221PA

Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEESYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-RAS P21 PROTEIN
molecule tags Oncogene protein
source organism Homo sapiens
publication title Three-dimensional structures of H-ras p21 mutants: molecular basis for their inability to function as signal switch molecules.
pubmed doi rcsb
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1991-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 221pA00
3EIQA 2GEVA 4PHTA 1XXHE 3IKJA 2FGJA 4AY2A 3K0FB 1KI6B 4BE7B 1JR3A 2P6NA 3KFXA 2HCBA 1BS1A 4TYPA 3RDPA 3ZLJA 2C77A 2F1RA 1GNPA 2F43A 1HT1E 2JJ8A 4QNMA 3TUIC 4JLPA 3ASYA 1G18A 4KI0A 4EJSA 3F3YA 5FI1B 1D2NA 4Q66C 3DPUA 1E2IA 3V4FA 2Z4SA 5TV2A 3T34A 2E9SA 4IRUB 4CZ2A 3EC1A 1YQTA 1Q12A 4TQAA 5JSZB 2GVZC 1EGAA 3TJZA 3CPJB 1GTVA 5E4FA 4M1WA 1CJTC 3TW4A 3VKGA 1H65A 3W8RA 3UMFA 2QAGB 4IJMA 5AUNB 3GCGA 1MO5A 2IS6A 3PEWA 4BFUA 2ZJ2A 4BUJA 4IDQA 2RGAA 1SVSA 1KI1A 1MO4A 2D2FA 1W48A 4BWYA 3GJ8A 3MWJA 1JALA 5HE8A 1G8PA 1HE1C 5KPDA 2XX3A 2QNRA 3N5CA 3QPUA 3IO3A 1IXZA 1U8YA 1XJ0A 1G6HA 4PQYA 2HXSA 4Q4JA 1KO1A 3RAPR 2KB0A 2XSZA 2V1UA 1G3MA 1X8JA 1TX4B 2ZJAA 3W5JA 4RD2A 4DLXA 2A5GA 1G8YA 2F3TA 2JAQA 5JRZA 4QG7A 4II7A 1Z29A 2FZ4A 4J0QA 5ELXA 5LBIA 3M4YA 3A6PC 3AVTA 2H18A 5FBVB 2GAAA 1DEKA 2GZHA 2HLDD 2QGNA 4PQRA 4F7WA 5L3QA 5FTLA 4WBSA 3EWSA 1IY0A 1T5IA 1YZQA 3I5YA 3EZ7A 3I72A 5ANRB 2PL3A 4QGFA 4XWAA 3UXMA 4KSBA 1NKTA 2IT1A 2VP0A 4FI3C 4Q4JB 3SJZA 1KGDA 4MYUA 4DHEA 4UXHA 3HPRA 1NMZA 4OQNA 2F7SA 4JVMA 1E9SA 1OXSC 4NYJR 1UDXA 4PPNA 5A0FA 4AC9A 4NYMR 2R8RA 2RKOA 4B3DA 2PBRA 4DCUA 4M2LA 3CH5A 5BWMA 5CK4A 5C4MA 4C7OA 4MUAA 2P5TB 2YVUA 3MWYW 2XTNA 1VDZA 3MMPA 3VNVA 2H1LA 3QKTA 2NIPA 4HLCA 2BKUA 1M8PA 4YMWA 1ZM4A 1E2KA 1G64A 4DRZA 4HDOB 4LJAA 3MWLA 4FW9A 1J8MF 4BFXA 5JEDA 1HURA 4NP6A 2JIZD 4NCHA 3SE0A 5K8LA 1EX7A 1NKSA 1JI0A 3AM1A 2B8WA 1KDOA 1NSFA 5HTKA 2FSFA 1NJGA 2GXUA 5F9FA 1U0JA 2R2AA 4ZI2A 1OXXK 1RIFA 3IIKA 4LK2A 2IC5A 4V0OA 5FL7A 4CEJA 2DFKB 3ZS8A 4YQFA 3C8UA 2AKAB 2J0VA 1XCPA 2X77A 4EPXA 2D4HA 3MFYA 4B47A 2UZIR 5EZ6B 1Z63A 3FB4A 3RABA 5F3WB 3VKWA 1OXVA 4A15A 1DAKA 2GJ8A 4JJKA 2ZVQX 4D26A 2BWJA 2CNWD 5JS8A 4JKIA 2QY9A 5G3YA 4M1MA 2BCJQ 4L5BA 1KZGB 5LD2C 2QM8A 2ZITA 2ZYWX 1XZPA 2IYUA 1G16A 3LBHA 3B1WA 2GCPA 1ANKA 2J0SA 1NY6A 3WY9A 1XMSA 1OFUX 1EXMA 2XTMA 4KJZA 1Q44A 4PC7A 5IK2D 1OB2A 4F92B 2N42A 4RVCA 4GP6A 4KXFB 1QG2A 1FZQA 1DAHA 1W47A 3LBIA 1OB5A 3AP2A 2HYIC 2OT3B 4Q1DA 4Q4HB 3MCAA 3AKYA 1YZGA 1NP6A 4RZ3A 2RMKA 4PTLA 1KAOA 1UBCA 1Y3AA 4PO8A 4URZR 3C16C 4LOAA 4P4UA 1FOEB 4LJ9A 2BHRA 1M7GA 2F9MA 3J81k 2OCYC 2IW3A 4C0BA 4FIDA 3WP1B 5EXTA 1E9FA 2VYFA 1B23P 2HYDA 5DYIA 2VBCA 3IUYA 1IJEA 1X6VA 3D7MA 3IO5A 1NI3A 3OIVA 2ZR0A 1JECA 1QF9A 4HAWA 1N6IA 2QU8A 4O2LA 2HJVA 3CNOA 2BV3A 2IYYA 5FUWA 3HWSA 1TEVA 5FH9A 1E2FA 5JHHB 2P2LA 4BEBA 1JQJC 3KTAA 2V8OA 1G7CA 2ZYUX 3AKEA 5KU1A 3B13B 4MDFA 2W0MA 2BIFA 2PLRA 1N6PA 1Z06A 1BOFA 2HJGA 3GJ7A 2PH1A 1N0UA 1R2QA 2C9CA 3CRQA 1IQPA 3WHLA 3GLFE 2F55A 1G8FA 1XFAA 2YWGA 2ZAOA 4B48A 3R7WA 4IXNA 3PUWA 3QG5A 1VCOA 2REXB 4G1UC 3DOFA 3P32A 4Q9LA 5KPJA 2QE7A 4ZO4A 2GEUA 4B71A 1TF5A 4DDTA 3JZAA 1E2LA 3PITA 3R9WA 3U3JA 1VG8A 3LDAA 4TLDA 2VRWA 3A36A 1OYYA 3M0EA 3FWYA 3LRPA 2GCOB 4P3YA 5KSZA 2QSYA 1A7JA 3DZDA 2R65A 3TAHA 4TT3A 1S1CA 4IDPA 2RGDA 4LC0A 2WJGA 3U3OA 4XTRA 2IS1A 1HY3A 2OG2A 4HUQA 3N2EA 2QT0A 4ACAA 4UNRA 3TAUA 2CLCX 4JT2A 1R10A 1HQCA 2Z43A 1KI3A 1W2HA 4P32A 1SGWA 1N2CE 3B82A 1TQ4A 5JMTA 3X1ZA 3WYGA 1DTSA 2A5DA 4NCIA 4UJ5A 1PV4A 5FUVA 4A6XA 5G3ZA 3B60A 3ND9A 1OIWA 2QN6A 2ZS9A 2HF8A 3EIEA 4MKIA 2WJYA 3ZVMA 3TIFA 3SC3A 3W5IA 2O5VA 2GCOA 2GBLA 4M9SA 2MMGA 3ZH9B 3TUJC 2PEZA 4E5UA 1FNMA 4WW0A 5IK2A 4BFTA 1GWNA 2A7QA 2JCSA 4YMVA 2ZI5A 2CLSA 2IX3A 3LD9A 3CF0A 1UKEA 1E1RD 1E79D 1OF1A 1TEXA 2H57A 5JECA 1E96A 1Z2AA 1Z28A 2DWPA 5CLQA 5C46F 1CIPA 2XZLA 3TH5A 4LJ5A 4M53A 4CDGA 1EFRA 3U4QB 1KY2A 4JSYA 1FUKA 3GLGA 1CRQA 1US8A 1YZUA 1VIAA 4EQ6B 1G3IA 1F60A 3KTAB 5EQTA 4BFVA 3BFXA 1XNJA 5GADl 3DVLA 1KSJA 1W44A 2GAOA 1IOZA 4TL7A 1BYIA 1CJMA 3BWDD 4URVR 1RJ9A 1NG9A 2PZGA 4CGZA 3ZYCA 3EZFA 2HT6A 2AN9A 2ORWA 3CNLA 2OHFA 1WP9A 4NPHA 4FN5A 3GLFB 2Q3HA 4B74A 1XF9A 3AVWA 2LCFA 5GJBA 1ZU4A 2F1JA 3OIYA 1FNNA 4KVAA 5J4VA 1MT0A 2CHGA 2JLUA 3U44B 3FKQA 2EFEB 121PA 1IN6A 4JIMA 4A0HA 3DKVA 1XMIA 1G8HA 4IW3B 4UNPA 3GFOA 4OK5A 4XWOA 1UBEA 4AG5A 2VQSA 2ZJBA 3U5ZB 2C99A 1N6RA 4K81B 4TYWA 1ZBDA 5FR2A 5JCPA 3NBXX 3EPHA 1WBBA 2XOKA 4F93B 1W5TA 1NY5A 4NL4H 5FR1A 2CK3D 2H5EA 4PC3A 1KIMA 4M22A 4FMBB 4LPSA 3T5GA 5K8TA 4WA7A 4A2PA 3IILA 3RHFA 3P27A 3BS4A 4L8GA 1VMAA 1FQJA 4Q1AA 3WMEA 1N0VC 4BRWA 3FGNA 4DSTA 4RD1A 1W0JD 3VKHA 1G7TA 4MA4A 2NPFA 3ETLA 1EWRA 5DN6D 1L4UA 2ZRJA 1T5LA 4FCWA 4US2R 3DDCA 4V03A 3BIFA 3O47A 2FNAA 2DR3A 3EWAA 3GEEA 3NDBB 3B1VA 1E99A 3CKLA 2ZXUA 1Z0JA 2WJIA 1E0JA 3BE4A 1GL9B 3QXCA 1HV8A 4QGHA 1GFIA 3O8CA 5HCIA 1LY1A 4CT4B 2C8VA 2QROA 5FPYA 4ZKDA 5AUOB 2NTYC 2XB2A 3AB3A 3GLHB 1T8UA 1KSHA 4US1R 3I92A 2VA8A 4U02A 3KXKA 1QHXA 4NMMA 1RFLA 5FFMA 5KNCA 1Z08A 1QHIA 4LRWA 1F2TA 2FN4A 3CW2A 1G1MA 3T35A 3I62A 4PFSA 1W4BA 4C0KA 2AHOA 1E2HA 2J5XA 2RHDA 3NXSA 2BOVA 3P20A 1ZNXA 2WSSD 4JBXA 4Q9IA 5CJ2A 2EVWX 3BB4A 3AEZA 2JLRA 5LDDC 2WMOB 1J99A 3K9NA 1PUJA 4D0GA 1YZLA 3THWA 4BECA 3BC1A 2A5JA 4ACBA 4KLNA 3RC8A 4H1UA 1ONBA 2RGEA 2WOJA 3IGFA 3CPHA 2XXAB 4HAVA 4DLZA 1DAFA 5DISB 4L9SA 2JLXA 4TTQA 4N0EA 2P6RA 1U0HC 3UG7A 2JLVA 2KI5A 1KSGA 1KJZA 1Q3HA 3T61A 4KFUA 2WWWA 5J4KA 4PHFA 1BKDR 2EYUA 2MSCB 3WBKA 3Q72A 1NBMA 4OYHA 4LYHA 3CONA 2JASA 2IXEA 2ZJYA 3U3KA 5J40A 3CNNA 1E9EA 2E1RA 5B57C 4TZ6A 4D81A 4TQUS 3ADKA 4LJYA 4AD8A 1G4AE 3PIRA 3Q9LA 3K0EA 4YONB 4CIDA 2FE4A 2QMUA 2O8FA 5AJWA 2AWNA 5J4HA 1NNEA 4XOIA 2EFDB 3HU1A 4LJ6A 4PQFA 3FMIA 4QC2A 3TQCA 1OT3A 2Z0MA 4NYIR 3TSWA 3X1DA 4ZDKA 2VLIA 3TBKA 1JR3D 2H92A 4U00A 2OEPA 4GPTA 4B35A 5TARA 1ZD8A 5JWRA 4TMKA 4RCYA 4WXPA 4KFSA 2ZTSA 1Z6YA 3O8DA 5EZ5A 4E22A 2GETA 4IEIA 4RFVA 2PT7A 1TNDA 1NLZA 5CYOA 1JR3E 3GMTA 4A36A 1E2NA 3RS3A 4ZKEA 2IUUA 4DZZA 1XJQA 1D9ZA 1K5DA 2WTUA 1ZUHA 2WMNB 3LWNA 4GZLA 1IXRC 4MKHA 2ZREA 2QORA 1UADA 2NQ2C 2Q9AA 3RYTC 1RPZA 4HATA 4TMXA 4MDEA 3LX5A 2WPDA 1XB2A 1LS6A 2W83A 1C9KA 2ZS8A 3OEED 4OK6A 5KOYA 1JQLB 3CZQA 2PCJA 3IHLA 1ZIOA 2NO7A 3DKPA 1SXJB 4F4CA 1R4AA 2YC2C 2O8BA 4Q1BA 1I4TD 3THYB 5A4JA 1R5NA 2FPKA 3I73A 3LW7A 3SQWA 4G01B 2P6UA 2ZRDA 3Q5DA 2BBTA 5EXXA 1W36D 1G17A 3LH5A 4DEXA 2C5LA 3AF0A 2ORVA 2F43B 3ONWA 3L0PA 1VYTA 2OXRA 2WIBA 3ZIAA 1A2KC 1KNQA 4DXAA 4Q1EA 4DSNA 4C4PA 2ZYVX 3QSYA 2V7QD 1MABB 1AA9A 2O0JA 4PX9A 1U98A 1Z83A 4ASUA 3QKUA 1SQ5A 1Z6TA 4BLQA 2GRJA 2PJZA 3PVSA 4AURA 3MSXA 3H0KA 3VU9A 3WNCA 4EJSC 2XZPA 1EFRD 2DFNA 5HZHA 2DYKA 2FX3A 2CLDX 1GNQA 5KO2A 4NH0A 1YJ5A 3AQ4A 1P72A 4MH0R 3VR2A 3F8TA 4BLTA 4DDWA 2ODBA 1VCNA 4HDQB 4D80A 1QVRA 4C7OB 2V4ZA 1P3JA 2NZJA 1VTKA 4UQOA 1FTNA 2ZAMA 2KJQA 4W5JA 3UANA 1X8KA 1KMHA 3IIMA 4F91B 1E9CA 1W36C 2Q3FA 4B76A 1LF0A 3EZ6A 2WJJA 2WSSA 2CJWB 1OH8A 3DO6A 3RS5A 3ZZUA 2N46A 4HLQB 3X2SA 1ZVQA 1W0KD 2AL7A 3FFBA 3ZZTA 1OH5A 3BERA 3SJAA 4TZ0A 4JVNA 3K70C 4EFMA 3IEVA 4WOPA 1JEEA 1U2RA 4H9GA 1ZNYA 1Z6AA 2WKQA 4C9BA 2GEDA 5AJVB 1Q57A 4O3MA 3FKSD 4KBGA 1ETUA 4B3CA 2R6DA 4FCTA 5GJCA 2ECKA 2VP5A 3VTKA 1VECA 2FFHA 2QP9X 4K46A 5DSZA 4F38A 5FPKA 1PLLA 1MO3A 1OIVA 4JJZA 3OEHD 4B2LA 5B2ZA 1JJ7A 2G88A 4PO9A 4JLJA 1I2MA 2HV8A 2V54A 1X1SA 4C30A 1UAAA 5KSPA 3SFVA 4YLGA 3NHAA 2MSEB 1NJFA 2IA5A 1P2VA 3NWJA 3GLFA 3KKOA 1CS4C 1M7HA 1F2TB 4G5GA 2GJ9A 3K53A 3N2IA 1GL6A 1XD8A 3OIWA 3HJNA 4R7ZA 3C15C 4BLOA 3FPAA 1RRFA 4FXPA 2B6HA 1ZUIA 3OAAA 1SVKA 2L0XA 4Z51A 2OCPA 3BJIC 1Z0AA 2J7PA 2OE2A 2QUZA 4A8JB 3ADDA 1MH1A 1ZC4A 2EU8A 2FZLA 4I81A 2NOAA 1NF3A 4PPFA 3A4LA 2G77B 1E9BA 3PENA 2BVNA 3JVUA 3ZVRA 1R8QA 3ZVLA 3PUZA 1W4RA 1SVIA 1WMSA 4U5XA 3LXRA 5CM9C 1P73A 2J9RA 2ZANA 4RY2A 3WRYC 3X1WA 3SU8A 2YINC 4IOJA 4MRNA 2XZOA 3TNFA 4GSYA 5BYKA 2BJVA 2P65A 1DS6A 1FQKA 5KUTA 3B7GA 1CJVC 2ZRKA 3SYKA 4XIGS 4EKDA 4QJ3A 4Z1MD 1KO7A 4B2IA 4QBFA 2WAXA 4LBZA 4JLVA 4D0NA 4TMWA 4UKDA 4V0KA 1KHTA 5TDHA 4R71A 5E95A 2VP6A 2Q9BA 1RE0A 2I1VB 3IEUA 4D0LB 1GKUB 3B9QA 2J1LA 3GJ0A 1HE8B 2GJKA 4A9AA 3REGA 2IYSA 5FL3A 3HP1A 5FBLB 2XJ9A 3W6OA 2ZI3A 3NKVA 4PPQA 3KQNA 4Q4AA 1SHKA 4DB2A 3NHBA 5FOTA 2JJ1A 3H4MA 4HB2A 5GJVC 2V3CC 3UIEA 1YZTA 4M0LA 4C2TA 3C41J 3Q7QA 3K0AA 2ZI9A 3AGQA 4NKRA 3L82B 1AN0A 3LAWA 4B33A 4DEYA 4B73A 5TXGA 2OLKA 3LNCA 2NGRA 3EX7C 2QRZA 1UEIA 4U7DA 1OKKA 1AS3A 4XH9B 2NPIA 1EWQA 3B85A 2FF7A 3K9GA 4CVNA 4Z1MA 3THXB 2ZUBA 1DBSA 1KK2A 3SFZA 3AH8A 5JLJA 4MKGA 3ADCA 2EFGA 4MRSA 1SKYE 2HEIA 4WZBE 5JFGA 4P4TA 3SQXA 2J87A 4HB4A 4DC9A 5CDFA 3S1AB 4YMUA 4JT4A 1CF4A 1CU1A 3BK7A 2PEYA 3SOPA 2O8CA 5IF9A 1SHZA 4DLUA 4W5WA 5P21A 2OFWA 5AUPB 1B0UA 2Z4RA 4BZQA 2B7BA 3T15A 4AWXA 4DBLC 4DUGD 5F98A 3CRMA 1NIJA 5AJYA 5BYJA 3OIUA 4GRAA 4C0LA 2ZS7A 2PMKA 4QM6A 2ZI4A 1T4GA 2ZUDA 5TMPA 3PJRA 5JJKA 1ELOA 4M1KA 1AZSC 3NC0C 2X8AA 3OAAD 3DMNA 1IJFA 2XNDD 2YJTD 2QTHA 1OFHA 2ERYA 2QAJA 3GJ6A 4KYUA 3LX8A 4AG6A 3O8BA 1HUQA 3K70B 2QE7D 4O0MA 821PA 3THXA 2H7VA 4JBYA 4XD7A 3H1TA 3KFVA 2QPTA 1Z6XA 3Q5EA 4JLNA 4RD0A 5FOVA 3W34A 1XMJA 4TQ9A 1G41A 4ERNA 5BN4A 1M74A 1W36B 1XP8A 1XTQA 2O8CB 4H1VA 4MRPA 3OEHA 1CULC 1ZC3A 3NDPA 1U8ZA 2AR7A 4Q48A 1GRNA 2CJWA 1P7CA 2QT1A 2FFBA 4HI0E 2GNOA 2GVDC 3ND8A 3BOSA 4G5QA 1M7BA 1UDWA 3SHFA 3IHWA 2WJVA 2CHQA 2YOGA 1JPNA 2YWEA 3AP3A 3U3MA 1S1MA 5B64A 1GKIA 5DYGA 2XXAA 2P5SA 4L9WA 2BM1A 2WWHA 3BFVA 4E07A 1E9DA 2AK2A 4I99A 3AV0B 4NONA 1E69A 5DE3A 1P2SA 2QAGA 1OH6A 3TUZC 1YR8A 2ZPTX 1A1VA 1SVWA 1G5TA 2ANCA 2I1QA 2IYTA 2VHUA 3RWOA 3W6NA 3RSLA 5L8VA 2Q3MA 5FTNA 2O0KA 4ASUD 1O3YA 1KO8A 3KUCA 4GOXA 2J41A 3BGWA 3K09A 1BYUA 3SN6A 4DLRA 3TKLA 4AK9A 3WYFA 1E2MA 3A58B 3B1XA 4ZDIA 1ZM7A 3SHWA 5EE1A 4CRWB 1U9IC 1T0HB 3MUFA 4MGIR 5DI3A 4A1FA 2VHCA 1PVOA 3VU9B 1Q1QA 1XCMA 4JL8A 4Q7JB 1D5CA 5E3HA 2JDIA 1CKEA 4Y0AA 1ZUNB 4FINA 1G7RA 2FEOA 1TMKA 4EPRA 1UF9A 4JLMA 2CNWA 2A30A 2RGNC 3I3SR 3SDZA 1US8B 2VIIA 2WPDD 4BPBA 2OCAA 2D06A 4Q18A 1OH7A 2YHSA 4PAQA 2EYQA 2IHYA 3W3AA 1N6OA 4UXIA 1RJ9B 3V4RA 3ICEA 4FWIB 3GJ4A 4N0DA 5BN3A 1KO5A 4M9XA 2ANBA 3F0TA 1XEXA 3IBYA 5EE3A 3UWOA 3DM5A 2IYRA 4DCVA 2J0QA 4KFRA 4YXWA 2QQEA 2FFQA 1CLUA 1G19A 3LFUA 4EFNA 5C1BA 5KDDA 4NYIQ 4NU0A 2EFCB 3RRZA 4IEEA 1KZ7B 4M1YA 2FU5C 1L8QA 3WMGA 4B34A 5F2EA 1HQYE 1KDPA 4IDNA 4ZPXA 4HLUC 2ZRAA 3AVPA 1AGPA 1ZD9A 3A4NA 4YXWD 4LYAA 2OCBA 2WWXA 3PUXA 1XTKA 2WWYA 4ILEA 2R44A 4RKFA 1XEWY 5FOSA 3WBJA 2PT5A 4S35A 2SHKA 5H68A 1KI8A 2Z6VA 1MR3F 1ZRHA 2GJSA 3FMPB 3BH0A 4DIDA 4IHQA 5FTMA 2ZE5A 3R9XA 3K0AB 3PFIA 3SBEA 1TPZA 3WNDA 1AQUA 2AFHE 2IYQA 4G5RA 3GLGB 1QHYA 4LPKA 4C3ZA 2WKRA 4TL9A 4WZ6A 3R9IA 3BBPA 4Y0VA 2CEAA 3FYHA 1P5ZB 2KBEA 2VF8A 1NLFA 1XRJA 2HLDA 3Q85A 4EJSB 4RJLA 5JRJA 1J2JA 3AP1A 1F48A 1YZKA 2FSGA 1U99A 4URXR 3QBTA 5EJEA 2JATA 1CP2A 3NG1A 4Q01A 3GJ3A 3KQLA 3T1OA 3GP8A 3U6KA 2AFIE 2ZSAA 2PJRA 2ZR9A 5A5GA 3KKPA 4KLZA 3L8ZA 2D7CA 2NG1A 3SJBA 1QHNA 4MYTA 2BBWA 5KNBA 1SXJA 3IDQA 1D2EA 3C7KA 1P75A 3ICQB 1KNXA 3GQBA 3NVAA 2BEKA 4QJ4A 1G4UR 3RS4A 3U2QA 1QDEA 3K9LA 1KK1A 1QHHA 1SVOA 1VIYA 3THWB 4GOJA 2WKPA 1YU9A 1WE2A 2CMKA 1NBME 1P6XA 4N3NA 1S4QA 1GITA 2D2EA 5CDFE 4M1OA 1FPMA 3CH4B 1BMFD 4QHSA 1G3QA 3TVTA 1J90A 2G1JA 2GXSA 4PXAA 4D82A 5JHGB 4X8HA 3UPUA 1G3UA 4Q02A 1JXMA 1Z6GA 4DLTA 4LDJA 4QM7A 1XWIA 2DWOA 2DFLA 3GFTA 2VSXA 2OUKA 4HB0A 1X86B 4A0FA 1ZU5A 5UKDA 1W4CA 2OAQ1 5JWOA 2ZE8A 1XPOA 2VPPA 1EESA 4XD7D 4PSVA 2QZ4A 3G82C 4LJ4A 3LQQA 3QPVA 2CE2X 1TTTA 4IVPA 5G53C 2G9NA 4Q19A 1I2DA 3WMFA 3KQKA 2FPLA 2O8FB 3PG5A 2IXGA 1FP7A 4RD4A 4IOLA 3QKRA 4JL5A 1DELA 4NHOA 1MKYA 4LV8B 3VX4A 2EW1A 1N25A 1WXQA 1OHHA 2FG5A 2QGZA 4P4SB 1AKEA 3QKSB 2IEZA 1BIFA 2RGGA 1M6NA 5DGXA 3TW8B 4OBEA 2DPXA 3LW8A 4K8OA 4AKHA 3RS7A 1G3RA 1SVMA 3ZQJA 2GXAA 3FTQA 1F5NA 1R0WA 2OFXA 2R6FA 4GT1A 2OFOA 4KAXA 2XOKD 2IWRA 4BEJA 1JR6A 4TYYA 2A2ZA 5HKKD 2WJHA 4V0NA 3T1TA 2I4IA 5CIQA 3KJHA 4BFWA 2DB3A 1E9AA 1OJLA 3LVQE 4HAUA 4D4JA 4TYNA 2ODEA 3QPWA 4XJXA 4GOKA 2D62A 2BMEA 3A1VA 3TMKA 1P4SA 4Q03A 3FHOA 1RVDA 2YNMA 1GZSA 1N6LA 4BFZA 2PX3A 2ONKA 3QF4B 1E1RA 1E79A 1Y63A 3FOZA 2R6CA 2R6AA 4Q00A 1C4OA 4LY6A 3KKQA 2MSDB 2VHJA 1JAIA 3QEJA 4TMVA 2RB4A 2IS2A 3B2EA 4OKSA 2FPMA 1PZNA 1KSFX 3QOFA 4V0LA 5J4YA 1VG0B 3GEIA 3FMFA 4A8JA 2PLFA 5JI3E 1QVAA 1KI9A 2BJWA 2IYLD 3QKSA 4TTPA 1MOZA 2RGXA 4TWZA 2ZRNA 1Q1EA 3LLUA 2RAPA 4JLBA 4DJTA 4MRVA 3MGCA 2RH5A 1VYVA 3Q3JB 2ZU6A 4M4SA 4PR0A 3L43A 3QXSA 4JMPA 5FUXA 1GAJA 4ZCIA 2C78A 3BH7A 3UMRA 3T5DA 1KMHB 5GVSA 1KI6A 3DL0A 4D2IA 4BRUA 3UWKA 4Q9JA 1TADA 1R5OA 1KI2A 4OJQA 1OSNA 4TLEA 4X8OA 2GESA 2DFTA 3RANA 1S9DA 1CEEA 2F3RA 4EIWA 3W9YA 2CCGA 1LFDB 2R9VA 2VTKA 4LWZA 4X8LA 1S3SA 3FHCB 1II0A 5CITA 1R6BX 4P33A 3SEAA 4GP7A 4R98A 4B6FA 1RYHA 1F3OA 2C9YA 2QBYA 4LYFA 2QP4A 2GF9A 1P9WA 3FE2A 4A8JC 1ODFA 4UJ3A 1II9A 2GJAA 1ZAKA 5IDVA 1G8GA 4BFYA 1LNZA 8OHMA 4G5SA 3A1UA 3A1WA 4TT3D 6Q21A 4HYYA 1NG1A 4D4MA 3V9PA 3U3RA 4MUBA 1VYUA 4LBVA 1FX0B 2QL6A 1MABA 3H2YA 1KK0A 2HXYA 4FD2A 4QBIA 1CXZA 1EFUA 5DH9A 1TQ6A 3TQFA 3CUEF 3HU2A 2P67A 2QENA 4ZCMA 1NN1A 2OESA 1GILA 3AUXA 4I1VA 5HCNA 3CB4A 3CIOA 4OJKA 3V00A 2ZSFA 2ZI7A 1NVWQ 1G9XA 2OSBA 3CF6R 3ZZ0A 3K0FA 4LV6A 3KJIA 2QMOA 5BXQC 1R0ZA 4KHZA 2OZEA 3QXHA 3NH9A 2NMVA 1OYWA 4V02A 2OBLA 1EFCA 4HLUA 3DM9B 1W0KA 1OKKD 4P0TA 4QJ5A 3CWQA 4M9QA 3UK6A 3BRWD 5DIFA 1D9XA 2AD5A 3KB2A 1II8B 1R8SA 2VHTA 4JLAA 5H70A 1DE0A 4MGYR 5FI0B 3SBDA 4OI4A 3EIHA 2H17A 5FPSA 2IYZA 3H84A 2QI9C 4OL0A 1V43A 2XEXA 1E9RA 3GLIA 5KTYA 2IUSA 2QPAA 5KDOA 3DOEA 2CHVA 1QHSA 3RLFA 4BASA 4TN1A 1W46A 4DKXA 3QXJA 4Q4AB 3KXLA 1IBRA 2WV9A 3MJHA 1ZW6A 3K0CA 4FWTA 4ESHA 1KJWA 1ZM3A 4ZIRA 3M1IA 1J70A 3I1FA 1T0JB 3IPXA 3TLXA 2NO1A 5D3MA 4CYMA 3KKNA 3FDIA 1OIXA 2QEQA 4PAMA 1N6KA 4B3BA 2V7QA 1G20E 3PCRB 1KJYA 1DOAA 2DWQA 1VG9B 3JZMA 1RC8A 2O52A 1XTSA 3HU3A 1I4LD 3KQUA 3X1XA 1E0AA 4P4SA 4AKEA 4CEIB 2O8DB 2ATXA 1U0LA 4HZIA 2JJ2A 1WRBA 3KB1A 1FW6A 2ZRCA 1EX6A 1P61B 2UVQA 1L2TA 4BQSA 4LGMA 4BZPA 3EAQA 1N5JA 1UFQA 2QPOA 3CRRA 3P4YA 4V0ME 3UG6A 1MRNA 5JI2E 3QF7A 2ZRFA 1WBDA 2LKCA 3AKCA 4PC2A 3B1YA 3WHKA 3QBVA 2QTVB 3OEEA 4FMCB 3A1TA 3RRNA 1GUAA 1CJUC 1SKYB 1BO6A 2ZRHA 1P62B 5IRCD 4A0GA 2C2HA 4HUTA 4CF7A 2CVHA 1GP2A 3RS2A 4TSFD 5FBQB 3S1AA 3HYRA 1G5RA 1G291 3QJYA 1OXUA 2BMDA 1S2MA 1HYQA 2Z5FA 2W6IA 4TL8A 3R8CA 3LXXA 3QF4A 3WXMA 4XVUA 2JIZA 5L3SB 1UKZA 3ZGXA 1E4YA 2ZRPA 2XNSA 1QZXA 2BCGY 3HYTA 4PHHA 4TMZA 4URYR 3QY0A 5C2JB 1XEWX 1KAGA 2GHIA 1L4YA 4LHXA 1GKYA 1CJKC 4HAYA 4QHTA 4A92A 2W0SA 2ATVA 3GLHE 3QENA 4L15A 1U90A 1Q20A 1E1QD 4JKYA 4ZDJA 4PZLA 5BW8A 1JNYA 2ZRLA 2GKSA 4QOSA 2FDCA 2ZQ5A 2RCNA 2JEOA 3PQCA 1OFTA 1N5IA 1W5SA 2WM9B 5JWHA 4OHVA 2JLYA 3ZD6A 1NBMD 1Q3TA 2ODNA 1E2JA 1IHUA 1AKYA 2OAP1 1H8HD 3PXGA 4HZUB 1C1YA 4FMCF 1DAIA 1NN5A 4Q5IA 1YR7A 4UNSA 4NYMQ 1N5LA 4RKEA 3RS0A 2N1BA 3IBGA 4V0MA 4N1AA 4PHGA 4Q21A 5JJIA 2AK3A 1P2UA 1Z8FA 1LF5A 2QA5A 2K5UA 4RZUA 5LPNA 4HDCA 1QHGA 4G0NA 3HR8A 5CB8A 5IT5A 1AM4D 3QI2A 3OF5A 4R9UC 3W3ZB 1IXSB 1UEJA 3PEYA 4DDVA 2BMFA 4Q7KA 2GF0A 2MMCA 3BAFA 2AD1A 4LUCA 2AX4A 5EE5B 3VR1A 4M1SA 2XSZD 1IN4A 3EASA 3GPLA 4OK3A 2H8KA 2Y8EA 4EQ6A 2OBMA 1SKQA 1VHLA 2ORIA 1LS1A 3ASZA 1O87A 5J47A 1AIPA 2FA9A 4P31A 4Q1CA 3REFA 1XPUA 3W6PA 2CL0X 3I4LA 1COWD 5CJPA 3ZIAD 4EAQA 1ZMXA 1XPRA 2YOFA 4O2RA 1WB9A 4QL3A 2EWVA 2Q9CA 1UPTA 3SS8A 3CPEA 4EFLA 1X8LA 3AF4A 2AXPA 4CT5A 2A3RA 2DBYA 3L8YA 1P60A 1Z0FA 4QHYA 5DN6A 1XEXB 2O8BB 2ZE6A 421PA 3LA6A 2LKDA 2W2TA 5L3SA 4R2HA 2QRNA 1DARA 4CEJB 1TQDA 4DB4A 1XXHA 3X1YA 1KDTA 4AYWA 2XJ4A 4A2WA 5KHOC 1N6HA 5C4GB 2X1VA 4IXMA 2LWIA 5FOUA 1UKYA 3DHWC 4JLOA 4TTRA 2PX0A 4GDFA 1ZCBA 4JZKA 5EP2A 3I32A 1U81A 2YWFA 3T1QA 4L16A 1JAHA 3D6TB 3CWZA 3KKMA 3L2OB 4HLDA 2JLSA 3KUDA 2YZ2A 2OV2A 4S2EA 5AUQA 3C14C 1E98A 5G40A 2IHBA 2GCNA 2ZYTX 4HUQB 3U44A 2KSQA 4BLRA 3AGPA 4B32A 4OHYA 2ZR7A 1IY2A 4O25A 4B2PA 1E0KA 2CCKA 4JSTA 4TMTA 1L7VC 1DVRA 2YV5A 2ZRGA 5CLLA 2VEDA 1YZNA 4IFEA 5H1YA 2QMHA 3TE6A 2IWHA 3E5HA 4URUR 2O8DA 1E2QA 1D2MA 1WQ1R 2A9KA 4B3XA 3M6AA 1HA3A 5K8UA 2FEMA 1VKJA 5TY0A 721PA 4JYBA 5K8IA 3K0CC 2ZETA 2GZDA 1R7RA 1Q1ZA 4FMDF 4LCBA 5BQ5A 5J4LA 1S9HA 1S96A 3FHTA 2IS4A 1FMJA 2ZSDA 1E2GA 1VG1A 2FMXA 3K70D 2ZROA 2VHQA 4DSUA 1FFHA 3O8RA 2OILA 1JPJA 1CR1A 1YR6A 4JL6A 1G5PA 5JEEA 2YOHA 4KBFA 4AIIA 1E2PA 1HT2E 1S8FA 2ZEJA 3D8BA 3OE7A 2GWHA 1F2UB 5FBWB 3GLIB 2F9LA 3PEUA 3QIAA 4AKIA 1RKBA 2W00A 4DCTA 2ZSBA 4G5OA 5E7IA 3CR8A 2ASEA 5IHPA 2RGBA 3R7WB 1XJCA 2O8EB 3EA0A 2BDTA 5FTKA 2JLZA 2QQ0A 4YC7A 5JCZA 3VHLB 2FH5B 2VSOA 4QGAA 3TSOA 4AI6A 1KTVA 1EFTA 2OLJA 1AK2A 2E87A 4A2QA 2A5YB 4E03A 2C96A 4KYIB 2DCUA 4LHYA 4RD6A 3KXIA 1Z22A 2VL7A 1U94A 1W7AA 5FPTA 3QNUA 2F1IA 2D74A 2UKDA 2WWFA 1RZ3A 4CEIA 4GMXA 1W0JA 4AYTA 3CRVA 1DG3A 1KMQA 3BH6A 521PA 3RNLA 2WSMA 3Q7PA 3SYLA 5AJXA 2NZ8A 4Z8YA 4US0R 2QMEA 4TLCA 4BZXA 5SZKB 1OE0A 2XNDA 2KWIA 2PZFA 2CDNA 2CK3A 4WXRA 3DZ8A 1TUEA 1ZNZA 1RYFA 1V5WA 4C0JA 1RRGA 1YRBA 4QGGA 4BGDA 1T6NA 5EP1A 4OI1A 3G5UA 2W2XA 3NC1C 4QBGB 4DUGA 4YMSA 2BEJA 1Z3IX 4B3GA 3PUVA 4A82A 1N6NA 1KO4A 2REBA 3CO5A 3AVXA 2DHRA 3P1JA 4D4LA 3T1VA 3C5CA 5DO9A 1T9HA 1E4VA 3B78A 4I1OA 4LX0A 5FOXA 1YE8A 2KE5A 3NBFA 3LBNA 3TK1A 4I1SA 4BLPA 3TVDA 2X2FA 1KI4A 2W6JA 1WA5A 1QG4A 1G6OA 1GM5A 1AS2A 3CLVA 4C2UA 1NLYA 2JLWA 1X3SA 4AYXA 1UKVY 1Z47A 3CX8A 4HAZA 4E09A 1GL7A 1CR2A 5EE9A 3UKDA 4OHXA 1OV4A 1BH2A 4I4LA 3ZDQA 4ZI3A 3F5FA 2ZM5A 1XEFA 2GK6A 4LHWA 4PZZA 1KDRA 3MWKA 1VHTA 3GLHA 3ECCA 3GLGE 3PEVA 2ZIAA 4NDZA 1Z2CA 2BMJA 2JJ1D 4DLSA 1JBKA 3DMDA 4W7SA 1DADA 1EK0A 1E2EA 2WOOA 1DO2A 3RVBA 4GFDA 4XWKA 3I61A 4POAA 1GOTA 1W1WA 2JA1A 3GFPA 2H16A 5KDLA 1TUIA 4A0RA 5TVKA 1G7SA 1QRAA 4KCGA 2WWGA 5AJZA 1ZCAA 1LW7A 2I3BA 4NTZA 1COWA 1YR9A 2EQBA 3CX6A 2V6JA 3GJXC 2XGJA 2KBFA 3LY5A 4B3FX 2Q21A 3THYA 2ZRBA 5D3QA 2HDNB 1P9RA 2ONJA 1U8AA 5EP4A 2WBLC 3R8FA 1IONA 221PA 3EPLA 4X8MA 3ZJYA 3K1JA 1II8A 3LV8A 2J45A 1K5GA 3HR7A 3MJRA 5J5CA 4A6PA 3I8XA 5EUQB 2J7PD 4GI7A 3UATA 4CEHB 1FL9A 2ZI6A 4B6EA 4LYJA 5L3QB 3NBYC 4XVQA 3OZXA 2IF0A 1UM8A 4AKGA 1JEDA 3ZQ6A 4KU4A 1HEIA 1YRAA 4OI2A 3FFAA 3WP0A 2Q6TA 3B6EA 2OM2A 4DSOA 2VP2A 1AJEA 2HF9A 3FVQA 3WNBA 3AKDA 1GSIA 1KY3A 4QNRA 4RFSA 3CBQA 2VO1A 1NRJB 3KX2A 1JB1A 5FUYA 1TF2A 1G21E 1OXTA 4MYCA 2GILA 2WWIA 4PZYA 2WAYA 4JYCA 1E1QA 1Q21A 2ZRIA 4F4IA 1Z0IA 5BN5A 2PZEA 1ESMA 3EXAA 3FKSA 4LC1A 5B30A 3B1ZA 2IF2A 2QP3A 1I4DD 3PR1A 4IFBA 3ZS9A 3VR3A 3A4MA 2QM7A 1A2BA 1J7KA 2V6IA 3BB1A 2C9OA 3QVVA 4IOKA 2C04A 3FMOB 1PUIA 1JXOA 5HE9A 3RRYA 3MD0A 1S0UA 2BC9A 5GVRA 4D4KA 3TGPA 3KL4A 1OPXA 2W6ID 1A82A 1YVDA 1H8EA 1PLKA 4TYQA 4DLVA 3KJEA 3I8SA 2W58A 1X1RA 1Q1BA 1XTIA 1NVUQ 2ZJZA 4WVFA 5EXPA 2JGNA 3K0SA 4YDSA 1XTRA 3A8TA 1UBGA 5G41A 5KNDA 4GL2A 2GBLC 1IY1A 3VNUA 1TU4A 2IL1A 4PSKA 1EG7A 3OFND 4KV9A 4YMTA 3SZRA 2RGCA 4RFSB 1ZINA 2IK8A 5JS7A 1T3HA 3AF3A 3VAAA 3W90A 1XCGB 2AWOA 3KZ1E 1Z5ZA 3IPYA 4OQFA 4UNQA 3C4JA 4NZYA 2UZ3A 2JDID 4ZIRB 4Q1FA 1WF3A 3EZ2A 2BBSA 4EDHA 4HB3A 2G6BA 2J0UB 2ZU0C 3CM0A 2B8TA 3OFNA 4C0AC 2A5FA 5DNYB 2QTFA 1DAMA 2HUPA 1DPFA 5DHFA 1OFIA 3K8YA 3OESA 5F9HA 2BBOA 5FL7D 5B58C 1DAGA 3MLEA 1YKSA 2AXNA 4LHVA 1HH4A 4Z54A 1H8ED 621PA 5HPYB 4D25A 3AVOA 4M9ZA 5E7JA 1KKLA 3QKRB 4UNNA 3GD7A 4EPWA 4RCZA 1SZPA 3WRXC 4M1TA 2P3SA 2TMKA 5JBQA 4F4JA 4FCVA 4W9MC 1NL3A 4HEJA 3ZVNA 3TR5A 3IIJA 2NO0A 3L0SA 2D3WA 1K8RA 1PLJA 4DT1B 3QG1A 1D6JA 3AVQA 2J59A 1EFHA 1CR4A 5DI3B 2F6RA 1M2OB 3MAAC 4PO1A 5KSYA 2VP4A 3VR6A 3W8NA 1DAEA 3QXXA 1QHHB 1Z0DA 2FGKA 1P9NA 1Q22A 5CM8B 1H8HA 1XU4A 1SULA 3RSOA 4DLWA 3CF2A 3U7FB 1LTQA 4PAOA 4PPGA 4RZXA 1TQ2A 3QQ5A 3LO5A 4OHWA 3EW9A 1Z07A 4ARZB 3WYAA 1GIAA 2PCLA 3PV0A 2RHMA 3NEYA 1NVXQ 2PMDA 3RRMA 3U4QA 2GA8A 3U61B 4QRHA 5CYPA 2RGNA 5DLQC 1IM2A 5DHAA 5DI9A 4B44A 4DLYA 3VX3A 2YYZA 4LV5B 4OQMA 5EE0A 2CCJA 4OQLA 2B7CA 2P0EA 3BXZA 4MGZR 4ZV4A 3NBZC 4Q7LA 3EC2A 2QBYB 3PUYA 4JVSB 1GVNB 3K9HA 2C95A 2FV8A 2GK7A 2G83A 4L4UA 1W49A 3NEJA 1RRCA 1ZIPA 4JBWA 5LB4A 5KYKA 1ZYUA 1GDDA 3K09C 4D6PA 3P26A 3TSZA 4Q47A 4NBSA 4TL6A 4TSFA 3QEOA 1GG2A 1XX6A 2ZJ5A 4JS0A 1TU3A 1AQYA 4TLBA 1MV5A 2QAGC 2ZRMA 2VP9A 3BD9A 3JVVA 3A37A 4BFSA 5L3VA 3KQHA 3VR5A 3ZD7A 1UJ2A 4C0HA 3BORA 2W2VA 1SXJC 1ZNWA 4Z8XA 3GJ5A 3AVVA 3MG9A 3IQWA 3L0OA 4UXJA 4M21A 4LBYA 3CR7A 1MO6A 4XTCS 3AUYA 1E32A 2JLQA 1QBKC 4RSGA 1ZP6A 1W2GA 2OBNA 3AVYA 4EPVA 1CRPA 3NH6A 2GZAA 1KKMA 2WVJA 3DEFA 2IXFA 2JJ2D 3E70C 1NN0A 3LQRA 4DCSA 2ZVPX 1Z0KA 1ESNA 3MRSA 3N70A 3SI7A 1JJVA 1GRRA 5EUMA 2G0NA 2REOA 4ZCLA 2FSHA 4ITRC 1E94E 3D31A 2O8EA 1NN3A 4PC1A 5C18A 2V9PA 4QBHA 4LZZA 4DT1A 4MYHA 2XTZA 1CTQA 1LVGA 1OLOA 1NVVR 2BKEA 1XTJA 1TL7C 1NMXA 3QUSA 2R62A 2ERXA 2G0TA 4Q9KA 2XB4A 3R20A 1N0WA 4MQBA 4DIEA 3QE0A 1FMLA 1VCMA 4EUNA 4ESVA 2O0HA 2X2EA 2WICA 5SZIA 1T3SA 1XXHB 1KOFA 3VMFA 3EARA 1IAQA 1AGRA 1KYIA 1NSTA 2CXXA 2FOLA 4HSEA 4Q4HA 3T06B 2IYXA 2D7DA 3AF2A 3E1SA 3B5JA 3OHMA 4XVRA 1VCIA 1FP6A 5JZVA 3UMSA 3H86A 4W5HA 4LJ8A 2CBZA 1FX0A 4NCNA 5EXSA 4HAXA 3KDSE 4KSCA 4RZ2A 4QKQA 5AR1A 1XDBA 4YDHB 2BM0A 1CBUA 1XBTA 4WIAA 3LLMA 5SZHB 3GEHA 4NCKA 3A1SA 3TRFA 2W6JD 1RW4A 1A4RA 1GNRA 4DDUA 5HKKA 1W4AA 3D3QA 5CB6A 1TF7A 2CL6X 4GBMA 4IKEA 4Q9HA 4TLAA 4LI0A 2C03A 4JVLA 2NO9A 4A4DA 5FPHA 1ZD1A 1AZTA 2CE7A 1E6CA 3KJGA 4KODA 3CX7A 4LBWA 2IYWA 2QSZA 1TAGA 4LJ7A 1Q0UA 2XITA 4URWR 3VFDA 2GTPA 2WHXA 1OHHD 5EP3A 3IQXA 2B92A 1ZM2A 2IEYA 4IOMA 5M04A 3AF1A 4KVGA 3C5HA 1KK3A 3B9PA 1FUUA 1SXJE 3LVRE 5FBRB 4XSHA 1M1YE 4CW7A 4IVQA 4DWJA 3U7GA 1SVLA 3ADBA 5JJLA 1GRQA 5FTJA 2FSIA 1R0XA 5CIWA 3CRW1 3EG5A 4LHZA 2QG6A 2AKYA 3L0IB 5GJWC 4C0QC 1MRSA 4WZAE 4ABYA 4B75A 1E0SA 3EA5A 4M8NE 1T8TA 2ZE7A 5E7MA 4GMDA 2OO7A 1R0YA 2XAUA 1YHNA 1N3BA 4LSGA 5JSZA 4IVRA 2CL7X 2ZUCA 3VHXA 3EPJA 2NO6A 3QVUA 1XZQA 4FMDB 3SJCA 1AS0A 1F2UA 1OW3B 2FJUA 4QFMA 1BMFA 4OI0A 1S3GA 4MITA 3SYNA 1D8TA 2A78A 2EFHB 2FFAA 4MRRA 3GLIE 4I1UA 2J46A 2IBMA 4DVGA 1R5BA 1RRPA 4PC6A 3RWMB 3VQTA 5LD2B 1XMVA 1CR0A 1F6BA 2VF7A 1U9IA 1PJRA 1NVVQ 2J7KA 3E2IA 4GNKA 5SZJA 1K6MA 2YC4C 1NIPA 2B21A 3P4XA 1E2DA 1LB1B 3U7EB 4ARZA 1SXJD 1KI7A 2CVFA 1NMYA 4DCNA 4C0SA 3OE7D 2EWWA 4NCJA 4CEHA 1IN5A 2OXCA 4Q7MB 3T12A 4B43A 1XD9A 1ZM9A 1XD2B 2J0UA 1IN7A 3U7HB 2HT1A 5FOWA 5L3RA 3EZ9A 4Q4LA 4KFTA 3HDTA 3RC3A 4IDOA 4OQXA 2IUTA 2YWHA 3BFKA 4ZDWA 4MGKR 1N5KA 3NTUA 5HZKA 4ON9A 4NE2A 2FWRA 2G1KA 3SNHA 1DO0A 4R2IA 2C98A 2V55B 2Z83A 5AK0A 1T91A 2WIAA 4PANA 2DY1A 4QXAA 2G3YA 2IYVA 2R6GA 3B8HA 2GXQA 1M34E 1UBFA 3CZPA 5H8WA 3VR4A 1LV7A 2VSFA 4PSAA 3TR0A 4BLSA 1J8YF 1ZJ6A 4MKFA 4OHZA 1E3MA 1DG1G 3I5XA 5AWFC 2V1XA 1FTSA 5D3MB 2ZJ8A 5TB5A 4XSGA 1T3LA 2ZSEA 4HZUA 2HCJB 1HTWA 1IN8A 1P2TA 4JLDA 3U60B 5KSOA 2ODWA 2F1HA 3Q8XB 5CK5A 2YKGA 2GDJA 4NYJQ 4IDHA 2Q0HA 3U6BA 4EPYA 4KO8A 1A5TA 2VH5R 5LB2A 2X19A 4EPTA 5HR5A 4G3XA 3HPQA 1WDTA 2J3EA 2WZQA 4WAUA 4GZMA 3AVUA 3BB3A 4JLKA 3G0HA 3SR0A 1WCV1 3THOA 3EPKA 4KITB 1XD2A 2ZJOA 3NIBA 4RD3A 1VPLA
chains in the Genus database with same CATH superfamily
1T36A 4K6KA 3OVMA 3EIQA 4MEAA 4OU4A 5ILQA 2GEVA 1AQIA 4PHTA 5HIJA 3W4JA 5KYUB 4BMDA 1XXHE 2FGJA 2RJOA 2OQIA 1UFVA 4IHKA 1VFNA 1I7LA 1I24A 5KNCH 4W1QA 1BTOA 1TKCA 2PVCA 4W6ZA 3JAKB 3P7MA 1U5CA 1U1EA 3OWHA 4MUNA 4TS9A 1GNPA 4LF4B 4MGHA 2Q5QA 3W2IA 3DNMA 2VYCA 3QYFA 4QNMA 2PKYX 3IP7A 4KI0A 4MV0A 3UJ8A 5K1ZA 1JXAA 2H08A 4HDSA 4GMGA 3HCPA 2GEFA 3NUGA 1PGJA 1Z5PA 3PPWA 2VNKA 3ZVKA 3MHTA 2BGKA 2FPUA 1RQXA 2Q28A 3V4FA 2Z4SA 5TV2A 5HRCA 4RKWA 4IRUB 2Q7DA 3H7IA 1Q12A 1FPQA 1NRXA 1C3LA 1EGAA 3CPJB 2GD6A 1BWQA 1CJTC 3AHCA 3TW4A 3NHUA 2BI4A 2I3ZA 2X42A 2H1SA 2GEJA 2XOXA 5AVRA 2QAGB 1YR1A 3ED5A 4IJMA 3M89A 1U3UA 2V7TA 2IS6A 3PEWA 2EG9A 3COYA 3LFTA 2QZJA 3UQZA 4BUJA 3BIXA 3KTFA 3N58A 5DTRA 3CN9A 2XI4A 3GI1A 3GJ8A 3MWJA 3DA8A 4JXKA 4AG3A 3P2IA 1HE1C 4MW4A 2XX3A 3HJAA 4CMIB 2HJSA 1HDRA 1AUPA 3NX4A 1U8YA 1XJ0A 3HYSA 3RH0A 5IDYA 1N5DA 2IIVA 5U4XA 3CJTA 3OO0A 5DK4A 1N75A 4YGYA 4CKBB 2I91A 1G3MA 1IWPB 5LNK6 1ZH8A 5K0SA 1TYAE 2TMGA 3N59A 5BV2P 1RWMA 1EGQA 2QYOA 2PAFA 3P2KA 2CBXA 4II7A 4XR9A 3SM9A 3H2HA 5LBIA 2R6HA 5DBFA 5KHAA 3FRJA 2GZHA 4PQRA 4F7WA 3LYLA 1ZI9A 1DQRA 1BKSB 1IY0A 1SRQA 1T5IA 3M4ZA 2PFGA 1CY1A 2PZAA 5ANRB 3F9RA 2MHCA 2DQKA 4WERA 4QGFA 3NM6B 4PTZA 5DYYA 3OQVA 1RYEA 5TQ0A 4IUCS 3UXMA 3AEQB 4RV4A 4KSBA 4FI3C 3BJZA 2GBCA 3EJ6A 5J1TB 1KGDA 1ZH2A 4MYUA 5T8KC 4YRKA 4CWAA 5JAPA 1GQFA 4H3KB 4FN4A 1KH3A 2PZKA 3L7MA 2WHEA 4AC9A 1OA0A 1U3FA 1USKA 3AU8A 1Y6RA 3AUFA 5I51A 5IC5A 2PBRA 1OBVA 2X8JA 4U6SA 1ODJA 1T15A 1PL6A 2Y0PA 3KELA 4LRSB 2NYRA 3FUVA 3LDFA 5I7HA 2WJPA 2JCGA 5CK4A 2YVUA 3MWYW 3GQBB 5T3YA 4UEWA 3MMPA 4K05A 5JAQA 4KR9A 4LF6B 2Z3ZA 3OQIA 2BKUA 1EIWA 3N2NA 4RGYA 1M8PA 2R11A 1TJ4A 4XGRA 3A9WA 4R7GA 2Q4EA 4YMWA 1TAHA 2UYYA 4CL2A 1UBUS 2WPNA 4UHFA 4LN1A 1ZRSA 4DRZA 3EOBI 3VV2A 4PO3X 1YK0A 1ZWKA 3LY7A 3HV2A 3MWLA 1J8MF 1X1AA 2CLOB 3TSAA 5JEDA 5INTA 4AICA 4ZWNA 1A9YA 1VL0A 1CJBA 1J39A 3V4PB 3ZEAA 1N1DA 1PJ3A 2WINI 3SE0A 2AYYA 5LVAA 3AM1A 4FHDA 1RHRA 4DCMA 1NSFA 2FSFA 3KAJA 1T9DA 4ECAA 3NHJA 1T1EA 3GNTA 3WB0A 1NDHA 4LK2A 2IC5A 4OVKA 1YXMA 4V0OA 3VI3B 4K1XA 2PL5A 4TKMA 4YQFA 2AKAB 2J0VA 3ESCA 1Q0ZA 2WIKA 3FZEA 5F12A 3V48A 2D4HA 3MFYA 2GN9A 1J25A 2B82A 5AICA 5DNCA 5JH7F 1Q0LA 1S7GA 3L4KA 1Z63A 2M6KA 1USIA 3RABA 5F3WB 1ABEA 1JN0A 4A15A 4WSOA 1Y1KE 3PQFA 4NPAA 4WVLA 5F2OA 3WX0A 4CDMA 2CNWD 1HZJA 3PNSA 2I66A 4BV9A 4FYPA 4LTNA 3G7NA 3D8SA 4RHYA 4PG6A 1B2RA 2X0KA 5I4BA 3P45A 2XCTB 3D6JA 4TM8A 3C24A 4XEHA 2PTGA 3INYA 2RK3A 2RIPA 4MMXB 2J0SA 1GGVA 2I9PA 4BO1A 1GUYA 1XMSA 5FWAA 1OFUX 2PUEA 2AJDA 1Q44A 4PC7A 1BW9A 3PNLA 4AJKA 1SCNE 3BGIA 1JEYA 1Y9DA 3FPHA 3HCFA 2DUJA 4O08A 4Z2YA 1DAHA 1W47A 2UVPA 1OB5A 1RXVA 2DOKA 4FNOA 3VNRA 1U9JA 3MCAA 3AKYA 5FA6A 5BXYA 4UHKA 3R5TA 4ZQIA 5DT2A 4PTLA 3E8MA 1SKAA 5GZ6A 2DG2A 2H1RA 3LWZA 1ND5A 4PO8A 3UT5A 4W5QA 3C16C 4P4UA 4OP3A 2G40A 3BRWA 5AESA 3KE8A 1CY2A 5DHUA 3K4QA 3NV7A 3VH4A 4C05A 3AM4A 4YK7A 5HM6A 1B23P 3RT1A 3BL6A 4QFBA 1JHQA 1IJEA 1JV2B 1X6VA 1N9KA 1C7QA 3IO5A 2FJ0A 4R8RA 2ZR0A 1JECA 3H2KA 3EF3A 2H1OA 1E66A 2RONA 3ANNA 1Q1AA 1TEVA 3LGSA 5JHHB 5EJIA 1JQJC 4JX9A 4EGCB 4LS3A 4GICA 4MDFA 4OUDB 4CPDA 3Q1LA 2BIFA 4LJSA 1R6VA 1BOFA 1KFKB 3A3OA 3CRQA 1A2QA 4IIVA 2VP3A 2XOEA 3M6LA 4UM8B 1O8CA 3ZHBA 5KU7A 1IQPA 4KO1S 2Y2UA 1YNOA 2VJQA 4Q3DA 2BYTA 1XHLA 2YWGA 4RXMA 3L9XA 4IXNA 4GPBA 1I30A 3CH6A 1QSGA 3P32A 3DKRA 3KZNA 4Q9LA 3VKVA 4CTKA 3N2KA 4IMPA 4B71A 3IH5A 3OLQA 4DDTA 3COJA 4PFQA 3LKVA 1E2LA 2BZ0A 4FZRA 1LZLA 4G0YA 4WLFA 2A86A 3LDAA 3NAGA 1OA1A 2VRWA 4G0PA 3VU1A 3KOYA 3V7NA 2PGIA 2AR0A 4WLOA 1AH2A 2PKEA 3GPBA 3N39C 2IXDA 1MJGM 2GCOB 5DGTA 1WJGA 2WFMA 2XWSA 3F1KA 4D98A 1J06A 1QRDA 1LKZA 1PJCA 2QSYA 3INNA 4TWAA 5EJAA 2BFMA 4TT3A 1VHQA 5CD1A 2H06A 2WJGA 4CJXA 1K92A 2DC1A 4YS6A 1DINA 4KO4S 1HY3A 4HUQA 2Z6QA 4ACAA 1MC5A 3P94A 4GKAA 4HH3C 1U7HA 3TAUA 2CLCX 2ZYRA 5CFZA 1F9AA 1W29A 1FDRA 4LGVA 2X41A 4YIHA 1QHFA 1W2HA 2IEIA 4P32A 5I45A 4RK1A 1N2CE 3B82A 3NWEA 1IK4A 3OLYA 3RIEA 1T8RA 4IS3A 2P9HA 3I4CA 1DTSA 4NCIA 4UJ5A 2FF5A 5F7XA 3FOBA 3HBMA 1QX4A 1ZO8A 5ESRA 1YVEI 1Z4KA 3H3XA 5LLDA 4W1SA 1IVNA 1BRTA 1O96A 2ZS9A 4C1NA 3GJZA 1WDKA 2M6LA 2P4HX 3TIFA 5C1PA 1HTTA 5JO9A 2GJ4A 1E2BA 3W5IA 2VEOA 1SG0A 4Z3OA 4BQOA 2GBLA 3PVCA 3QV2A 1EUCA 2JFZA 1Z8HA 2P3OA 2KQUA 2PEZA 5DIZA 4DZRA 4HDKB 3EA4A 5AI5A 1LPOA 4B87A 2A7QA 2XT6A 2JCSA 3BULA 3LT2A 4Z9FA 5E0OA 1JWBB 4YMVA 2IX3A 4XRRA 2WTEA 3EVDA 4WKGA 3G9QA 3JWIA 1Z2AA 2AZMA 1Z28A 5CLQA 3VR2D 4AMVA 2W7TA 3IERA 1CIVA 1P1KA 4L76A 1DWQA 4H7EA 3WMWA 1FUKA 3JRNA 3ETDA 5FKJA 1G3IA 3VSAA 1P5JA 2VXCA 2GPAA 4BFVA 1ZCZA 3QUTA 5DBHX 6ABPA 3QEKA 5GADl 5JCOA 4IHJB 1ZD5A 3ON5A 1X80A 1K3UB 1RKUA 1XJ5A 3DEAA 3JPYA 3SLRA 5TQ2B 3ZR4B 4CGZA 4RF4A 2J6HA 2AN9A 2ORWA 4RPLA 2OHFA 3O31A 2PQMA 2EX1A 4C0WA 2CNNA 1MTOA 4B74A 5BR7A 3BE8A 1HZZA 1A50B 1FNNA 2RI0A 3IDAA 5C8YF 1T3ZA 3JQ9A 3L92A 1J21A 3NBUA 2YQ4A 4IP0A 1QIKA 1IIBA 3E7DA 1WCWA 2VQFB 2GRAA 4IW3B 3NUZA 3GFOA 1UBEA 3PPIA 2FQYA 2B4YA 4KIUA 1VSUA 1ILEA 1M2KA 5C81A 1HX7A 2C99A 3DAHA 4EG0A 1U3DA 2XMDA 2E49A 1JA1A 1WDLA 2DVMA 3GPCA 4J0GA 3V5NA 1ZBDA 3VC7A 5JCPA 1QIIA 2QJFA 1AKUA 3OLCX 4K6OA 5CT6A 4XLTA 4ZCSA 1J20A 2VN8A 4ALNA 5KYTA 4MULA 3TSYA 2CK3D 1A77A 1KIMA 1QDLB 4M22A 1YJ8A 3DAOA 2VJCA 3C97A 1YDMA 2OQ2A 4LPSA 3K1AA 1A9PA 2NVUB 3ZDBA 3F9CA 2VDQB 3UJBA 4RJTA 3BS4A 4FYHA 1Q7TA 3H19A 3MD9A 4ES6A 4P58A 4RD1A 1YVPA 1M1YA 1VQ1A 4REQB 3VPSA 4MR9A 1TMYA 1TPYA 3R77A 4NK5A 3VKHA 3DP9A 3WGMA 3ETLA 5DN6D 2JJMA 1X9HA 3Q87B 2ZRJA 4MCAA 3NPMA 1J9ZA 3IUNA 3JAWA 1P0PA 1O2DA 4FCWA 2CDRA 1CPYA 2JBAB 5L7TA 3ZV4A 1NAIA 1TFRA 1RZRD 1E6WA 3EDQA 3KS9A 3PIIA 5ITWA 1JIQA 2CWDA 3PFWO 3WWPA 1PNRA 2ZXUA 2WJIA 1UFKA 4AN4A 1IUKA 2G9VA 4OQEA 3JQ9C 1HV8A 1NUSA 1TTQB 3OO1A 5K45A 3MIZA 1DCTA 1ZGHA 3ONNA 5HCIA 1XZHA 4G89A 5EFZA 3O8CA 2XB2A 2NTYC 4YAEA 5KREA 2HIGA 1DO8A 2D4AA 1HEYA 4HTAA 5HG0A 3I92A 3KOZA 5HDBB 4DAOA 3QTLA 2UZAA 3WFJA 1M8KA 3F8SA 3ZU6A 2JRCA 1NE7A 2XMGA 3FH0A 3UFBA 3GAAA 9LDBA 2FN4A 5KNCA 1SBHA 1WCIB 4PFSA 3T35A 4YJ2A 1E2HA 3NXSA 4ZCTA 1GQRA 1G0OA 3X1JA 4B80A 2FN7A 1RQLA 2ODQA 3KK0A 3ZWNA 2JLRA 4TKUB 2UYQA 2WMOB 1GPJA 3DE7X 1L5QA 1JIJA 3GRRA 4MQ5A 5DX1A 2A5JA 4UPEA 3RC8A 4H1UA 1ONBA 2X0FA 2B35A 3OTIA 2IYEA 3IGFA 2E6UX 3MMNA 2QD5A 3JXEA 3DBHB 4RQTA 4B6RA 1ZLYA 3DEKA 3SIRA 4DLZA 1UZLA 3AJAA 4MCJA 1DBVO 2VYVA 1XQ1A 3P2YA 4L9SA 4N0EA 4RLSA 2KI5A 2NZVG 3L0BA 2OHHA 2A9FA 4KFUA 3IP1A 5ITSA 1AX9A 2MSCB 2J8ZA 3JQGA 4HVTA 4X65B 3UT6A 3CONA 3ELBA 1KFJB 2BUBA 1VB5A 2IXEA 3ZHSA 1T8PA 1QLJA 4DVJA 3U3KA 1WSAA 2VBGA 5TS3A 1IN1A 1COZA 1BKYA 4YRRA 3ADKA 5EEGA 4AD8A 4RTLA 2XBLA 2VPXA 4X00A 3MXOA 1QNLA 2FE4A 4GEGA 4IZOA 4M0CA 3CVJA 4ZHSA 5LKAA 5J4HA 3JYNA 3CXRA 4K9KA 4XOIA 2M6SA 4DR1B 3TQCA 2CFTA 4NR0A 2JAOA 4NYIR 3UAZA 4PFKA 3X1DA 4GC5A 2X0IA 3ESRA 4AJPA 1TZ2A 1Z82A 4U00A 4DLAA 1ACMA 1ZVKA 3JZDA 4PVCA 3KDPA 4JT9A 4TMKA 3WTCA 5JALA 3TE7A 2CXNA 1LRLA 1UQUA 1U7XA 1Z6YA 1PHRA 5EZ5A 4QTTB 1NQWA 4R1OA 1NR1A 1IQ0A 1A27A 4IEIA 4FFBA 3T1NA 3UUGA 1NLZA 5CYOA 3ZNQA 4B7ZA 1JR3E 13PKA 3EMVA 3EN0A 4YEDA 2J6BA 1IHXA 5COQA 5CUQA 4FNAA 2ZP1A 4ZKEA 4AXXA 3S3TA 3OJWA 1N3IA 4EW3A 1GPDG 2IZ5A 3LWNA 4FS3A 3GEDA 4GZLA 3RQIA 3M81A 3BK2A 1IY8A 1FC0A 2GARA 2HHHB 1UADA 1AHHA 2ORED 4JFAA 4PU0A 1RPZA 4TMXA 2H3HA 3DBVO 3F6YA 4MDEA 4OX9B 1XB2A 2W83A 3OEED 4OK6A 5KOYA 4FYIA 1TM2A 3H4TA 4M89A 1WXFA 1ZIOA 1U2TA 2NU8B 4EHKA 3IAEA 4TXMA 2YC2C 2O8BA 1I4TD 2IY7A 3LW7A 5BSRA 1I32A 3C1OA 4H4DA 2P6UA 1UP4A 3A6FA 2BBTA 1KRXA 2PBFA 1W87A 4BAZA 1W36D 3KT8A 4I19A 5BUQA 2C5LA 3AF0A 2ORVA 4K86A 5JDCC 2I2FA 5K51A 5LJIA 2JA2A 4D9IA 4BRSA 4QE3A 3TAXA 1UFOA 2FPSA 1A2KC 3JQFA 5JQWA 4DXAA 3DGFC 4DQXA 4Q1EA 3FYUB 4C20A 5EWMB 2ZYVX 1AO3A 4PF1A 3DWFA 2P9QA 5JJBA 1ZIXA 2RDMA 3FCYA 5LZ7A 4LX8A 3ZCSA 4HDMA 5BNFA 1D4AA 1E77A 4AURA 3OICA 3ND6A 3MSXA 3HJCA 1GYQA 5KYYA 1ZK3A 1EFRD 3PE3A 3HFRA 5EJ7A 1SIOA 4E5KA 1O77A 4H3HB 5D3KA 5B1SA 4Q05A 4KMMA 1ZUD1 3TL3A 4NH0A 5JNUA 4YREA 4BLTA 1U2PA 3MS2A 5DP2A 1U7OA 2AV6A 1PDOA 1ZY2A 3G49A 3S5JA 2G72A 3UPDA 1NW7A 1MQAA 3GRUA 3HI6A 1FTNA 1EP1B 3OT4A 1QH1A 1UXOA 2B4QA 3ZN2A 4MV5A 2VF2A 4GR4A 2QTVA 5GV8A 3A4IA 5EIOA 4DUYB 1FDSA 1FP2A 1KMHA 1AHIA 4F91B 1E9CA 5HFAA 1JVSA 1W36C 2C92A 4JV5B 1LF0A 1D7OA 2ZIFA 3EZ6A 1QU2A 4YCNA 3DGEC 4B6GA 3G2OA 2CJWB 5AM5A 2QTWB 3UNXA 2QDKA 3KZVA 4KXYA 3ETCA 1QF7A 1EYZA 1ZVQA 1RFGE 3ESDA 4RHFA 3BD7A 3EJWA 3ZZTA 5I9TA 2GS9A 4DNXA 4FGLA 3IEVA 5TRTA 1BXGB 3N2YA 3HSKA 2Q7XA 4MI6A 3TTWA 2DULA 1JEEA 3H2JA 4WOPA 3K5WA 4B0PA 1ZNYA 1B6TA 3NT2A 4JC5A 1YFLA 4NICA 1E3LA 1WY7A 5FUQA 2ZQZA 3KOUA 3TR6A 1ZD2P 2R6DA 2X4LA 4XWWA 1NXOA 3VTKA 1EG2A 3D2BA 5LA6B 4NCAA 3BSYA 1MO3A 4JELA 1L7NA 1QO0A 3OEHD 4TS3A 5FYQA 4I7EA 4MWDA 5TGDA 4RKYA 1X1SA 3K71B 3QMWA 4D3SA 3SFVA 3WQRA 2B78A 3NHAA 4FJ2A 1LD3A 4HDSB 1YGYA 3KOWA 3PC4A 3RC1A 2X7XA 1IATA 4IUDS 4WFIA 4D9NA 1CS4C 3LZDA 2WK1A 3QQPA 3RVSA 1EA5A 1LA2A 3QE3A 2J48A 4L0CA 3GMDA 2WAOA 1GL6A 3JQAA 1BCRB 1KETA 3ABZA 3N2IA 4HQOA 3C15C 4R7ZA 4RS4A 4X6XA 5T4HA 4BLOA 1TD1A 4JIGA 1SOMA 2B6HA 3LUFA 4I50F 4Z51A 1K6JA 1OQAA 4MS4A 4Z86A 3JQGB 2FDRA 2XWJI 2J7PA 5F33A 2EU8A 2FZLA 2YN0A 3EPPA 4DIOA 4D8XA 2CJFA 2G77B 1LEHA 1UBTS 1RDFA 3GYGA 3I2GA 3IBCA 3MWEB 1XLVA 2NUTB 2P9CA 4BKPA 2RI6A 3QWHA 4K5QA 4U5XA 5IAJA 1IZ8A 4H7IA 2BMVA 3HQ4O 3OHPA 4I4IA 4KE8A 4LTMA 2PIAA 3DFKA 2YINC 2CC2A 4HTFB 3RASA 4C4RA 3G2MA 5JNWA 1E5XA 3NBAA 3BX1A 3PXUA 4HN4B 2C2OA 3PE6A 3TTSA 3RK4A 1DBIA 3OG9A 2YUIA 1FFEA 1WZNA 1YL6A 1X42A 3QE2A 1JHUA 1CJVC 2EC5A 2ZRKA 3ITEA 5KUTA 3HRIA 1WX1A 5I7FA 1YJAA 3M7IA 2IV2X 5BVGA 1XTPA 3B7WA 1Z4JA 4EFKA 5IYZB 1Z6PA 1UBHS 3H2GA 4LBZA 2BFBB 4Q3OA 1Z26A 1NF8A 3PGXA 1XFDA 1JG2A 4UKDA 1KHTA 4V0KA 5TDHA 5E95A 4RDXA 3VC1A 4D79A 1RE0A 1NQOA 1YQ9A 2PQ0A 1WG8A 3N3AC 3NUQA 4NVRA 3CISA 2GJKA 2XE7A 3TPFA 4Z9AA 5E8JA 1YB2A 3M9XA 4TT8A 1LTKA 3NKVA 4OHPA 4QECA 4Q4AA 5JCXA 5JSFA 4HB2A 4PN3A 1Z68A 4Y1RA 2V3CC 3UIEA 4TOIA 2GPJA 2H2DA 2IZZA 1YZTA 5AI0A 3RK0A 3L1IA 2Q2WA 3FFWA 5HBRA 1JKMA 2DFPA 3E5RA 3K0AA 1IPHA 2ZI9A 3AGQA 2BFPA 1AN0A 1VA5A 4RACA 1M8FA 4R2JA 4DG9A 1T9GS 1T6YA 2G9UA 3HKEB 5EJ2A 3ZWDA 1BE6A 1MC8A 1E1CB 2B61A 4OYLA 2NGRA 2AG5A 5E1BA 3IP6A 3N5KA 5CB4A 1P0FA 4U7DA 4WOKA 1RXWA 3C3EA 3GARA 2NPIA 3MJVA 1L7QA 3BQNB 1P17A 4IDFA 2WJ6A 4RV5A 1M0EA 2BFNA 4CVNA 4Z1MA 4KH0A 3IDOA 3IDSA 4YWJA 3WLLA 2YWDA 1R66A 3F2IA 4MKGA 3I53A 3ADCA 2EFGA 4DXHA 1Y4ZA 4MRSA 3WVNA 2HEIA 5AVXA 3I8OA 1E8NA 1OXMA 1XCBA 1K06A 2R60A 3O9VA 4P4TA 1C1XB 1JTFA 3SQXA 3WA6A 2IEBA 1Q3KA 1JJBA 3ZDCA 3VJKA 4UHEA 3PFBA 1VJDA 1JKXA 4QGSA 3MCTA 2PKQP 3TOCA 5IF9A 1XLWA 1BCRA 1SHZA 4IIBA 2VT2A 3FOFC 1OWOA 2YJZA 1U28A 2Q5IA 3AWIA 3T15A 4AWXA 4YP9A 3B3AA 4Y2GA 1DKMA 3LHIA 1UIRA 4UULA 5BYJA 4AY4A 4GRAA 5E6SB 1BNCA 2D6FA 2PMKA 2Q1UA 1Z18A 4QM6A 2ZI4A 4X61A 4JU8A 1NFFA 2JZNA 4BVHA 5JJKA 4BJ6A 1ELOA 1PNOA 3GB9A 1AZSC 3A1NA 2X8AA 3NC0C 1A04A 4BB9A 3DMNA 4Y1EA 3WLSA 1TKBA 2QTHA 1OFHA 2ERYA 1HYBA 1A9SA 3QLEA 1V16A 3O8BA 1HUQA 3ODPA 4KDRA 821PA 3NTQA 2P5YA 5IH7A 1DKQA 2DPHA 4JBYA 3ZUGA 4S1WA 1JXQA 5B1IA 3DVQX 2WI8A 2QPTA 3H1TA 4KR0A 3OKCA 4S1OA 1A4XA 2R97A 5AP9A 1I5EA 1SCUA 2F8MA 4TQ9A 2JGDB 1F8UA 3GRAA 1M0TA 4XD2A 2PV0A 3AL0C 2I9KA 1SHTX 2O8CB 4MRPA 3WZ2A 1ZC3A 4XYMA 1JEOA 3NDPA 4KPFC 4EB8A 4LECA 5EHQA 4G5XA 1U8ZA 4D42A 2AR7A 2I87A 5TNXA 2XRMA 4CF3A 4Y98A 2H0AA 2VHXA 2FFBA 1W75A 2ISQA 2YV2A 1M7BA 4LDAA 2WJVA 2YWEA 2I7TA 3AP3A 2W6NA 4UBIA 4UOZA 3ER6A 1KEZA 1CS0A 1UOOA 1XG5A 4N5LA 4NJEB 5K6RA 2WWHA 5FA5A 2G06A 2H85A 4BLWA 4E07A 2WAAA 4CKBA 1QVVA 1P29A 4JJFA 2B2CA 1E69A 2I2XB 1K66A 3MCZA 3QVGB 4OLFA 4JJIA 2DECA 2ANCA 2WM8A 3W6NA 3HB0A 3RSLA 1S3FA 2Q3MA 2G17A 2YUTA 4FLFA 4ZALA 4MVJG 2H2HA 4JI8B 4S24A 1FYXA 2Z2YA 1G6Q1 1TLLA 5B3JC 3IAAA 5E1OA 5LXTB 3EFHA 2Z56A 3SHWA 3WL5A 2AS0A 2V03A 5FWNA 1U9IC 1BX0A 5L6MB 1T0HB 2IU6A 2VWQA 2HIAA 3FTPA 1FLVA 2MOKA 1Q1QA 1I0IA 1PVOA 1XCMA 4YMHA 3VYWA 1D5CA 1I3NA 4B4VA 4N03A 4FINA 2TECE 2FEOA 4MV4A 1TMKA 2GKGA 3HU5A 3KFLA 3S99A 3ROKA 3A3YA 1ST3A 1WUTA 5AI8A 2O59A 1WU8A 3H4VA 1AZWA 2WPDD 2G09A 1ST2A 1L4MA 1NDUA 2GERA 2OCAA 2YCBA 4WJZA 3IJ5A 2GZ3A 4PAQA 2UAGA 2IHYA 1OFVA 1N6OA 1U7TA 3MMZA 4UXIA 1X80B 2EX0A 4BQNA 2JGLA 4N0DA 4B3TB 1FP4A 3BHNA 2AUTA 3F0TA 3RTCA 3IBYA 2CVPA 5EE3A 2J0QA 1AHNA 4N41A 2FSVC 4XPZA 4J29A 5LDGA 3T7AA 4BQRA 5FAKA 5C0OE 4F9EA 5LQUA 1EJBA 5EQJB 2FFQA 3LFUA 1DC6A 4MB2A 3TI9A 4ZC8A 2QN1A 4V1CI 4BE9A 4NU0A 1PZXA 3U37A 3WHPA 2HEGA 2X0RA 4IEEA 4ROTA 5AK3A 4M1YA 3WMGA 2HMUA 5F5XA 1UK6A 4IDNA 2R8BA 1IHPA 2ZRAA 3AVPA 1NA5A 2VJKA 3ILXA 7MDHA 4DN6A 4YP7A 4CUZA 1JQBA 4ZMSA 3TLGB 3DTVA 1U1FA 2G1UA 3PUXA 1XQXA 5HIMA 2WWYA 3BWMA 3AR4A 4EKIA 5AHOA 3LC1O 3RGWS 1NJ8A 4YYEA 2H29A 2IXBA 4ND1A 3OF3A 4ZAXA 3IAM1 4CMJA 1V5IA 2C4MA 3BMCB 1GQOA 2NVUA 3DVSX 3SQDA 3TD9A 2V0GA 2N3ZA 1R4NB 2GJSA 2I99A 2HSJA 1SCJA 1QE0A 3FMPB 3BH0A 3W2EA 2FEWB 3P97A 3D0QA 3SQNA 3WLKX 4LSMA 3UBMA 4DIDA 1QG0A 2G82A 4LCEA 2YJGA 2HSEA 3CV3A 3S2GA 4AX8A 4RC9A 2IPNA 3JQEA 4I3HA 1ZMOA 4RHUA 1MV8A 4HH4A 4J1QA 4D56A 4IGEA 4UTVA 2BGWA 1CG6A 1AQUA 2AFHE 4G5RA 4RF3A 3SM3A 3VNAA 5AFSA 3RYCA 2FW0A 4C3ZA 2WKRA 1B4DA 4TL9A 3HN7A 4WZ6A 4UHHA 3A1FA 4DCJA 3R9IA 1X38A 2KBEA 2HLDA 3Q85A 4IJVA 1E8DA 3SE7A 3V6MA 3P2OA 2MYUA 4FEEA 1F48A 1P6QA 5F3DA 2BI8A 2NTJA 1U99A 2J3JA 2Z3VA 3KJNA 3LQYA 2HWWA 3OCVA 3QBTA 5CVJA 1I7QB 3KQLA 1K7EB 2DLCX 2EIXA 4MB6A 1CVIA 3T1OA 1TT5A 5TQ2A 1NXWA 4E21A 4ZRNA 4Q82A 1LSUA 2Q62A 5IUJC 3KKPA 4YMIA 4L75A 1M75A 2D7CA 2DHEA 2XE6A 1IYZA 4MYTA 4AMGA 2FUEA 1YZFA 5K4HA 1D2EA 5K20A 1KAHA 4QJ4A 3U2QA 3AETA 3P9SA 5JZMA 1MRZA 3QW2A 1SUEA 4HH0A 1YQWA 2QJTA 4ZQGA 4XDZA 4R0VA 3A0UA 3HS3A 1QE3A 4ZTBA 1K08A 4HGOA 2WKPA 1F4VA 3H04A 2CMKA 1P6XA 2MTBA 2ZWPA 4JGGA 5IAEA 2D2EA 3MBKA 4QHSA 1FPMA 1VYHA 4HP8A 4IX1A 1G3QA 3OPXA 1J90A 2G1JA 3DYIA 3GWGA 4S3MA 5JHGB 1OROA 1QPZA 1JLSA 4Q02A 5T7BA 3OZIA 3FVVA 4DLTA 1Z5NA 3EYAA 5KQGA 2D2IA 5KAPA 3MJDA 4OFZA 3FDXA 1XWIA 2DFLA 2VSXA 4F5WA 4A0FA 2VJAA 4HGZA 2RHJA 1PO7A 5UKDA 1QOQB 3AWDA 5CT5A 2VXBA 4XD7D 3EAFA 5EJ5A 1M1YB 2C2MA 4REQA 5C51B 2IE0A 4LJ4A 1LJ8A 5ITZA 4H3SA 3GL9A 4MUIA 1Q2XA 1IM5A 4Y2YA 5BOSA 4IVPA 3L8FA 2Y67A 1W5AA 2YXPX 3V8QA 4YA6A 4QG3A 1R6AA 2CD7A 2JIDA 1DUSA 2IXGA 3PG5A 3TD6A 3NORA 2YCLA 3IP5A 4NI5A 3RT7A 3BGVA 5CTAA 2OXIA 4JYZA 3QKRA 5D00A 2P2SA 3UV3A 1MKYA 2OV1A 3K3PA 3R0ZA 2FWBA 2EW1A 3KHUA 1N25A 1DFIA 3LS2A 4LDPA 2C82A 1OHHA 7AT1A 5EYPB 5BVHB 1JHVA 4KB5A 1BIFA 3AEUB 1M6NA 3LDUA 3ONDA 4O2BB 3WDKA 2GAJA 4O02B 4G0MA 4AZ0B 4L1KA 3RS7A 2GXAA 1NQTA 1V7CA 4QPCA 1M2VB 2O4UX 2QHXA 1TZKA 1MJ5A 2R6FA 3NC4A 4GT1A 2M1XA 2OFOA 1KOGA 1M2OA 3OOWA 3UKOA 3D8RA 4KAXA 3I04A 4LOHA 4FSDA 4A03A 5J2UF 1K7SN 2A2ZA 2UUCB 1E1LA 2I4IA 5TPWB 5CIQA 1RYMA 5ARCA 3SPXA 1YI0A 3A4TA 3A9TA 3KJHA 1NTOA 2YHUA 3K1YA 1L4EA 3TFOA 3O1IC 4I1RA 2WE7A 2WD7B 3JY6A 3GZJA 2BFDA 3QX8A 4EGFA 1QCYA 1YBVA 2ODEA 3KQWA 4NC9A 1KJNA 4GOKA 3T8YA 2BMEA 3AR2A 3H7AA 1DEOA 1VIMA 3TMKA 4I1PA 1FX1A 2C2KA 1Z62A 1N6LA 2A92A 3D2LA 1QXSA 1BD4A 4QVKA 1PS8A 4UEOA 2QTNA 3DD1A 1W1IA 1Y63A 3QF4B 3RTBA 5G0UA 3FOZA 4K6MA 4LZWA 4H77A 1MJNA 4RA6B 2VHJA 5ALEA 1JAIA 4TMVA 1K7FB 1FNDA 3FROA 4A6DA 2P7HA 2AZTA 3JVDA 1ZSNA 4HC4A 1RXSA 1H2XA 2HK8A 3GZTB 4V0LA 3VO8A 1KSFX 1I1NA 5DDIP 4X71A 3QYPA 2VFAA 2GPNA 4Q4CA 1MXFA 4Q39A 4C3VA 3FMFA 2IHKA 3HJBA 1QVAA 1PGPA 3ORQA 3MBOA 1MOSA 3IAS6 2IDKA 4G4SO 2RGXA 4TTPA 4TWZA 4EYOA 1NXVA 1L5KA 3X2EA 2RAPA 2Q1YA 2DBVO 3CEJA 1ZVVA 4NSNA 4A8TA 4M37A 1CNMA 1VYVA 4ER6A 1M2JA 4DYHA 5KNBH 3L8EA 3L43A 1SH7A 3QXSA 1GAJA 2H7CA 4JB0A 3U7QB 4ZCIA 3K8ZA 3UMRA 3DE0X 4DMFA 3QELB 1G8AA 2O3UA 3GZNB 3OLXA 4OKIA 4ZP1A 1L5MA 3VJLA 3O84A 4UTNA 1RNLA 1TADA 1R5OA 3MAJA 3U9SA 1UQTA 1KI2A 4WGGA 4BZWA 4W9NA 3VA7A 3DHVA 4QT0A 1GTRA 2GESA 4KJXA 2CBGA 4BU1A 3F6BX 4FYVA 1U7WA 2FWNA 1M72A 4K7JA 2R9VA 4LWZA 1YDWA 3FHCB 5NLLA 4YMGA 1RPAA 4TS1A 3WL7A 2I78A 2POCA 3SEAA 4GP7A 4CM6A 3SVLA 1KZ9A 1RYHA 2PD4A 3VBCA 1FIUA 4LVUA 5FWYB 3M49A 2GF9A 4FWBA 4A8JC 2Z1NA 2GM9A 1EVIA 1WABA 4UJ3A 4XYBA 4GVLA 4YT5A 1XRSB 3K8OE 3R3SA 1DKOA 4DQDA 4DILA 5IDVA 1G8GA 4OO3A 1KTIA 4EHBA 2VDKB 4RE6A 1WQ4A 4UCQA 4MI9A 3VDQA 3L6RA 6Q21A 4G36A 2ZQYA 4D4MA 3V9PA 5CGZA 1VYUA 3EEBA 3OD1A 1FX0B 3WV4A 1X7XA 4UHCA 3H2YA 2HXYA 3HYNA 2Q5EA 3EQ2A 4YV1A 4ZHQA 1NUTA 2H4XA 2JFXA 2FJPA 1NXSA 3TW0A 3FNIA 3C3XA 2P67A 1QQ7A 2QENA 3JYLA 3HJHA 2XRZA 2R0QC 1GLGA 2QD4A 3AOGA 5K3FB 3WQQA 3GUCA 1JILA 3F78A 3DEIA 1XZNA 3K96A 5AXCA 5HCNA 2JHAA 1N77A 1SN7A 5B55A 2ZSFA 3UMJA 1G20B 1PV2A 3CY6A 1G9XA 2Z1DA 3G0GA 1EHYA 4MROA 3ER9A 3MT9A 5EVCA 1FYWA 3CF6R 3KB6A 2QU7A 3FCAA 5EHXA 3KJIA 2QMOA 2VI5A 3P8ZA 5BXQC 1Q6YA 1Y8QB 1EMDA 4KHZA 3QXHA 4RIHA 4UAVA 1QKIA 4CF4A 4J0JA 2ZBGA 3ZDXB 1EFCA 1RHKA 2XZTA 3KPJA 4HSGA 4HLNA 4ERXA 3FCSB 4DUZB 2BTOA 3T6KA 1H9BA 1X9IA 1ORWA 1KY4A 4QJ5A 4E51A 4L0QA 1ADCA 4CXMA 4F12A 1YA6A 1R8SA 2VDWA 2ZIUB 3GN2A 2FMUA 3OPYI 1LTHR 3N76A 5AXAA 4GX5A 3DG9A 1K6EA 3PWZA 2P2CA 1QJ4A 1JAYA 3FXAA 5F7JA 4RIGA 5FI0B 2NNLD 3G9ZA 4A23A 3AEQA 2H1CA 4I66A 4OI4A 3HB4X 4PM4A 4PLPA 4Y18A 4DAEA 5FPSA 4HVCA 2IYZA 2LDXA 4EVRA 2WM2A 1NYQA 1L9XA 1V43A 2XEXA 3EIUA 4B09A 3GLIA 3Q2IA 5KTYA 2IUSA 2ST1A 2P6MA 4F3TA 5J9FA 5I8ZA 2QR3A 3L4BA 1TQHA 1QHSA 2CHVA 3HDYA 5IT0A 1W46A 3BA1A 3BF7A 1GGMA 4O4LA 3KXLA 2VHYA 2HRZA 3IV9A 4IINA 3ZWVA 4M55A 2B69A 1T9CA 1Y1PA 3MJHA 2C9BA 3NLLA 2UZ1A 4ESHA 3AHGA 1KJWA 3MLAA 1T0JB 3IPXA 3UWPA 5AUPB 2DTDA 4KN8A 4CIWA 1A69A 1UJCA 3C8HA 3KKNA 3KZCA 3EVBA 2JAXA 1OU4A 2Y4OA 4MVJM 4PAMA 4XFDA 5JY1A 1WDWB 1KJYA 4G1VA 3BDIA 3M6WA 2DWQA 3HU3A 1XTSA 2TMDA 3OY2A 3PJGA 3X1XA 3O2NA 2AC2A 3IBFA 1GTL1 5LQMA 2BAGA 2EJWA 1Z16A 4RVUA 4B83A 4GM4A 5JYEA 1U7UA 2ON6A 1QS0B 4ZZ0A 4YHHB 3QHQA 4EG1A 4V38A 1FW6A 2UVQA 1P61B 1Z74A 2X2PA 5CU7A 2AOUB 4BVJA 3GN1A 1CUJA 1BS2A 2ZVDA 4HFJA 3VYTB 4HGPA 1BX3A 2LKCA 1JVBA 3CTPA 1O89A 3W8EA 3B1YA 1H22A 1HDEA 4XYEA 1VKZA 1FVXA 1BJKA 4DW8A 3I23A 2FKAA 1GUAA 1CJUC 1SKYB 2CDAA 3RAFC 1BO6A 2CV2A 2QD1A 1IULA 2NLOA 4WESB 3EGXA