2NPFA 4HEJA 5L3SB 1Z83A 4P4SB 1KI4A 2F6RA 3PUXA 2JCSA 5ANRB 4JLKA 5JS8A 2MSDB 4XSGA 1YZUA 3B1WA 2ZRNA 1OE0A 4JT4A 2OT3B 2ZE7A 1H65A 1M6NA 1FP7A 2ZVQX 3HR7A 3D31A 4KSCA 3U7FB 5H8WA 1U8ZA 5KDLA 3HYTA 5G53C 3PV0A 5HE8A 3LBHA 3H2YA 1HTWA 5L3QA 2CLCX 2WJHA 5E95A 5HR5A 3AP2A 3ZZUA 4V0KA 5K8UA 4B35A 1TEXA 4DLWA 1E96A 3B6EA 4NYJR 1G8YA 2XSZA 4QGHA 2Q3FA 2AXPA 1KDPA 2PX0A 1DS6A 4Q4JA 1T9HA 1XTIA 3ZH9B 4P31A 2QGZA 1NN1A 4TYPA 1JJ7A 4XVQA 1G4UR 4AKHA 1IJEA 3QJYA 4MKGA 4NKRA 1J70A 2GEVA 4KFSA 1CU1A 3CH4B 1E2JA 1KI7A 2MSCB 5J40A 5LPNA 2C04A 1UKZA 3QVUA 2QROA 3T12A 2FMXA 2O0KA 5EXSA 2CMKA 1GL9B 2ZUCA 2O8DB 1VHLA 1XMVA 2PLRA 4JBWA 5TY0A 4JVNA 2DHRA 2MMCA 2OM2A 3MUFA 3RRMA 4H1VA 4Q48A 1GILA 3EASA 521PA 1TAGA 4FIDA 2QQEA 1II0A 1QHSA 1S1CA 2B8WA 1C4OA 2ZAOA 2ZRKA 4MDFA 1QHYA 2O52A 3IUYA 1NN3A 4TLEA 5DN6D 4PPFA 2WJJA 1EXMA 1SVWA 4LC0A 2FFQA 3I5YA 1IAQA 1DO2A 4OQMA 1Z6XA 4URXR 3L0IB 3GEEA 4BFUA 1ZMXA 1TU4A 1U98A 1U0JA 1V43A 2ZYUX 5E7JA 1KDOA 1EFRA 1XD2B 3D6TB 2NO0A 4DJTA 3H86A 1VIAA 2DPXA 3KJHA 3K53A 4R7ZA 3T06B 5KNDA 2KB0A 4TMTA 5FOXA 4AWXA 2I1QA 2KJQA 2PZFA 2OSBA 3NG1A 2EFGA 2FU5C 3BERA 3OIYA 2VF8A 3B13B 3SHWA 3U6BA 1GRQA 1X6VA 1G3UA 1NRJB 4IXNA 2JLVA 2GK6A 1VKJA 3KFXA 1UKVY 2IYXA 3W5JA 4A8JA 1A7JA
chains in the Genus database with same CATH superfamily
5D3KA 3VZSA 3RV3A 4HDCA 1EWVA 1MAAA 2AG1A 3MS7A 4KXWA 1XVIA 4QVKA 4UHCA 4IH1A 3FMVA 1S2NA 4N0MA 5ESRA 3D4NA 3ZHSA 1S9HA 4PG6A 2P5YA 4MEBA 1D5CA 3VYVA 4UARA 2WHQA 3G5MA 1W2HA 3QYJA 2R97A 2FDRA 1EUDA 3O31A 3VH1A 3TOCA 4FYJA 3RBXA 1JDUA 1KVQA 2IELA 5FLXA 3FFAA 5IEJA 3FCSB 1O0CA 3R23A 1TUBA 3AFOA 4FBGA 1YIDA 3RVMA 3QK7A 4DCNA 1T1SA 4YPOA 2D2EA 3ZEIA 1MRZA 2C54A 3I8SA 3LP8A 3O73A 4MA0A 3SJZA 4TLCA 1TIKA 1NQUA 5JXJA 4U3JB 1KMIY 5LP1A 4Q9IA 3TIXB 4FWBA 3LQ4A 2JB9A 3VOAA 2FWRA 2HIHA 3ZY5A 1LDNA 1RYNA 2CLLB 3G68A 4BP1A 5LKRA 4C07A 3EPHA 2V65A 3OH8A 3RBAA 1T5IA 4DC0A 5L4SA 3M5WA 1M6VA 3BFJA 4DLUA 1J0BA 4KQMA 5DX8A 3IBGA 3T5DA 4KPYA 2QLJA 1Z2EA 4ARVA 4OHBA 3ZLJA 1G1MA 3EZNA 4I9FA 1WB4A 1RAIA 1HT2E 2BMDA 1C7ZA 1F2TA 1JHRA 4KXNA 4P0TA 1S02A 3BD7A 3TTXA 4YP0A 4DKXA 3MWDA 2V9PA 2LRHA 5FYQA 3MIZA 5JAZA 1NBOA 5C1BA 3P1JA 1IWOA 3Q9SA 2FZEA 4IIDA 1AC5A 2JBWA 2XWBF 4WE3A 1AKWA 3AT1A 3AHDA 3GA5A 5FWYA 4NARA 3F71A 5JZBA 1I94B 4QOJA 5CB4F 5FV7A 4H0CA 2W6ID 5I8PA 1V35A 4LRWA 3ENWA 1B76A 1R6UA 2WVGA 3FH0A 3CVUA 5UKDA 1U7DA 4C3UA 3E9EA 3DC2A 3TZKA 4JAVC 3RYHB 4D8XA 4M37A 3K5PA 4LRQA 5D5QA 3RS7A 1Y3HA 3PXGA 1KK3A 2ZE6A 4FNOA 2IE0A 2X6TA 3WRVA 3CX6A 5A1JA 3DPIA 4MUFA 4A15A 1KK2A 1V9LA 3CWZA 3JSXA 1SCIA 1GTG1 1KJ9A 3RQIA 4CLXA 3ORRA 1NM5A 1I1HA 5DBFA 2VSOA 1IXZA 2JLQA 4MVWA 1IZZA 4LJ5A 1Q50A 4EVIA 3EEQA 2ZRQA 1PJRA 5F12A 2V5VA 3R5XA 5TV2A 5BOSA 4BV9A 3RYIB 4YDHB 5IDWA 5KO2A 2JDID 2YQZA 1EGAA 4IV0A 2RAUA 4TV8B 5LIRA 2PH5A 1FJHA 1I4DD 3KKMA 3PDHA 4C88A 1XDGA 5F9FA 2XCTB 2YMLA 5ALIA 4MA4A 1NOJA 1Z88A 3X1XA 4R98A 2IDMA 3JASB 4K05A 2OE2A 4KWTA 4G24A 2IEBA 4JLUA 1HLFA 4D82A 1XK6A 2HNBA 4NOMA 1VMKA 2WFAA 2H7YA 4ZCLA 4TWZA 5A71A 4DQUA 5EXTA 3TLJA 1WDWB 3G9XA 3IHKA 4ZFNA 4IP0A 2FFHA 1KFJB 2DKFA 5FFMA 3NXSA 4U00A 1POWA 3U9LA 1NQXA 2OKCA 3BMCA 4J03A 2OD2A 1CUSA 4RVFA 1KO4A 4HZIA 3REQA 1LDBA 4D9IA 1D4AA 3A06A 4JXJA 1EFUA 2YDYA 2YTZA 5IH3A 5ALMA 4LBYA 2XCUA 1FU7A 2BUBA 3IS3A 3OAAA 2MSLA 2XXAA 4BRWA 4PZAA 3DKIA 3GF4A 1PNRA 4UAUA 3H5LA 2Q1WA 4LOJA 2ATXA 4MR8B 3EFBA 3WOHA 2PLFA 4ZVOA 5JNWA 4PLTA 1X1QA 3ZY4A 2VDLB 1CUUA 2F55A 4QUBA 1NBMD 2EX1A 4RLQA 1UMCB 3I05A 1FUUA 1KQFA 5DN6A 1Z29A 4LSZA 3RUDA 5AOBA 3OPMA 4NZMA 1R4MA 2RCYA 3E9RA 3OZTA 3PFIA 3LQFA 1U3TA 2LTAA 1MXHA 1T13A 1TMKA 1CUGA 3BIFA 5FLKA 1K6MA 3HI6A 2G76A 4REOA 1KI3A 4Z3OA 1P81A 4NVRA 4KHZA 2GJSA 1XHLA 1E8DA 4BGDA 2ORIA 3QUBA 3EZ2A 1PQ4A 1U9CA 1WAMA 1CQIA 3FPFA 1TM7E 3D0OA 4NOKA 2WWVD 2L82A 5AVZA 1M34E 5FHQA 1R1DA 2AV6A 4BO7A 1RCFA 2BJVA 2XA1A 3FGOA 5C34B 2VPXA 1KE1A 5FI3A 3WIEA 1E1QA 1HPLA 1IIRA 4G84A 1KE2A 1QX3A 2O2IA 1RTTA 5KNBA 3U56A 3JYQA 1DBPA 1G21B 1KDTA 1ZK0A 2D2FA 3CIFA 4WCDA 1UP6A 3VH3A 4XA8A 2IIQA 3HR8A 3LLUA 2C2HA 3PJDA 4CFSA 1KDZA 4RJLA 2BRUC 2JLRA 1UDWA 1M2WA 1ZKMA 1RBZA 2A5DA 2QVCA 1PSWA 2ZKLA 3DWFA 1OLOA 3BT7A 4O2AB 2AW5A 3BL5A 2IUUA 3OA0A 3BD6A 4NV0A 3EHDA 3DLTA 4P32A 2FOIA 4PSVA 3TTVA 1N3IA 4G8DA 3SNHA 3FN4A 5F2EA 1AA9A 5EEHA 1DAEA 4WNCA 4DJJA 1PS0A 2HAEA 3BH0A 3H5RA 2XT0A 2GA8A 4HQLA 3ZV5A 2FXIA 3FPCA 1TYEB 4I9GA 4REQA 1DFIA 1ICIA 2I2CA 4LRSB 1JS1X 2Z5GA 3OE7D 4JITA 4JYZA 3HHPA 5DGCA 3HM9A 1L5FA 3AI1A 5T64A 2V4ZA 3CKMA 4N49A 4ZQGA 4ALNA 2QD2A 3FOZA 2YBEA 3SBOA 1TYCA 2IYRA 2BEKA 2VRCD 2QMEA 4IHJA 2APJA 3F47A 4ABTA 2IH4A 2V7UA 1FMLA 3T15A 4KRFA 2YMPA 4LBZA 4R84A 1BMFA 4U2GA 3QPAA 1PZGA 3NWEA 4HAUA 1PYDA 1RM3A 3H2SA 4XLTA 4XX0B 4H1UA 2H5IA 4TYQA 1X1SA 4QQNA 1KMNA 1NBHA 2EJBA 5C51B 3Q9NA 2J8ZA 1HT3A 1JYEA 1MBZA 5JZSA 4UNSA 1KYIA 1VI5A 1I6LA 4ZVMA 2R8XA 1RWKA 1G3QA 3BIXA 4P3KA 2J32A 3AZPA 1Z8HA 3N2LA 1QGUA 1GCAA 1DKMA 1KEEB 3EW9A 1YZTA 1TZBA 2QP4A 1I14A 3I9V6 4WLNA 2GJ9A 2HJSA 2X4DA 4GYKA 4DR2B 1XCOA 3GUHA 4A73A 1NRWA 2VYND 2YDXA 2PS9A 1SXIA 4MSUA 4ZO4A 3IV7A 2W0MA 4RELA 3WYAA 1CUIA 4G65A 3BK7A 2VAVA 4MIOA 3QE9Y 2IS4A 1K2WA 1VMEA 4I7EA 3UXHA 1YKFA 3VX4A 4DANA 6PFKA 4RO0A 1ADYA 1RYEA 3BC1A 3NJRA 1NZDA 4ZEVA 3DO8A 3TD2A 4IDNA 2D5IA 3B52X 4LCJA 3FI0A 1K5DA 4P58A 3DTVB 4ZC8A 3GX1A 3OCCA 2ASVA 4RK5A 3W2GA 3LIPA 1OYVA 3A31A 4M3NA 1V3VA 1YKGA 1LPBB 4ZI2A 2CZQA 1GSIA 3SX2A 3BRSA 2ESRA 2EW1A 2OECA 3OF3A 2VWPA 1PV2A 1R8XA 4FDAA 3G8AA 4HNQA 3V1UA 3ROGA 5HIKA 1U0EA 5KJ1A 4CETA 3A0RB 4PZDA 2P11A 1P7ZA 2ZSFA 4I36A 1NTRA 3EA5A 3PC8A 1XO1A 2VUUA 4KGVA 4JI6B 1DDOA 3IQDB 2Q0XA 4RHUA 4X60A 4XVCA 3UXYA 1XPRA 1OH8A 3GGSA 3TL3A 2UU9B 4G1UC 1WU7A 3OY7A 3EGWA 4P5DA 1JBKA 3NPMA 4JENA 3OD1A 5TEWA 2O7QA 3SI7A 5EZYA 3EMVA 3QSYA 2MJLA 3HCCA 4Y1FA 1WOYA 2QD5A 4HHEA 1FYFA 4JB3A 2IP2A 3FF4A 4PIPA 1G2OA 4BB5A 1ESMA 1SG0A 4DUGA 4OI0A 1HDRA 3JZIA 2ZYRA 2D6FA 1U11A 1SRRA 1Z13A 4K6GA 3RUAA 4ENVA 1FCJA 1UJCA 2EFHB 1XTBA 4WZAB 3G0DA 1JKIA 1GTJ1 1BX3A 4EBBA 3MQ2A 3KWJA 1DUVG 1SC4A 4HWTA 3WK7A 1UR5A 1IY9A 3C3MA 1SC9A 1JPJA 4GOMD 4YRQA 5B57C 5JBNA 1QG0A 5A9SB 2HYIC 1UOEA 2OCDA 2QTBA 4TLMB 1LA2A 1W47A 4WOKA 4PHCA 1OKKA 2O59A 4E6PA 5E2BA 1JYSA 4BNZA 4WESA 2AF4C 1AHIA 1A8HA 1UWKA 2JRLA 3K6JA 1LRKA 2GEJA 1GZHB 4PR0A 4KI0A 1I0LA 1Q19A 3G17A 2VZEA 2OZKA 2WHEA 3BX1A 4UM9B 4ZYWA 4LC9A 2GD6A 2XRMA 4NBKA 1NQTA 3D8BA 3DL4A 2Q8NA 5ITVA 4RHCA 2FSGA 2ISSD 4REQB 4IOLA 5JSKA 3CCFA 2GNAA 3IIKA 1Q3TA 3P0JA 5CXXA 2I91A 4B3FX 3OLCX 4RPLA 1RCTE 3B89A 5DI3B 3VYUB 5KTYA 5G0UA 2R1VB 5HGXA 4QUDA 4AM8A 1UC9A 1LSJA 5CA0A 2BT4A 3RTAA 2EQAA 4C87A 1DV2A 4OQXA 3PGA1 3C45A 5BN3B 4GOND 1C1DB 1YJBA 1NHGA 3O4IA 2JHAA 2BEJA 1GZ6A 2Y1XA 3RJ9A 3LBNA 1SY7A 4UAVA 1ZJ5A 5EQTA 5CAEA 2HMYB 1UPBA 4CLRA 3JY6A 2W6QA 2ZROA 2OYSA 4BLSA 2CNWD 4UCWA 3LOQA 2QTVA 2RDMA 1GZDA 2EP8A 3M1IA 4IFIA 4DIBA 3AVYA 3GNSA 1ZC4A 2J5BA 4Q21A 1APBA 1E9FA 5EHXA 1J9EA 5ENVA 4ISCA 3SVTA 3MJCA 2IEGA 3CNEA 4K3VA 3CLRC 1G20B 4M9SA 1JAHA 4K1XA 3KQHA 3PGKA 3LL7A 3Q7PA 5KCZA 3GQVA 1A7AA 1Z62A 2O50A 2C9YA 2CFRA 4F5EA 3B78A 1ULBA 1OWNA 4IGIA 2QAIA 5MDHA 2QM8A 4TSFA 2QU8A 3VA7A 3D4BA 3GJZA 3KZOA 1O94A 4ZI3A 1V4BA 5FOSA 4MRAA 4UZFA 2IV3A 2ONKA 4TSFD 3RSGA 4BE9A 5JIBA 4Z4CA 1NN0A 4K9PA 3FZEA 4EX6A 2VJMA 3E8XA 3PQ5A 3HZRA 3U7IA 1PAUA 1UBJS 4B74A 4F5WA 2IBSA 3KHTA 4KZKA 3T3PB 3W6PA 4RGVA 4P5EA 2VT3A 2WSMA 3SKVA 4DNQA 2H00A 4D4LA 1UPAA 4Z4EA 1BROA 1A9TA 2C57A 1ADCA 1E9CA 4LGCA 5EPUA 4EH1A 1G5TA 4FT4A 4E1BA 3W2IA 3T35A 4L28A 2C29D 4KSBA 2EQBA 4PG8A 3LYUA 3QXJA 2CJPA 2VK1A 1UZMA 2I3GA 1DAOA 2JZCA 3GBSA 4D43A 1T15A 2RH4A 5AHXA 3EXEB 4CMCA 3IQEA 4Y0NA 2A4MA 1WVGA 1PSDA 1L8OA 4MVJD 4OP3A 5ELXA 1XJQA 1ZD5A 2Q3MA 5AM4A 5B64A 4FEYA 4IKEA 3N0TA 4IIJB 5IBQA 1C9NA 1PEDA 2AGVA 2VHQA 4MVJA 4W9NA 3VJLA 4AP5A 4BLUA 3NOQA 3U16A 1XTUA 3K2EA 2CLDX 1ZYUA 3QYFA 4IILA 1KYTA 5LZ7A 4M0PA 3TSYA 5EMNA 3UA4A 1CNFA 2ABWA 2F4VB 1J99A 2VN8A 4H0NA 2QE6A 2OD9A 2NGRA 5MF6A 2IEYA 3O3MB 2A5LA 3ZLVA 3T5AA 1Y89A 4WWHA 4M87A 3RRFA 1OAAA 2ZBVA 1S2IA 3LECA 1T36A 2JFQA 4QLAA 1CUHA 1PDVA 4PC2A 2LDBA 2VBFA 1J0CA 4MINA 1UT6A 2DAPA 3N2KA 5IJAA 5A9SA 4JBYA 2JI7A 4DDUA 3WGTA 3RT7A 5AIAA 2GYWA 2PQMA 2Z2YA 1KP3A 1MNQA 1IZ0A 4KAFA 1G9XA 3PX3A 3ZJ4A 3L82B 1TECE 1GSAA 3RCBA 1KMQA 4DMCA 3QY9A 4E03A 1TTPB 3UB3A 1JW9B 4WJKB 3WAKA 4ER0A 4D9HA 2FPGA 1RE1A 1T9KA 3WMXA 5CW2A 4RC9A 4ZXPA 1LI4A 4CQMA 2IS6A 1T8YA 3TSZA 3CGGA 4QTTB 3CSDA 3RF7A 1G8AA 1SOWA 2Q5EA 4IX9A 3IAAA 3ZGOA 1POXA 1MMFB 3EA0A 3PFNA 4LJYA 3BYZA 2R86A 3DS8A 4B4VA 2NMVA 5THQA 3QQPA 3UNXA 3WV4A 1H6AA 3F5FA 4UUNA 1U8TA 4I3HA 4WLEA 5SZJA 3W9UA 2GD0A 4J0IA 3RK1A 1DBQA 3W5DA 2ZUVA 3PRKE 4F2GA 1FIUA 1QGZA 3T1NA 2XI4A 4MWEA 4WLOA 4ZVPA 1OT5A 4F9EA 4OXXA 5EL0A 1GPMA 1UBSB 5K3OA 2OWDA 4RLFA 4DRXB 3EC1A 1H3EA 2I78A 4FMCF 2D59A 3A6EA 2BFFA 1U3WA 1QCDA 3WA6A 5EHQA 3K0AB 2Q8QA 3WXBA 4MS3A 2YMQA 1QGDA 1ZK3A 2HJGA 5L51A 3I76A 2ONCA 4EB8A 2ISCA 4HEQA 2P5TB 2A9FA 3P2YA 3KJIA 4AZ0B 4AY4A 3J80A 4QKQA 3P8ZA 3DFFA 4A03A 4HAYA 1NY6A 4QOFA 3AV0B 2G9NA 1JECA 4EEZA 1ZW1A 2MINA 4LISA 1HMPA 2FSUA 1ZH2A 2BOVA 1LV7A 3SYTA 4BVLA 1U9IA 3KLNA 4D26A 2FGJA 3BCUA 1FY2A 4MGEA 5LD2C 1ULAA 4YCLA 3H5TA 1JLLB 1I32A 3WJ2A 3OCYA 3R6DA 1D1QA 3GLIA 3ZU3A 4KUGA 2R6ZA 5C8YB 4D4KA 4BECA 2G9QA 3UUEA 4JP5A 4ZAZA 3THRA 1VL5A 4PV7A 3PICA 3M82A 1Q1EA 4TL6A 1RAAA 1BXKA 1PT7A 4BIMA 1GO2A 1SCJA 3S1AA 1CETA 3ABOB 1G9TA 4O4JA 4W5JA 4G5SA 4CG1A 1J5EB 3U4QA 4D5GA 2J3QA 1QK4A 1J06A 1FDRA 3WK9A 5BRJA 2D0DA 3KEOA 4J43A 1Y9AA 2Q3BA 2OHXA 4AJ1A 1E3DA 3H9JA 4Y9SA 2EBFX 4UOZA 1ZAKA 4HQ0A 4JODA 1KP9A 2H11A 5TPWA 1RCUA 3D3JA 3DE3X 4KUEA 1M1XB 1VHDA 4UNIA 3U3KA 5CXQA 5HM6A 1AXRA 3A4LA 2P41A 1ISGA 4MPPA 1UAYA 1ZUNB 3SHOA 4DA4A 2RGUA 4EO9A 5LM3A 2K7FA 4BNIA 2YYAA 2RK6A 2V7TA 3IP5A 3GYBA 4FP9A 5EIOA 1DT5A 3MJSA 3WGUA 2M6SA 1FUKA 1YS1X 4KE8A 3U3RA 3Q98A 3VR3D 3NHMA 2NV0A 4BFZA 4GR5A 4R9VA 4GVLA 3I2GA 2REOA 4WZZA 3EJWA 1FNBA 2ZWVA 3OSUA 1E1NA 1Z0AA 5FB3A 5IAKA 1NW9B 3EY4A 1QLWA 3NT2A 4JVOA 4AVYA 3FVQA 1I3KA 1Y34E 1SQSA 2QNIA 2UZIR 3KZMA 5JS6A 5F52A 3UV7A 1JQ5A 4FPXA 4JSYA 5ICGA 1SXJB 2F9LA 2A33A 3EDQA 4OHWA 3JAMA 3SK0A 2R68A 4M8KA 1YI8A 1Z22A 2JFVA 2O8NA 2WJ6A 2JEOA 1S4QA 1X7XB 3MAJA 1ISIA 1BXZA 1IY0A 1ORIA 1QO0A 3B1YA 2AUTA 2OSVA 4NHOA 3M9LA 1GNPA 5GV8A 3UT0A 1VB3A 1R4NA 1Q0LA 3RFFA 1SCKA 1Z4OA 1F1JA 4JHXA 1U8UA 1J56A 1Q2UA 4G1FA 4WT7A 1W2GA 3QX8A 5K0EA 1CEEA 1IN4A 3P9SA 4YRMA 5JHHB 2F67A 2WA1A 3BGOS 3KPVA 4GMKA 3JXEA 3R5TA 3P9RA 3NHFA 2BELA 2KLHA 4A16A 4BRUA 2O0LA 2CKMA 4TRJA 3S7ZA 4ZYLA 1I13A 1Z25A 1ZWKA 4NULA 2W6CX 3TL6A 4Q3CA 2OVFA 3OQVA 1ULHA 3E2MA 4OKSA 1L4GA 3KJFA 4Y1RB 1RYMA 1XI2A 3DDNA 4XARA 4M54A 4U2CA 1V7QA 3G6KA 3DOHA 3IXLA 1QPGA 2I4TA 4NP6A 4U02A 5DGXA 2EAUA 4C6RA 5FTJA 5I48A 1W35A 1X39A 4EG3A 5BWCA 5C8DA 4FDTA 1TTQB 3R0VA 1PJ8A 1NYTA 2C1ZA 1DTWA 3UF0A 3D7RA 2BTOA 3CW8X 2TECE 2CJYA 1GPBA 2D2XA 2G09A 3P9KA 1A5SB 4X1KA 3EC2A 3SC4A 3L4JA 1NFQA 2IKQA 2JASA 3SWWA 3G6WA 1DRWA 1OPXA 4EL5A 4O2LA 1NU8A 2A7QA 2GRUA 3B3AA 3QBTA 3J7TA 2EX4A 5GPBA 4F91B 4BO3A 5ECWA 2ZI3A 2ZWOA 4CQMB 5FEMA 4YMUA 4EYSA 3OKPA 4PCAA 4GVPA 4R2WA 3NETA 4L73A 4BO8A 3HXOA 1NBAA 1RRPA 5CDUA 1UM9B 5AK0A 1NM5C 4PAWA 1U80A 3E9CA 4CTOA 1KORA 3F7TA 3OMWA 4HNAB 2HF9A 4B8YA 4JJGA 1FFEA 3B20A 2BP7B 4KJXA 4OOEA 3FUUA 3N2IA 3FDZB 4Y8VA 3X3HA 1IUOA 3O94A 1PZHA 3DYBA 4PLFA 4FSHA 2NO5A 1WV1A 3SDZA 2OORA 5DHQA 4DLYA 2BTEA 2XLCA 3H1AA 2GR9A 5EP4A 1TTTA 3RC7A 3L4SO 3X43A 4BAZA 1AIPA 1AJEA 1NSTA 5CLLA 2CVHA 3GNLA 4R31A 2LKCA 3COYA 3PPIA 2JLYA 2H2AA 4HQFA 1DL5A 4DMRA 4DDVA 3MCTA 3PT5A 5KX5A 3MWEA 3OU6A 3F3MA 4WBNB 5EKDA 1Z7YA 1D2CA 3L0OA 1BNCA 4B4DA 2ACKA 5D2CA 4ZDWA 1XT6A 4M1OA 3F9IA 4N0DA 2HQBA 4GO1A 3CR7A 1LJLA 4QHTA 1T8UA 3COJA 2BMVA 4HR7A 1KRWA 4OJKA 3GRVA 4HNGA 3MMXA 3T7AA 2RI6A 4XSHA 3P2KA 2BGTA 1NVKA 3ZHCA 4P22A 2IY8A 2QQ0A 3ONWA 4JB8A 2IHJA 3KOWA 2X6RA 4ZCSA 1P60A 3KZVA 1YOVB 4DUPA 4QQKA 2QJRA 3PD7A 4MW2A 5C4GB 3ZNPA 1LNZA 4U7WA 2C7BA 2JLBA 1AGXA 3A9UA 3BORA 2UUPA 2NSDA 3L4BA 4GBGA 3MRXA 3OUZA 4PC1A 5IAEA 5EAIA 3TJRA 5B4VA 5GZ3A 2KYRA 4RZUA 4YO7A 5BNZA 1EI9A 3GCWA 3A11A 4MDHA 3GWZA 1E0AA 4L2IB 4J29A 4MRMA 4DWVA 3TLXA 4MUGA 4URHA 3GXOA 1VLZA 3IUPA 4GP6A 3GVCA 4G56A 4S1VA 4ZAVA 5DYWA 2EX0A 3E1GA 1U0HC 2HRBA 2CKDA 3QWAA 1BDMA 1MA3A 3RRNA 1O6BA 2H1IA 2HCFA 4EW6A 1HE3A 1C30A 3AOGA 1U4NA 3MCAA 2HJRA 3MHPA 4Q7JB 1W4BA 3U7GA 2IYQA 3TFWA 4YRAA 5B6PA 5CB6A 5JBQA 3CUTA 4AAYA 2C96A 5JFGA 3AEUA 1ZXLA 5BR4A 2OHFA 3EG5A 3M6LA 1WR8A 1JG3A 3IMKA 2XNDA 4EG5A 1CJVC 4G25A 4UNQA 4AUMA 3FHLA 4DPKA 4FJ2A 2NZWA 1DWPA 1JQEA 2CCGA 4GWGA 4UE6A 1JUDA 2BEUB 4DUYB 2O57A 4URWR 1Z68A 1OIXA 2X0KA 4OI4A 1QNLA 5A0TA 2OAP1 2R3SA 2WWFA 3PGXA 4F86A 1W30A 1HZJA 1DP4A 1A2KC 1GRCA 2RK3A 3OHSX 4GE0A 4WFJA 4XCQA 4F4HA 1X86B 1X7HA 1SQGA 4ZN6A 2W2OA 1T25A 4CMAA 5CT8A 4DR3B 3B48A 5LB4A 1OGIA 3KB1A 2PKRA 3SXUA 4ED9A 1ZM2A 1VHQA 4JOSA 3NPAA 4L4RA 5KJ6A 2K5UA 3A7DA 1S2MA 1ID1A 1YVEI 4PO8A 4C4TA 4M0EA 3ZS8A 4G89A 4NZZA 3AETB 3T7TA 5K0TA 1GCOA 3WR5A 2GWHA 2JDIA 3R7SA 3ZXUB 3K5WA 4A2QA 3FLAA 1CUWA 5HS6A 4AZ0A 1MENA 4MLDA 4G97A 2C61A 1BX0A 2EV9A 4FQ5A 4Q39A 3I5XA 5F73A 1DXOA 3OU7A 4PZ0A 4ALIA 3RB8A 4B0OA 2NP6A 4D02A 1GQFA 3B3JA 3BWYA 3JQDA 1YVRA 3ZI0A 1NNSA 4IGAA 4NESA 5SZKB 1V11A 3CPJB 3FHOA 4GDFA 4L9SA 4LYEA 2QZZA 4OHYA 5K0ZA 2FK7A 1DAHA 4AG3A 2MWMA 2I55A 4F9FA 1RR6A 5A3JA 4F8JA 1UT8A 2H52A 1Q1AA 4F3YA 2XHZA 2QN6A 4KVFA 4X3OA 1RACA 2LPMA 2Q1XA 2WTBA 3HJBA 1QV7A 2QMZA 4GC5A 2DB3A 4B3GA 4CKWB 2PL9A 3UTCA 2MMGA 3CLSD 1HNNA 3T7IA 1GRRA 1Q0QA 2B9VA 1QH8B 1QE5A 2FR0A 3INRA 3QVOA 5DNAA 4HRVA 4J0CA 1E9VA 3G0OA 1NRIA 4P3OA 3F46A 2VFAA 2AT1A 5MN5A 1QMPA 3S0JA 1DMRA 2ZU6A 3QNUA 5IVIA 5CDHA 3KETA 4HAIA 4OJYA 2PZ8A 1HKHA 1DG1G 1O9HA 4JGBA 5DASA 1TKAA 1GKKA 4QU9A 1JX6A 4WPGA 4F4FA 2BM0A 3SC6A 2Q3CA 1EUQA 1IHYA 3BXEA 4RTOA 5C8YF 1ZESA 3WICA 2X4LA 4HWPA 4Z0HO 4LXHA 5FFFA 1ZCBA 1GTVA 5PNTA 4YAOA 1RRFA 3JD3A 5BUCA 5B2ZA 1UQUA 4J75A 3V4OA 4I3FA 5I7WA 2EHJA 1YFLA 1KZ7B 1FXWF 1XMJA 3GJTA 4LZPA 2O20A 3KAPA 2YKGA 1QVZA 5HILA 2BMJA 4H4DA 3ZI7A 3A27A 3FMIA 4UZEA 4AJLA 4Z9AA 5JAPA 4UE2A 3RKRA 5CFRA 4HTFB 1OVGA 1YI1A 2QTLA 4NONA 4X9XA 4YYEA 4QPNA 3QY0A 4Y6OA 5AJXA 5CJPA 2J31A 1NXQA 2WSYB 3B7GA 4W5WA 4X97A 1WS6A 4DADA 2V6IA 4AKEA 2QL6A 1ZMBA 3FFTA 2YOGA 4QE3A 3KQNA 3HKDB 3NVAA 2RHMA 4I5EA 2JAWA 1RI2A 4X94A 3SG0A 3HSSA 3LJKA 4ENRA 3TGPA 2YL2A 1MG5A 1T2FA 1MO6A 4C89A 4O5OA 2Z1DA 2ZIGA 1N5DA 3IP7A 3TKLA 2VHUA 4KMRA 1DAPA 1I2CA 1NP3A 2RJNA 3A2NA 1ZUIA 1KJYA 2DFTA 5G4KB 1FX0A 1LRJA 1XD9A 4KL8S 1TE2A 4RA6B 1LNSA 2BE7A 3HNOA 5E7IA 4OF4A 1KJ8A 1CQPA 3A6ZA 4YREA 1J00A 4RMJA 2QUAA 4UBMA 3GJ7A 2FOLA 5GIOE 3OPYB 4KACA 4KR3A 1OLXB 3AGPA 4K8OA 3GJXC 5KTPA 3HLTA 1AS0A 3H19A 5F5LA 4JP3A 4HX9A 2FSVA 4LZZA 4DGQA 4IDFA 5FOQA 1SCBA 3P2IA 4C7OB 1KFEB 5ALUA 3OZ7A 2W2KB 1CRWG 2H57A 2GKOA 1EBFA 3HI4A 5CEFA 1N9GA 1G98A 5D86A 1E0DA 2VDJA 1NBMA 3G2NA 2PXCA 2YJ4A 3DZDA 2EL9A 1PLJA 4HATA 5JWOA 2P68A 1FRNA 4ND3A 4LRUA 3ILXA 4UC0A 2DF8A 2PJUA 1LBQA 4V0SA 3EF0A 4R2XA 3DBRA 5HFJA 1VZ3A 3AJ9A 3MILA 4H15A 4QGGA 4QT4A 4YBZA 1JZTA 2Q27A 4OD0A 4OQNA 4TMXA 4QDUA 3VU3A 3FOFC 3CWCA 2NUAB 5J5CA 1S3FA 3PUYA 4QUGA 3ZIUA 5JVDF 5TJHA 2DUMA 4E2WA 5EY5B 2QBYA 1V5WA 1XLWA 2ZIZA 3M1LA 1I51A 2OG2A 4C0XA 1U2DC 1MW9X 2ST1A 1IQUA 3QF7A 3VDMA 4AMVA 2YWXA 5CW1A 4EFMA 2FEKA 4K9RA 3OQHA 4NCIA 5HF8A 4ZK2A 2B5VA 3IKMB 4DWWA 1GLNA 2WYHA 3W1VA 3K16A 1RYDA 1KY5A 1ZINA 4ND7A 3H0CA 1YZLA 3NBMA 4UFNA 1RU3A 4QC2A 4H1WA 5JAMA 3LQ2A 3M6MD 1Z8DA 2J41A 3I4CA 1T4BA 2F17A 4JDUA 1Z0FA 1E2EA 4A0SA 5AVVA 1TA0A 4W7IA 1XXHB 4LXGA 4FWTA 1FC0A 1E58A 2AS0A 2JIBA 4JA0A 3O82A 5M29A 2HZ7A 3DOEA 4MGIR 1IEQA 2A1UB 3DC7A 3ICVA 4BBZA 1ENOA 2ERYA 3C7KA 1Z0UA 3VAYA 1XNGA 1F2UA 1Q2XA 1YK1A 2ZUTA 2Q49A 5KYGA 4DG8A 5A3SA 4I99A 1QH1A 5A5GA 4CM9A 1AKNA 4EARA 4OCZA 3PA8A 1BH6A 4QZVA 3MAAC 3WFJA 3DAFA 2H1LA 4KMMA 4HB0A 4MKFA 4NRDA 5JLAA 4BQNA 4UVHA 4HWOA 2XUIA 3GLGB 3U4DA 1OBVA 3FWKA 4WOJA 1DCTA 2JIOA 3DCIA 1PJTA 4EUFA 3L0SA 3KT8A 4KV7A 4TWRA 2FZWA 1D4OA 3VSEA 5IUJC 2AJLI 1ZK2A 3B85A 2BSQA 1PG5A 4TT3D 3RNLA 3RUIA 3KYDA 1WXEA 5C7YA 1E59A 3R3ZA 3MINB 4IZOA 5ILOA 4GHWA 2V59A 4F3NA 1MOZA 4W63A 1J7KA 1FK8A 2B7CA 1H2FA 2QMOA 4MWDA 3G9TA 2FSHA 3FCCA 3L1UA 4N8SA 4OAPA 5CB4A 3DNMA 1JDTA 3PNLA 4KMSA 4QBIA 1ZO8A 2X2OA 5IAGA 2HK7A 1DHTA 4LY9A 3GDWA 3DQZA 4R5HA 4RQUA 1N78A 2OK8A 2Z1NA 4DQDA 2DT5A 1JLSA 3KG2A 1SUIA 1FFDA 1UPXA 3GROA 5GGYA 1MT0A 4BTEA 3KELA 2J4DA 4R83A 4CR6A 1P2GA 3GEPA 1AQYA 5CA0F 1Q0ZA 3ZD6A 1RS0A 2C98A 2X0DA 1G5QA 3VBEA 1BVUA 1W87A 1Z0SA 2QTWB 4JBIA 5IUKC 1DEXA 1FFXB 4DQVA 1V5IA 3CHYA 5IU6A 2GEBA 4PF1A 4EG7A 3ENQA 4P4LA 2H3HA 1E2HA 1OAKA 2DQ4A 2FZGA 1S8OA 2Q0SA 3BXOA 5HP4A 4B73A 2HXGA 3WRWA 2C84A 5HK9A 3T3NA 2BGNA 5EIBC 3I9KA 1BWRA 3PENA 4YR7A 1MVOA 4JB2A 4D96A 2AFIE 1G55A 4YFYA 1KS9A 3N8IA 4NS1A 3TFQA 1TT5A 2BI7A 1OU0A 4RBNA 1EDZA 1PW5A 2XMPA 3KZXA 1FX1A 4N3CA 5JNUA 4YA6A 1FFXA 1P4HA 1U28A 2AMLA 1C9DB 3M81A 1CF2O 3ZPXA 4LXIA 1DQRA 1ZFNA 2H4XA 3LCVB 2B99A 3RRZA 4HWRA 4MEAA 1W34A 3C1TA 1LF0A 3LI2A 3T6KA 3K0FB 3JD1A 1RLUA 1H42A 5J4LA 5FPKA 3HHEA 3SYLA 3VUFA 2GUGA 2BGRA 2GN9A 3C5CA 4I3GA 4PQGA 3U9TA 1BA2A 3AEKB 2E6KA 4RZSA 5J1TB 1ABBA 3QKRB 4PG4A 4H16A 1NWCA 5CIQA 4R1MA 2R00C 4QYIB 1Z15A 2GI4A 3NUQA 1LC3A 5ALNA 1GSHA 3HDYA 4HUQA 4JNKA 2GDJA 2C95A 3E5MA 3I5AA 1JWBB 4B4KA 2BGKA 3TLGB 1I80A 2Q9CA 3G88A 4LXXA 4P7BA 3UQYS 4KMOA 1FMTA 4PX5A 1G8KA 1RJ9B 5EWMB 3Q9LA 3TW4A 4A0FA 4KVAA 4AKTA 1P0QA 2J45A 3AFIA 3IAHA 3PEUA 2ZJYA 1QDUA 2Q5IA 3GB9A 2G88A 3SEQA 4N3BA 5K6AA 4MMXB 2XMZA 3NS7A 3N86A 4HP8A 1U63A 3OA2A 3L6UA 2FJPA 1R5NA 2CHGA 4DFDA 1ZD3A 3GBVA 3LA8A 4ARIA 2GF0A 3M0EA 5BV0A 4WADA 5IYZF 2ZCVA 4HQ6A 4K87A 1PT5A 4IF4A 4E7OA 5L53A 3F6RA 3HUTA 2X58A 4ARSA 3UQZA 1QOZA 4LQCA 4NDAA 2Z8YM 1V37A 2VT7A 3K9FC 1BXRA 1Y1QA 5K0FA 1D6JA 3WWDA 3SQWA 1W6UA 3AETA 2IP1A 2IUTA 2B21A 2KE5A 1QJ4A 2RC6A 2XVYA 4R41A 3WGJA 4XLLA 2HF8A 2GCNA 3NHYA 3EBLA 3MT9A 2D3WA 3BICA 3D3EA 4PG7A 5LP6C 3HL4A 2A92A 4JFRA 4NBSA 5AFSA 3RG8A 1EIZA 4X64B 5KVCA 3GQBA 1I9GA 3E9QA 4L4SA 1UCFA 2VNAA 4GE3A 4MUMA 1F0YA 4A6XA 2A0XA 2HJWA 3AUTA 4BE4A 3I30X 5F1YA 4OTZA 5B3JA 1QKJA 1FMCA 3N87A 3WKEA 1FDTA 1QQ6A 4R6XA 4RHTA 5FBHA 2RI0A 4KB5A 4BUZA 4IW3B 1NQOA 1IATA 4OLFA 1CJUC 3CSSA 1YRHA 5M5BA 2WC1A 1GQOA 1V16A 1XDDA 4K1LA 5AI8A 3VI4B 4A7PA 4A8HA 9LDTA 3IUNA 3VR2D 3NHZA 3HLKA 4PYQA 1NFFA 3JWHA 3IE1A 2YFHA 4M0KA 3F2VA 4AF7A 2Y0DA 3ZWMA 1NZJA 4LEIA 1JA0A 2B8NA 1EWQA 4UHBA 3ORQA 2H2IA 4ZT7A 1WV0A 2HDNB 3D64A 4F3KA 1VLQA 3LE8A 3DGFC 3IDFA 2R2AA 4WN9A 4RUKA 1CZRA 1RFGE 3MW8A 4FGLA 5TE9A 3LT5A 1VKNA 1H8HA 2XDQB 3K4HA 5I9TA 2HGZA 2V54A 3W4KA 1RI4A 1KZ6A 4JI8B 1Y5LA 1S7GA 4NCKA 2XCSB 3HUFA 3OZIA 1GL7A 2IPMA 2JAPA 2REXB 1HQDA 1IHDA 2O8FB 3WE7A 3GH3A 3WLKX 2Y27A 4QLOA 3BHMA 3KSRA 3FJOA 4QOGA 1Q3HA 3JD4A 5HIJA 2PAFA 1RMYA 1F9EA 2P9FA 5TQ0A 6LDHA 2A86A 1JFTA 1R37A 4Z4QA 2IEAA 4MPDA 3BXPA 2R7NA 2F1JA 1IRXA 1Q1QA 5H83A 3THYB 4R1NA 4CF3A 4GD3Q 4ZOLA 1YE5A 3GLTA 4IGEA 2R6HA 4E33A 3H5NA 2YCLA 3H1GA 1IG0A 1G2QA 1QHFA 4YAKA 2WTXA 1R16A 4MW0A 1FDIA 1CUJA 2NU6A 2SICE 2QPAA 2QN2A 4DLKA 5B1EA 5K3FB 4AQ7A 4BUCA 1ZCAA 1NIPA 2GD2A 4HT3B 2J3DA 2EJUA 3P0FA 5DNDA 2IDZA 3C3EA 3SSNA 1V26A