221PA

Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEESYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of H-ras p21 mutants: molecular basis for their inability to function as signal switch molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
molecule keywords H-RAS P21 PROTEIN
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1991-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 221pA00
2OFWA 1CXZA 4NE2A 3B13B 1KO8A 3AF4A 1EX6A 2F1JA 2WPDD 3T61A 5GJBA 1F48A 3CNOA 4AD8A 1CJVC 3CZQA 5DN6D 1E6CA 4PANA 2JLZA 4G5QA 2AXNA 3BERA 4NCHA 1JQLB 4AYWA 4EFMA 4BPBA 4TQAA 1NJGA 1V5WA 1DAMA 5JCZA 1LFDB 2EW1A 3SR0A 4W5JA 2CJWB 3PV0A 1QHNA 1ZP6A 1XP8A 1YZLA 4LJ9A 2D06A 1U9IC 1G8PA 5JZVA 1R0ZA 1N6LA 1W4RA 2AX4A 2X2EA 3I4LA 2JATA 2WJHA 2V54A 4MYHA 4D0LB 1UF9A 2E87A 2PEZA 1Z63A 1OH5A 4WZ6A 4R9UC 3OHMA 2FA9A 2ZANA 1NVWQ 1NN5A 3Q5DA 4KSBA 2C95A 2QI9C 1F3OA 1E9CA 1AQUA 3GJ5A 3RLFA 1SXJD 3IBYA 4CT4B 3BH6A 3BXZA 5KNCA 4M9XA 4YMSA 2VHTA 1J99A 2RGEA 2IEZA 3AKEA 4BRUA 1OH8A 1AM4D 2UZ3A 1JR3E 1IN6A 3C5CA 2FGJA 1SKYB 4RD1A 2ZI7A 3QNUA 2VL7A 2HJVA 5GJVC 3U3KA 3W5IA 3RWMB 4KODA 3OE7A 5CK4A 3UIEA 2ZRPA 1TADA 5LD2B 2PMKA 2PLRA 4IW3B 3WP0A 4B35A 4OI0A 1OIWA 2W6IA 4P32A 1EWRA 2PJRA 3LY5A 4JJZA 4QL3A 3ZVNA 4LC0A 5FR1A 1EFRA 2BKUA 1VG1A 4KITB 4QC2A 1E2MA 1KTVA 4TLCA 2F55A 2MSCB 2JJ1A 1E99A 2G1JA 3GLHA 2FFBA 4DSUA 1J70A 5D3QA 4IOJA 4FWTA 1Q44A 3KJHA 3ZH9B 1QZXA 1WQ1R 3UMFA 1F2UB 3IKJA 4LPSA 1G7SA 1UBEA 3SJAA 1P61B 1PZNA 5JWRA 1HYQA 1OSNA 3J81k 1XPOA 3WNCA 1XU4A 1ZCBA 4IDNA 4BZQA 2OCYC 3BJIC 1XTJA 2DHRA 5HZHA 4KAXA 1VYUA 4MUAA 4PZYA 4DKXA 2XJ4A 2BM1A 4NYMQ 3B85A 5DHFA 5DYIA 4F7WA 2RGDA 4M1TA 1TEXA 2GJ9A 2YOFA 2Z4SA 3EIEA 3ADCA 3U60B 4GZMA 2C5LA 4JKIA 3H4MA 4KFTA 1JEDA 1ZM4A 2Z83A 1TF5A 5HCIA 5HE8A 4AG6A 3KX2A 5LDDC 2NIPA 5KDOA 4AY2A 4BFUA 5JHGB 1R6BX 2EFHB 1Z06A 5KPDA 3WMFA 1UDWA 3D6TB 2NO7A 3LLMA 1Z0AA 1XJCA 2ZI4A 2ZE6A 3QKTA 1KY3A 1NLFA 1ZIPA 1G3RA 3T1TA 1MRNA 2V8OA 2ZSDA 4JZKA 2QY9A 4UNRA 1P9NA 1ESNA 1P2SA 3MFYA 3TSOA 2DWOA 4OYHA 5E3HA 4C0JA 1R4AA 2V6JA 1ZD9A 2ZRGA 3MRSA 3H0KA 2MSEB 2CNWD 4LC1A 1X8KA 4ERNA 2YOGA 5CJPA 1DG1G 1E32A 4ZDIA 2GCPA 5FPYA 3SC3A 1YRAA 2ZR7A 5FPSA 2OHFA 1GRRA 3U61B 1P9WA 2WMNB 1E1QD 5HPYB 3O47A 1ZCAA 4RD6A 5KDDA 3FKQA 3GP8A 3ICEA 4LCBA 1CU1A 1E9RA 3U6KA 4HAZA 3PEVA 1D2EA 2J7PA 2ZEJA 1IBRA 2J45A 4Q01A 4NMMA 3EXAA 2D7CA 3C15C 5AWFC 3X2SA 1OLOA 4EPYA 2XNDD 2ZR9A 2EWWA 1U2RA 4ITRC 4Q9KA 5CJ2A 4D4KA 2HYDA 1DO2A 2VSFA 4M53A 4XTCS 3CBQA 3PCRB 3NWJA 2QTFA 2ZSAA 1EXMA 2ZS7A 3LAWA 3VNVA 1RRFA 4A9AA 1Z0DA 3AP3A 2O8EA 1EK0A 1JR3A 3BIFA 1E2QA 1GVNB 4D0NA 2XZOA 1TQDA 2BDTA 4URUR 5C46F 4WZBE 4ACBA 2WKPA 2ZJAA 4P0TA 3V4FA 1QRAA 1XTSA 3AP2A 3DEFA 3W3AA 4B3DA 4DWJA 3U7FB 4LHZA 1JR6A 1P3JA 4KSCA 2P5TB 4TMTA 3WXMA 1WA5A 3WNBA 1R2QA 1UM8A 1P6XA 3RABA 3SE0A 3UANA 3VX4A 3LQQA 3SQXA 1Z29A 4P4SA 2ANCA 4LHWA 2P65A 4D25A 5JHHB 3D8BA 4Q48A 4E09A 1DEKA 4Q02A 2GJ8A 4WVFA 1KZGB 4BFZA 2HJGA 3KFXA 1P2TA 2QGZA 5FL7A 3T1OA 2DFNA 4IOKA 4TYQA 3ZD7A 1ZRHA 2YZ2A 3A1VA 3K70D 3I62A 1N0VC 4PSVA 5KUTA 4PSAA 4HB2A 3TW8B 1ZUIA 2GJAA 4URWR 2QG6A 1KDRA 3B78A 2ZETA 5FTLA 3AVUA 4B48A 2VTKA 3DM5A 2QN6A 1W4CA 1NKTA 5KSYA 4HAVA 4EJSB 4F4IA 2O8BB 3A1SA 3GLIA 2MMCA 2R9VA 1P4SA 2OLJA 3N70A 4OK6A 3FDIA 3QPWA 1AS0A 4MGYR 2JJ1D 4X8LA 4DCSA 2JLVA 3PEUA 3PUVA 1KMHB 3IHWA 1NMYA 3ZVLA 1US8B 3I92A 1HURA 3EPKA 2RKOA 3NTUA 4G0NA 3W5JA 1XXHE 5IK2D 4LSGA 1IQPA 2FSFA 4QJ3A 2H7VA 1Z3IX 5DHAA 4BWYA 4LPKA 4QGAA 2YINC 2WJVA 3ICQB 3BWDD 4G01B 1KO7A 5JS7A 2HDNB 2FNAA 3DKPA 1XF9A 1SVWA 3LBHA 4KYIB 3MD0A 2WJGA 4GRAA 2ZROA 2ZREA 3QBTA 2V9PA 1IJFA 2OXRA 5FTKA 3TVTA 3FHTA 2CLDX 2VP2A 4RZXA 1Q3TA 3DVLA 1V43A 3RSOA 1KI1A 3O8BA 3N5CA 4PZZA 3T1VA 2Q9CA 4JT4A 2GCOB 2IK8A 1Z22A 4QRHA 1A2KC 3KKQA 5ANRB 2ZRDA 2ZRJA 1P75A 3TAHA 1RJ9B 4Q9LA 3QENA 4PX9A 4IFBA 5K8TA 2Z4RA 2V7QD 3FFBA 3RRZA 3TJZA 1N3BA 1T8TA 4HLCA 4EIWA 1DOAA 1JPJA 1TF2A 2W2XA 2RGNA 2CNWA 4C2TA 1KI6A 2QP9X 2RCNA 4GBMA 2VF7A 2Q21A 3U7GA 1KI7A 1X86B 2BMJA 2UKDA 3T06B 2XTNA 1BH2A 2RGBA 3CR8A 3S1AB 3QQ5A 5EJEA 1R0YA 4IDQA 3CRQA 1G8YA 4PQYA 1DVRA 1M2OB 2QORA 1B0UA 1NBMA 1IHUA 1KO4A 1YZTA 4DDWA 3F8TA 4DDTA 2HXSA 421PA 1S1CA 2V3CC 3W90A 2X8AA 1I4TD 2WOJA 4A2PA 4Y0VA 3PQCA 4R2HA 4PQRA 4GMDA 5LPNA 5AUQA 3B9QA 1S1MA 3IHLA 4LJ7A 4U5XA 4CGZA 2V55B 4HYYA 5KTYA 1WBBA 2QBYB 1NVUQ 2YJTD 3OZXA 5L3VA 3BBPA 3K9GA 4A2WA 1GL7A 4IVPA 2X2FA 1D5CA 1G3IA 3ASZA 2VSOA 3CF2A 4PO8A 2XITA 3KUCA 3T5DA 1T5LA 4Q00A 3PITA 4NYJQ 5EXTA 3TUIC 2XX3A 2DB3A 5EZ5A 4LHYA 2IYWA 4TSFA 1SVKA 4Y0AA 1EFRD 1GKUB 2GJSA 4OQMA 2LKCA 3F0TA 1II0A 3CRVA 2IUTA 1E79D 2VP0A 4CEJA 1UBGA 1FX0A 3DMDA 3QKRB 5AJWA 5IHPA 1W49A 2P5SA 4RD2A 3JVUA 2ZYTX 3Q5EA 3FFAA 4OJKA 4FCVA 4KBFA 3KJIA 2J46A 2RGGA 1DAEA 4TT3A 4C0LA 3M0EA 4UNQA 1U94A 4ARZB 4C0BA 2IBMA 3QKUA 4JYBA 3SOPA 3BFKA 3GJ6A 4BLQA 2V7QA 4HLDA 4N3NA 3U2QA 4HLUC 2F9MA 2G88A 3ZIAD 1WXQA 2JIZA 1WMSA 1LNZA 3KJGA 4LJ4A 3TW4A 2QU8A 4BFSA 4B44A 3AVTA 3P26A 3LNCA 5FTNA 4OHWA 1E94E 4B2PA 1IAQA 1FW6A 1W1WA 3EZ9A 1NVXQ 2ODBA 2O8FA 3DPUA 1ZM9A 3U44B 3G0HA 5AK0A 1D2MA 2FE4A 4B32A 1W2HA 5IDVA 3OIYA 2GVDC 4DBLC 4M22A 1KSJA 2VHJA 4KLZA 1CRQA 4TQUS 5DI3A 1XPRA 1GWNA 2KBEA 3HPQA 3TBKA 2RB4A 2GF0A 2IYQA 2NQ2C 2QGNA 3NXSA 5FBLB 4B71A 3GLGB 1LVGA 5KNDA 4HAWA 1O3YA 1TQ4A 4TLEA 1RE0A 4P31A 3IPYA 4LBYA 1OB2A 2GK7A 2KSQA 2ORWA 2EWVA 4RD4A 3CPJB 1XDBA 1NN0A 1YE8A 2XNDA 1EFTA 1KAOA 4P3YA 4A8JC 4NBSA 3I72A 1GNQA 4TL6A 3NDBB 4DLYA 1E0KA 2P3SA 3CWZA 3VU9B 2OM2A 4JLDA 1CULC 2BCGY 1MABB 2OEPA 2C96A 2FSIA 4LJAA 1GL9B 1TL7C 2FPMA 4RD0A 3KKNA 5FBWB 5E95A 2PEYA 4TMWA 4XJXA 1YHNA 2YOHA 5CDFA 1GRQA 1YZUA 2WWXA 4GFDA 3EA5A 3JZMA 5JRJA 3IDQA 2L0XA 3MCAA 1ZUNB 3EZ6A 2GKSA 1YZNA 3CX7A 2QPTA 4AIIA 2QAGA 4PAQA 2IYTA 3EZ7A 3VFDA 5H8WA 2ZE5A 3IEUA 2FJUA 1AA9A 4OHXA 1QHIA 1YR6A 1QG2A 4NHOA 2NO9A 3C41J 2EYQA 4Q1EA 4AK9A 5LD2C 4FMCB 5CITA 2XOKA 4UKDA 2Q3HA 2IHBA 2QSZA 1XMSA 5DISB 3PUZA 3GJ0A 5TV2A 3H84A 3P27A 4OQNA 1JB1A 2XZPA 3VTKA 4DLUA 2R44A 1ZM3A 3EX7C 4R71A 3THYA 3ZGXA 4YXWD 3KUDA 1QBKC 2R6AA 4JVSB 4YDHB 4Q1AA 4Q9IA 1A2BA 1GSIA 721PA 1G3QA 2G9NA 2WWIA 1NMXA 2RGNC 3B5JA 2FMXA 5J47A 2V6IA 4KXFB 5JMTA 3NH6A 1SXJE 4LHVA 5EXXA 4YXWA 4XSGA 3CH4B 4H1VA 4IDHA 4BRWA 4CEHA 4MGZR 2IYXA 1T3SA 1UFQA 2ORVA 3ASYA 1G20E 2WZQA 3H2YA 4NYIR 2KWIA 1S8FA 3LVRE 4I1OA 3AGPA 4CEIA 1R5NA 1N25A 1D8TA 2GEVA 4D0GA 1TNDA 1U98A 2J0QA 2H17A 1G4AE 1GILA 2IXFA 4FCWA 4W7SA 2XJ9A 1LW7A 1S2MA 3Q72A 4G5SA 2NO6A 1VYVA 1DO0A 4D82A 1E2HA 4JLOA 5JI2E 3HJNA 2DR3A 5E7MA 2ODWA 3ZQ6A 4I1UA 2CHVA 2GK6A 4TMKA 4DLSA 1XCGB 2W00A 2PLFA 1XD2A 5UKDA 5H1YA 2QA5A 2C9CA 5JEEA 1BYIA 5M04A 4V0NA 3AV0B 1ZAKA 5FPTA 2BC9A 2ZI5A 2JLRA 2JLXA 2PH1A 4BLOA 3LBNA 3PXGA 5C2JB 4DJTA 1E2NA 5L3SB 5IRCD 2QQ0A 2CL0X 2ZPTX 4D4MA 1M6NA 4V0LA 4HZUA 1W5SA 3DM9B 2IYSA 4MH0R 1TF7A 5BN3A 3NVAA 1SVMA 2R6CA 3SZRA 2C98A 2PT5A 4FN5A 1MR3F 1W0KD 2CHGA 3K09A 5HTKA 1RRCA 3CX8A 2ZRNA 3B6EA 4PFSA 2C78A 1G7CA 2A3RA 3FTQA 5K8UA 2ZQ5A 2QPOA 1DPFA 4OI4A 3EPLA 3FGNA 2J7KA 4A0RA 4DIEA 1E9AA 4BUJA 4DT1A 1ZIOA 4GOKA 4YLGA 4BFVA 4GMXA 3NC0C 2I4IA 1S3SA 2FEMA 2B7BA 3DKVA 3IPXA 2RGAA 3F5FA 3IO5A 2QAGC 1GNPA 4CF7A 3CWQA 4PAMA 3LDAA 2C9YA 4KU4A 4OK5A 3MUFA 5JCPA 3E1SA 3OFND 3THWA 4ZV4A 2XSZA 2H57A 3VR2A 3KQKA 5EE1A 3MWYW 1HQCA 3GFTA 2IS6A 1Z2CA 3MAAC 1AN0A 1K5DA 4A82A 4OBEA 4JT2A 1KDOA 4PSKA 3K0CC 5F9HA 1E2PA 1FUUA 1OB5A 4LJ8A 1NI3A 2JJ2D 4IDPA 1MABA 1T91A 4A0FA 3TK1A 1GAJA 4B73A 3SS8A 6Q21A 2REOA 4ILEA 3NHBA 4XOIA 1G5PA 2Z43A 4DEXA 2I1QA 5EUQB 4HLQB 1P73A 2BOVA 2GVZC 4Z8XA 4XVQA 1GNRA 5HE9A 1DBSA 2CVFA 2Z6VA 4RY2A 2A5JA 3W6OA 1GDDA 1MO6A 2P6RA 4LWZA 3CB4A 2ODEA 5G3ZA 4JVLA 3WMEA 1E2EA 3I8SA 2A30A 4KJZA 4MQBA 2FEOA 2DWQA 1E4VA 4ZIRB 4MRVA 4TL8A 3P32A 2ZSFA 4KLNA 3LXXA 3L0IB 4HB3A 4V0KA 1ELOA 2VP6A 4NCNA 2GWHA 3ADBA 3AVWA 1SULA 1A4RA 3EW9A 3FWYA 1XMVA 4TLDA 2GEDA 2TMKA 2P0EA 2QEQA 1UKEA 4Q4JB 5J5CA 3IUYA 1UAAA 5CLQA 2WICA 3BC1A 1CBUA 3AKCA 4TTQA 1ZNZA 3QG5A 5LB2A 2WM9B 1Z6TA 1G16A 2O8FB 3AVQA 1MH1A 1U9IA 3TMKA 2I1VB 3RDPA 1HQYE 5GJWC 1AS2A 1RZ3A 4UXHA 2CEAA 3RYTC 2EQBA 2P6UA 3E70C 2ZAOA 3QOFA 1C9KA 1P5ZB 2WJJA 1SXJB 3BORA 3X1YA 2XOKD 3A1WA 3G5UA 4PC2A 4Q47A 2IT1A 2CVHA 4IOLA 1S9DA 4U7DA 2WWYA 4AKHA 4FMCF 3ADKA 2JEOA 3QIAA 3THXA 1OFTA 4YC7A 4RKFA 3GMTA 5KNBA 2QT0A 2ZS9A 1GIAA 4US2R 3O8RA 3PR1A 2QP3A 1A5TA 1UKYA 4MRRA 1NJFA 2QRZA 1M74A 2W58A 3DO6A 4ON9A 1G9XA 2YVUA 2ZM5A 1FX0B 2O8CA 4M9QA 1OV4A 3EIHA 4CEJB 3D7MA 4HB0A 2DPXA 4LJYA 4HAUA 1SKYE 2PZFA 1W0JA 1E2KA 1X6VA 3CKLA 5P21A 2ZRCA 3B60A 1KDPA 1BKDR 3CRRA 2E1RA 3RS3A 4YONB 2BKEA 4KFUA 2A5FA 2F9LA 4Z1MD 3RC8A 1ZBDA 1XX6A 4EPRA 2G3YA 4PAOA 5KYKA 1E9EA 1EG7A 1XZQA 1EX7A 2BMEA 1EESA 1KAGA 2GILA 3ND8A 4ZCMA 1KSHA 1QHYA 3CM0A 3UPUA 4DCUA 3IEVA 3FE2A 3PFIA 1ZC3A 3PJRA 4Q4AB 1P62B 4Q7JB 3W8RA 1E1QA 3KXIA 1QG4A 4JLBA 1UBFA 2OE2A 1WF3A 3OIVA 2GHIA 1ESMA 2D74A 1R8SA 4HI0E 3VKWA 4B6FA 4OHVA 4JBXA 3IIKA 4JJKA 5K8IA 4MGIR 1OT3A 4C7OB 5C4MA 2ECKA 4LX0A 2GAAA 4XTRA 2OFOA 4TYPA 4GPTA 2IYZA 4B6EA 4JVNA 3FB4A 3U7HB 1EWQA 2BIFA 2ZUBA 3QUSA 2KI5A 3HYTA 2OZEA 5CM9C 3ZQJA 3ND9A 4S2EA 4B34A 2JDID 2F43A 5DNYB 1AQYA 2FSHA 3KQLA 5FPHA 3OEHA 3Q3JB 4PC3A 4HDCA 2ZXUA 2WBLC 1QVAA 2XB2A 4ACAA 3GJ3A 1KI6B 2PMDA 2OCAA 4KHZA 3RHFA 1JECA 4BASA 2A7QA 3FHCB 4JLNA 2VHUA 1LS6A 4GSYA 1E2IA 5HCNA 3SJCA 1TQ2A 2D4HA 1TX4B 1SXJC 1C4OA 3L2OB 2WWFA 4GZLA 1P60A 1E1RD 3GD7A 4MDFA 2CCGA 2C2HA 1UJ2A 5TB5A 1OYWA 4CYMA 5AJVB 5BW8A 3DMNA 2F43B 3RRMA 2BV3A 3A58B 3JZAA 3VR3A 5EP1A 4MUBA 1IM2A 3WP1B 3LVQE 2FOLA 1M8PA 1N5JA 5E7JA 1EFHA 2VA8A 3IIMA 4ZI2A 4C7OA 2LCFA 1PVOA 4LJ5A 4F4JA 3L8ZA 3ZLJA 2OLKA 3KFVA 3K8YA 4QOSA 4EFNA 1IY2A 4DZZA 3IGFA 5EXPA 2WHXA 3UMRA 2JASA 2GRJA 1OW3B 1KMHA 5FFMA 1VIYA 4Q4AA 2BJVA 2CMKA 1J2JA 3IO3A 2PZEA 2EFGA 2G1KA 4GP7A 4A0GA 1ANKA 5FR2A 4DCVA 4Q7LA 5EE5B 3VKGA 4AYXA 5DE3A 3GLIB 4PHFA 2RMKA 3W6NA 5KO2A 4IVRA 5J40A 2QT1A 2ZJ5A 3NIBA 1T9HA 2AKAB 2XEXA 2N1BA 1JAHA 2QPAA 4Q1DA 3U3RA 4UNSA 5CYPA 3AVYA 1DADA 1NBMD 3HU1A 4LDJA 4QHSA 1Z0JA 1ZMXA 3NEYA 2O8CB 5G41A 2ZVQX 1R0WA 5EE3A 1WP9A 2X77A 4ZCLA 4I1SA 1XNJA 3BK7A 3SNHA 3K70B 4JVMA 2JJ8A 4DLZA 5J4VA 4D6PA 3I73A 1VKJA 1J8YF 1XMIA 3THXB 1JBKA 3AB3A 4OK3A 1KJWA 4Q21A 2B7CA 3ZVMA 1NG9A 5BXQC 5CB8A 4JLKA 1HH4A 1SXJA 2ZJ2A 1HT2E 1TU3A 2IYYA 1RKBA 4TMVA 3U3JA 1E0SA 3NEJA 1RVDA 4IFEA 3OEED 4B3GA 2YWFA 1Z47A 3T35A 4I1VA 4II7A 4R98A 2JA1A 4JS0A 3RSLA 1MO3A 1ZVQA 3PVSA 4ABYA 4ESHA 3EIQA 4C9BA 1XJ0A 1FOEB 1W4AA 3U3MA 4JSTA 5B2ZA 4A4DA 5TDHA 4Q4JA 1IY0A 1U81A 2J87A 2ONJA 2WTUA 3R20A 1T8UA 3SBEA 4XD7D 3ZS8A 1F6BA 3OESA 3TVDA 4OI1A 3I5XA 2WIBA 3K70C 1YKSA 2R6DA 1UPTA 2ZJYA 4ZIRA 1QHXA 1DTSA 1Q22A 1NVVR 3B1XA 3NHAA 5AJZA 2JLYA 2FF7A 3WRYC 3MGCA 3V9PA 5FUXA 5J4KA 1KNQA 4NPHA 2ZIAA 2P67A 5CK5A 2CCJA 4NP6A 3CF0A 1SVIA 4Q1FA 1L2TA 4H1UA 3KXKA 3LRPA 1GKYA 3L43A 2F1HA 4M2LA 4PC6A 3DZ8A 1OH6A 1Z0FA 1XEWY 4M1OA 2VHQA 4WW0A 1VG8A 4R2IA 5GVSA 2FPKA 3C5HA 4XWOA 1JJ7A 3LW7A 2OV2A 4UXJA 4A92A 1ZJ6A 2A2ZA 1RFLA 3C7KA 4M1MA 1CEEA 1P2UA 1FNNA 1G6HA 3E2IA 4QHYA 1HEIA 1YJ5A 1VPLA 2ZS8A 4HB4A 5CIQA 1J90A 2PX0A 3THWB 2J0SA 3ADDA 4CT5A 2QENA 2QRNA 5JBQA 1TAGA 1IJEA 1KYIA 1X8LA 1NN1A 1YQTA 3CUEF 1OPXA 4HAYA 1WE2A 5ELXA 3PEYA 3KL4A 3QJYA 1E0JA 3NBYC 3K1JA 4O2LA 5DGXA 1ZU5A 5FOVA 2V1UA 4S35A 1L4UA 2IF0A 1P7CA 4B74A 4US0R 4W5WA 1GP2A 4QBGB 2K5UA 4DT1B 1PUIA 4PHTA 3UATA 5AUOB 3T12A 2Q9BA 4OQXA 4JYCA 4EKDA 1JXMA 1GG2A 3NKVA 4MITA 2OXCA 5JRZA 1DE0A 4E03A 3SI7A 1XBTA 1KK1A 5A5GA 2WV9A 1GM5A 4A1FA 5AR1A 1OFIA 3A4NA 1QF9A 3LH5A 3ZZ0A 1OHHD 1ZM7A 1XTKA 4TTRA 1S9HA 1G8HA 1NKSA 2B21A 5BYJA 4B2IA 4HZUB 2QAJA 3RNLA 5DO9A 3GLHB 1SVSA 2H16A 1Z08A 1N2CE 5L3SA 1CLUA 1PLJA 4MKFA 1R5OA 1W0JD 4NTZA 2DY1A 2NO1A 4PPNA 2ZRAA 4OHYA 3EWSA 5TXGA 2IXGA 4XWAA 5KSZA 1Q12A 4DIDA 3MJRA 2FG5A 2BBOA 1CR2A 4TYNA 4PPQA 3R9XA 1XD2B 1OE0A 2AWOA 3U3OA 4IXNA 1H8ED 4GOJA 3KZ1E 2VLIA 4X8MA 4DLVA 1XEWX 1FMJA 3RAPR 4DRZA 2ZRKA 3KJEA 1OIXA 3W8NA 2WKRA 4I4LA 4GOXA 2HT1A 4PTLA 2R6GA 3K53A 5GVRA 5IT5A 4IRUB 4FMDB 1SZPA 2IF2A 1TQ6A 2OO7A 1Y63A 1NNEA 3PIRA 1E79A 2BEJA 1T3LA 4CEIB 1M7BA 5DLQC 2Z0MA 1YR9A 1IXRC 1D9XA 2ZU6A 2GTPA 3KB2A 3RANA 3UWOA 3TH5A 1KO5A 4WIAA 1ZINA 3QPVA 1OFHA 4MKGA 4CEHB 2NZJA 4LJ6A 4JL5A 3AUXA 1OFUX 1UKVY 3FKSA 4RVCA 4O0MA 4ZDKA 3KKOA 3EPJA 3BE4A 2O0HA 521PA 1KSFX 3GJ8A 4HEJA 2BMDA 1U0HC 2AKYA 4QM7A 4JLMA 4F4CA 4Z8YA 3QVVA 3X1WA 1MT0A 4DXAA 2BBSA 4LK2A 3NH9A 1AKEA 2OSBA 5FBQB 5KOYA 1COWD 2W6ID 3Q7PA 4RSGA 3FKSD 3C14C 2O5VA 2W2VA 3THYB 3A8TA 1XTIA 1FFHA 2CCKA 4DSOA 1VECA 1L7VC 1MRSA 3TNFA 3B1WA 2AL7A 4NL4H 4QBHA 1E1RA 2HYIC 5HZKA 5B58C 4E5UA 1W36C 4D2IA 2YKGA 2QMOA 1N6OA 1CS4C 1DAFA 1PV4A 2KB0A 2C99A 1XEFA 4DSTA 2AFHE 2QMEA 4C0QC 1IN5A 4BEJA 2QAGB 2IA5A 3K0CA 1IN8A 1UEIA 3EPHA 3BB4A 1RRPA 3THOA 1LTQA 1IXSB 2AFIE 3BAFA 1QHSA 2CDNA 1UDXA 5HKKD 2HLDA 1ZW6A 3B1YA 4XVUA 1G1MA 3B2EA 2AR7A 1KI2A 3K0AA 2FV8A 4M9SA 1VG9B 4MDEA 3R9IA 4B2LA 4EUNA 1ZNXA 4CVNA 4OL0A 2NMVA 1F5NA 2Z5FA 2AK3A 3AP1A 2XZLA 5E4FA 4UJ5A 1J7KA 2B6HA 3VU9A 1GKIA 2NG1A 4A8JA 3KTAA 3TIFA 2WPDA 4RFSA 3GCGA 4RFVA 1YR8A 1MV5A 2EU8A 5JJKA 3M6AA 1KNXA 4BE7B 2FDCA 3QKSA 4GDFA 1XWIA 1O87A 1KKMA 4FWIB 3GLGA 2F6RA 1U0LA 1FQKA 2UZIR 2WSSA 4ZO4A 1VG0B 4U02A 1T4GA 1KZ7B 4XH9B 3A1TA 4JBYA 5FOWA 1W48A 4A6PA 1XXHA 1E2JA 5DI3B 3GLFE 4EPVA 5EXSA 2ZVPX 1G3MA 2IXEA 3B8HA 1YR7A 2Q9AA 3WRXC 4XIGS 4C2UA 2R65A 3B1VA 3EZ2A 4YMUA 4FMBB 1OH7A 1Z6GA 1G8FA 3AVOA 3U44A 2HUPA 4M1KA 1XEXA 1YVDA 3W9YA 4UQOA 2Q3FA 4EAQA 4RD3A 5BQ5A 4AKEA 3C16C 4KYUA 4LV6A 4A6XA 4QHTA 4URVR 3FPAA 4F38A 1LF5A 4IOMA 1Z83A 1WDTA 3LFUA 2OAP1 1KDTA 4WA7A 4TMZA 3AKYA 1Z07A 4P4UA 3BH0A 1NP6A 3E5HA 1HY3A 4ZKEA 3VHXA 1U8ZA 4E07A 4B3FX 4IEEA 1FTSA 4NYMR 5GADl 1WB9A 4ARZA 2C9OA 3H1TA 2QP4A 1F60A 3OE7D 4UXIA 4Z51A 3TQFA 2CHQA 2BM0A 3HPRA 2QE7A 3FHOA 1CJKC 5D3MA 1XTQA 2LKDA 4JBWA 4DSNA 4TN1A 5EUMA 3QKRA 1Z0IA 3ZS9A 1AJEA 2IYRA 4KFRA 1BO6A 3VMFA 3R9WA 1CJUC 2BHRA 5JWHA 2A5GA 4IXMA 4LGMA 1GITA 1M1YE 4GI7A 3ZZUA 1CRPA 1QHHB 3QF7A 1Q1QA 4Q19A 1MO4A 1UADA 2NO0A 1M34E 2MMGA 1GRNA 3V00A 2Y8EA 4KVGA 3KDSE 2W0MA 1Z28A 1WRBA 3SHWA 2IUSA 1N6PA 3MWLA 1P72A 4TL9A 5J4HA 2RHMA 4PHGA 2LWIA 4L8GA 1N5KA 2W6JA 2WAXA 3L0SA 1NIJA 3IILA 1L4YA 2QBYA 4UNPA 2BVNA 4Q5IA 1U8AA 2G83A 2WMOB 3C8UA 4Q7KA 1E0AA 1G8GA 2QL6A 3I8XA 1QVRA 2AD1A 3OEHD 5BN4A 3K0FB 2JLWA 1TEVA 2DFLA 1AIPA 1KHTA 2PT7A 4TZ0A 5H70A 2ATVA 2W6JD 4KV9A 2OAQ1 3CPHA 2J3EA 2YC2C 3WYFA 1VIAA 5C18A 3GFOA 5C4GB 4NH0A 2IS1A 5DSZA 3RC3A 2CE7A 2IEYA 5FBRB 1W0KA 2A9KA 1U8YA 4IEIA 1FPMA 5TY0A 4Q9HA 2HF9A 1Z2AA 1TUIA 4N0DA 4PPFA 3GLIE 1E2FA 2ZUCA 3S1AA 1NSTA 3SYKA 2D2EA 3FYHA 3X1DA 1MKYA 3KXLA 4ZI3A 1S4QA 3PUWA 4DVGA 4ESVA 1U0JA 2J41A 1KGDA 4TL7A 4Z54A 2R2AA 2XAUA 4NU0A 4MA4A 4OKSA 1NL3A 3B7GA 1KI4A 4ZPXA 2ZRFA 2Q0HA 4P4TA 3GJ4A 1WBDA 2ZRLA 1RJ9A 4FINA 3OAAD 4U00A 1R5BA 4LBWA 4Q66C 1A82A 2ASEA 2NPIA 2OILA 4ZCIA 4JMPA 3QEOA 4FD2A 1VCOA 4TZ6A 4BGDA 5CDFE 1VCMA 1XRJA 4XWKA 1XMJA 5FUYA 2GCOA 1RRGA 2CLCX 3Q85A 2EFCB 4PPGA 3UWKA 2GXQA 2XB4A 3QSYA 1Q0UA 3VR1A 4D4LA 4D80A 2IW3A 4BLRA 3TQCA 3KKMA 1Z5ZA 4EQ6A 4XD7A 2G0TA 4BZXA 5KSPA 1YZKA 1ZD1A 2FZLA 3IBGA 3GEEA 3WYAA 1N0WA 3DOFA 3O8CA 1DAHA 1VCNA 3VNUA 2HCJB 1R10A 2XTMA 3U4QB 4TWZA 2B92A 2VBCA 4N1AA 621PA 2ZI3A 1BYUA 2ATXA 2IHYA 3GEHA 4AKIA 1E96A 3PENA 2VPPA 1US8A 3HR7A 1K6MA 2GXSA 4ZKDA 2Q3MA 2C77A 4WOPA 2XTZA 2GJKA 3IQWA 4LBZA 4PO1A 4C0SA 4YDSA 3I5YA 2BJWA 3CO5A 3NG1A 1Z6AA 2IYUA 1J8MF 2BBWA 1EGAA 2O8BA 4EJSA 1YZGA 1N6IA 5FL7D 3QXSA 4M4SA 3ZYCA 3SYLA 1CTQA 3AVPA 2ZSBA 3F3YA 4M21A 4C4PA 4URXR 4X8HA 2NZ8A 1NY5A 5FH9A 2XGJA 3NDPA 3SU8A 3I61A 1A1VA 2DWPA 2FPLA 2CLSA 2F3RA 2IWRA 5F98A 3ONWA 1VHTA 2ERYA 1N6HA 2QTVB 4IKEA 4J0QA 1W36B 3TSZA 2XSZD 3M1IA 4QGGA 4V0OA 5CB6A 4Q03A 1IOZA 3L0PA 3K9NA 2ZYUX 4B47A 1ZU4A 4QGFA 2VP5A 3GLFB 4Q4HA 4JLAA 1R7RA 2WJYA 4P4SB 4CRWB 4HZIA 4PHHA 4MRPA 4NYIQ 2ZU0C 4NONA 1EFUA 4H9GA 3EZFA 1FP6A 5FL3A 1T6NA 2WSMA 3PG5A 5KSOA 4LYHA 4BLPA 3A37A 3BB3A 1H8HD 2ZJZA 1KY2A 3EG5A 3TKLA 4FI3C 5TARA 3LV8A 2DFTA 4PR0A 4DCNA 5KU1A 3B82A 5FI0B 2ZRMA 2YWGA 5HKKA 2O8EB 1VYTA 2EFDB 4JKYA 4DLXA 3AEZA 3OFNA 5AUNB 1SGWA 1DG3A 1E2LA 1UKZA 4TSFD 1NN3A 3LW8A 3KQNA 2ODNA 4JSYA 1XCPA 3SN6A 3ZDQA 4XSHA 2D62A 2RGCA 2N46A 2VYFA 3N2EA 1JR3D 5DYGA 4M8NE 5B30A 1PJRA 1JI0A 1TMKA 3QF4B 5JWOA 1MOZA 4AC9A 1Y3AA 2F1RA 2REBA 2OCBA 5CYOA 3RWOA 3SJZA 2A5YB 2CK3D 2QM8A 4NCIA 2ZYWX 4TLBA 2FU5C 2CL7X 1KMQA 121PA 1SHKA 1NF3A 1KSGA 3HP1A 4HDQB 1X8JA 3QEJA 4V02A 3T1QA 2MSDB 3SDZA 3SYNA 2VSXA 1H65A 1P2VA 3CIOA 1CR1A 1Z0KA 1T0HB 1XB2A 1W47A 1ZD8A 4B76A 4YQFA 3QPUA 2HCBA 4HUTA 4QJ4A 3JVVA 1JPNA 1AGPA 1E69A 2IX3A 2OBLA 4ZDWA 3MLEA 4LI0A 1CR4A 3GLGE 2H1LA 2AWNA 4KFSA 1I4DD 3X1ZA 3ZD6A 1FUKA 3KB1A 3ZVRA 2BBTA 1IY1A 2H8KA 3VR6A 3ZJYA 2GDJA 3SBDA 5KHOC 5JJLA 2WWGA 1PLLA 5FI1B 5G3YA 5K8LA 2DFKB 2FFQA 1SVOA 3IQXA 2AXPA 5FUWA 2WWHA 4UJ3A 1X3SA 2D2FA 4AKGA 3RS2A 2WIAA 2IS4A 2PCLA 3EA0A 3MJHA 3U5ZB 3NBZC 3VKHA 1OXXK 1BIFA 1AZSC 4GP6A 3AF0A 3GEIA 4DHEA 4EDHA 4Q1BA 2JAQA 3A4MA 2GBLA 1RYHA 5IF9A 1R8QA 2RGXA 3K0SA 3D31A 3U6BA 2ZSEA 3QXCA 2RHDA 2ONKA 4LHXA 3RS4A 3TGPA 2WVJA 3DZDA 2JLUA 5CIWA 4AURA 1F2UA 3P1JA 4F93B 2IL1A 3CLVA 5FOTA 1ZC4A 1TUEA 1LF0A 1KO1A 1N5IA 4HAXA 2GEUA 1K5GA 3LA6A 3Q7QA 1CIPA 1XZPA 3HDTA 4R7ZA 5EP4A 2GZAA 2GETA 1L8QA 2Q6TA 3CX6A 3QXXA 4L16A 3ZIAA 4A15A 1XD8A 2YHSA 5BN5A 1G41A 4DUGD 1FL9A 1CJMA 1FQJA 2GA8A 5AUPB 1OYYA 4TT3D 3AQ4A 1GZSA 4LYAA 4W9MC 4QBFA 4JL8A 2ZE8A 4FMDF 4WZAE 3V4RA 5FOXA 2IYLD 1TTTA 3AF3A 4M1YA 4GT1A 4JLVA 4BQSA 4BFXA 4F91B 4F92B 3EC1A 2W83A 4LYFA 2ZYVX 3AVVA 1G21E 2QSYA 3TE6A 5EQTA 2CXXA 3Q8XB 4B75A 1Q1BA 3RVBA 2SHKA 4NKRA 1VHLA 1IONA 1NBME 1I4LD 2OESA 2VH5R 3LBIA 1G291 5F2EA 3BFXA 1OKKA 4JLPA 2QUZA 3NBXX 3CR7A 4LRWA 3TR0A 1W5TA 1E2DA 2CL6X 2O0KA 2O0JA 2FSGA 3DHWC 4TQ9A 3P4YA 221PA 2O52A 1LV7A 2CJWA 2HF8A 2OFXA 2YNMA 3FMOB 4YMWA 2AK2A 4URYR 1GFIA 1W2GA 2PX3A 4RCZA 5CM8B 4NCKA 4Q7MB 3DL0A 2OUKA 1IXZA 2UVQA 2ZUDA 1XD9A 1JAIA 3MSXA 1JEEA 3CF6R 4G5RA 4L5BA 5L8VA 5E7IA 1D2NA 3A36A 4TMXA 5KPJA 1BOFA 5G40A 4CIDA 4FW9A 5F9FA 4HDOB 2OT3B 4QM6A 4GNKA 4AI6A 2PBRA 1HTWA 1SHZA 4QXAA 4DLRA 3LLUA 2XXAA 3A1UA 2I3BA 1OJLA 3WBJA 3GPLA 1DAKA 1S96A 4FCTA 2J5XA 1ODFA 2VF8A 1QDEA 1PLKA 4YMTA 3G82C 1W4BA 2NTYC 3AVXA 4DLWA 4Q18A 2CE2X 1R0XA 3REGA 2PZGA 1BS1A 4C0HA 4Q9JA 2QQEA 5B64A 3UG6A 2GESA 3LO5A 1FMLA 3LQRA 2J0UA 3VR4A 1FNMA 4B3BA 2GZHA 2HXYA 2ZRIA 3FMIA 3K0EA 4EFLA 4FIDA 3ZZTA 2R62A 2W0SA 3FMFA 2R6FA 4G5GA 4KBGA 1AKYA 4DUGA 2J59A 2REXB 1BMFA 2GNOA 4OQFA 1G19A 5FUVA 4C3ZA 4BLSA 2RH5A 2EYUA 4HATA 3QBVA 1F2TA 4WBSA 2PCJA 1N5LA 4RJLA 3VQTA 2ZR0A 4BEBA 3RS5A 1RW4A 5EE9A 1TPZA 1YZQA 4IJMA 3P20A 4N0EA 2KJQA 1HE8B 1CJTC 1NY6A 3CNLA 2P2LA 3LD9A 8OHMA 4TYYA 2QTHA 3VAAA 5JSZB 2R8RA 3CZPA 5FOSA 2JGNA 3LX5A 3OIWA 1I2DA 4K46A 4CZ2A 4EPWA 3HU3A 4V0ME 5JEDA 2XNSA 3TRFA 2FX3A 1MO5A 2YWEA 3TR5A 2QMUA 5EE0A 1KIMA 1II8A 3QF4A 3SHFA 3DDCA 1ETUA 4E22A 5FPKA 5SZKB 2OG2A 1Q20A 4NDZA 4I81A 3LXRA 4Q1CA 1KKLA 2CBZA 4DLTA 1Q57A 1T5IA 4HUQA 1N6NA 1OXTA 3KKPA 3R8CA 4LUCA 3A6PC 1E98A 2AHOA 1KOFA 2QZ4A 4JLJA 3MMPA 3VX3A 1DS6A 1W44A 3W3ZB 1N0UA 4WXRA 4OHZA 3IIJA 3TUJC 3K9HA 1IN7A 3K9LA 4O3MA 4GL2A 2YC4C 2QMHA 3PUXA 4W5HA 2IWHA 2O8DB 3O8DA 4PC1A 1ONBA 4NYJR 5EP2A 3RRNA 3FOZA 1ZNWA 4PC7A 1CR0A 1DELA 1E9FA 3GQBA 3UK6A 1UEJA 2VIIA 2VO1A 4G5OA 4DDVA 4TTPA 3FMPB 1KK0A 3AKDA 5A0FA 1LY1A 1XJQA 1GUAA 4M1WA 4CW7A 2G6BA 4KO8A 3R7WA 5EP3A 4Q4HB 4MRNA 3GLFA 1HA3A 3BRWD 1KI8A 1E3MA 2EVWX 1RPZA 2JIZD 4L9WA 2V1XA 3FVQA 1UBCA 2NOAA 1OXVA 4NCJA 4QNMA 3BFVA 2J1LA 2JDIA 2YV5A 4M9ZA 2IUUA 1XFAA 3BD9A 1G5TA 4B43A 3SJBA 1K8RA 1I2MA 1OXSC 1ZM2A 1T3HA 2N42A 4MKIA 3X1XA 1GOTA 2QNRA 3NBFA 2J9RA 4A0HA 1X1SA 3SQWA 4BFTA 1U99A 3KQUA 1P9RA 4IHQA 3CRW1 1DAIA 4DDUA 5JS8A 1G64A 5H68A 3MWJA 4EJSC 2D3WA 1GL6A 1G4UR 1G3UA 2NGRA 5GJCA 5JI3E 3QE0A 1KK3A 3A4LA 5TVKA 4EPTA 2GBLC 1FZQA 821PA 5CLLA 2OBNA 1N6KA 4POAA 1D6JA 1VDZA 1Q1EA 5L3QA 2H92A 1FTNA 2WJIA 4EPXA 2YYZA 1EFCA 2X19A 4LOAA 4D81A 1OHHA 5EZ6B 3U4QA 2D7DA 4RZ2A 1XPUA 2DYKA 1HV8A 2WWWA 3GJ7A 5DH9A 1NIPA 3OEEA 2IS2A 1Q21A 2F3TA 2X1VA 4QGHA 2FH5B 4EQ6B 2RAPA 3D3QA 3BH7A 5J4YA 2HV8A 1XTRA 3QG1A 3CNNA 2A78A 4PO9A 3MG9A 1IN4A 5KDLA 4L4UA 3Q9LA 5FOUA 1Z8FA 3TLXA 3EAQA 1CF4A 3AM1A 3VR5A 1WCV1 2F1IA 4RZUA 1BMFD 4QNRA 4P33A 1NLYA 1TU4A 4BFYA 2FN4A 3CPEA 4M0LA 3GLHE 1KJYA 3EARA 4B3XA 1ZUHA 2FGKA 2PL3A 3EASA 1OF1A 4JL6A 1GTVA 2KE5A 3T5GA 4L9SA 2JCSA 4LYJA 5SZIA 1YU9A 2GAOA 2JJ2A 3AUYA 2OBMA 3OIUA 4C30A 1M7HA 4D4JA 2CK3A 1VCIA 2ZRBA 2YWHA 3QXJA 2ZI6A 4V03A 2HEIA 3I3SR 1Q1ZA 5SZHB 1LS1A 2VP4A 4MYTA 1G7RA 4KVAA 4ASUA 2FFAA 1CP2A 1A7JA 2C03A 2ZRHA 1NLZA 3RRYA 4DB4A 3PUYA 3WBKA 5B57C 4QFMA 4WXPA 3M4YA 1HT1E 3SFVA 2GCNA 5F3WB 4YMVA 3EC2A 2GXUA 5J4LA 4FXPA 5JLJA 1M7GA 4LZZA 1KK2A 1SVLA 2WKQA 3K0FA 3QY0A 4MYCA 1E4YA 4HSEA 2J0VA 5L3QB 4XVRA 1PUJA 2WOOA 3ETLA 2ZJBA 1KI9A 1JJVA 5DN6A 4LV8B 3WHLA 4ASUD 3ECCA 3QXHA 3LX8A 2ZAMA 1Z6YA 3UG7A 4URZR 5FTJA 2C04A 1XCMA 3HU2A 1E9BA 1SQ5A 2F7SA 1CKEA 1NG1A 2OCPA 4KI0A 4US1R 5A4JA 1LB1B 4QG7A 1HUQA 3GJXC 5SZJA 3LWNA 1NMZA 3RS7A 2GXAA 2PJZA 1NVVQ 1OKKD 4WAUA 3UXMA 2G0NA 2C8VA 4LV5B 2VRWA 1VMAA 2FFHA 1QHHA 4K8OA 2B8TA 4RKEA 3AF1A 4G3XA 3REFA 4QKQA 3UMSA 2VQSA 1JXOA 1FP7A 2ZJ8A 1AGRA 3EWAA 1W46A 4PZLA 4Z1MA 4AG5A 4DB2A 5AJXA 4C0KA 2ORIA 3WMGA 4I99A 1SKQA 4BZPA 4B33A 1H8HA 5D3MB 1AS3A 5JFGA 2GZDA 3K09C 3VHLB 1X1RA 1NSFA 3L8YA 4BLTA 1H8EA 2WAYA 5BYKA 3OF5A 4PXAA 1VTKA 3R7WB 4MKHA 1JQJC 4C0AC 1YRBA 5LB4A 2BWJA 4K81B 3C4JA 4AYTA 5L3RA 1II9A 4DC9A 2NPFA 4BECA 4TYWA 5FBVB 5AJYA 4A36A 3W34A 1E9DA 3L82B 5IK2A 5DIFA 2QM7A 4KCGA 1RYFA 3MWKA 4LY6A 2VP9A 4Q4LA 1G5RA 2O8DA 3QI2A 3N2IA 4PQFA 1KI3A 1RIFA 1XEXB 2ERXA 3CH5A 3L0OA 4LBVA 1S0UA 3TAUA 1Z6XA 2AN9A 2BEKA 2IC5A 2E9SA 2H18A 4QJ5A 3B9PA 1JNYA 1E2GA 4HUQB 1E9SA 3AGQA 4UNNA 3UKDA 5JECA 2A5DA 3SFZA 2JLQA 2KBFA 4DEYA 4ZDJA 1N6RA 1XXHB 1ZNYA 3SEAA 2AD5A 1Q3HA 1ZYUA 2ZTSA 1II8B 3H86A 4CDGA 4O2RA 2P6NA 4B3CA 3PEWA 5JJIA 1D9ZA 2ZITA 1AK2A 1W36D 3WY9A 3BOSA 2BMFA 1OIVA 3U7EB 5JSZA 3QKSB 3NC1C 1G6OA 5G53C 1C1YA 1HE1C 1U90A 4OQLA 2BCJQ 4JIMA 2DBYA 3AF2A 3T15A 3W6PA 1DAGA 2ZI9A 4D26A 1AZTA 5TMPA 2G77B 1G18A 4RFSB 1COWA 2B8WA 5FTMA 3KTAB 4A8JB 1JALA 4O25A 3AH8A 3DOEA 1QHGA 2GF9A 4L15A 4TLAA 1F2TB 4AWXA 5BWMA 2W2TA 2QROA 4MYUA 2QE7D 4OJQA 2EFEB 3I32A 1G7TA 5C1BA 3RS0A 4IDOA 2H5EA 4RZ3A 3OAAA 2JLSA 3K0AB 4DCTA 2VHCA 3GFPA 3WHKA 4HLUA 4MGKR 4V0MA 4A2QA 2ANBA 3TUZC 4NZYA 2ZE7A 5LBIA 2V4ZA 1RC8A 4MRSA 3P4XA 3R8FA 3QVUA 3BB1A 1B23P 5HR5A 3TSWA 3CRMA 1G17A 1T0JB 2IYVA 2J0UB 3KQHA 1NRJB 2ZJOA 3CONA 1W7AA 3WYGA 3HR8A 4M1SA 4G1UC 4BFWA 2HLDD 2DCUA 1OXUA 3BS4A 1DARA 3B1ZA 2WSSD 4X8OA 3HWSA 1KJZA 4IVQA 4OI2A 4RCYA 3CW2A 2J7PD 3HYRA 3WNDA 2FWRA 2VEDA 1S3GA 5DI9A 2FZ4A 3I1FA 3T34A 2HT6A 4QBIA 3BGWA 2XXAB
chains in the Genus database with same CATH superfamily
1Q7BA 3KPUA 1UBNA 2FUNB 2O2EA 2ACKA 4MGHA 3UB3A 1QE5A 4JASB 5SV2A 1J56A 3CNOA 3RU7A 2WWRA 5F2KA 1QX3A 3CZQA 2FZ5A 4LDZA 4P4LA 3TRIA 1SBYA 2R48A 1K3TA 4I9HA 4PANA 4B3IA 2JLZA 4NAVA 3ZE1B 4BNWA 4EFMA 4QOFA 4CMBA 1NYQA 4LKRA 3P2MA 3VYWA 5BMVB 3CINA 5JCZA 2EW1A 5HIAA 1N1DA 1XP8A 1YZLA 3HVUA 4R1SA 4LJ9A 3DE1X 4L6CA 2OCKA 3SSOA 1N6LA 3I4LA 4I3HA 4CKWA 1M6YA 1Q16A 4YRMA 3R09A 1OH5A 1LSJA 3ANMA 4WZ6A 3GUYA 4QREA 2YXBA 3OHMA 3INNA 2BP7B 1NVWQ 1PF7E 2E7ZA 1LBSA 2QRMA 3BMQA 1R4NA 1UC8A 2C95A 2QRJA 2VFAA 1E9CA 2Y6UA 3C5WP 4QYTA 2FRVA 3TNJA 3T4UA 3T41A 2TMYA 3BH6A 1V7PC 4QDTA 2ENWA 1N2SA 1WUTA 3DVSX 1DU4A 2VHTA 1YI8A 2P4SA 3FNGA 4OKNA 3RIMA 4RZSA 2E82A 2F90A 1FDVA 1R6DA 2HMUA 5A71A 3CN7A 3DOUA 4J75A 4RD1A 5FX2A 5HM8A 1BFKA 2HJVA 2ID4A 3RWMB 3TOXA 4XJSA 1XHEA 1P4HA 1TADA 2IE0A 3TRHA 5DX0A 1I6LA 4IW3B 3V4VB 4AO7A 4B35A 2PT6A 2P9HA 5ER9A 2OO5A 3S99A 3VPBA 3IE2A 1V48A 2FWJA 3ICWA 4CBVA 3RUFA 3LUPA 1JFVA 3KOMA 3DW3X 4AM8A 1YHZA 4ZO7A 5FR1A 1NRIA 1BAPA 5HFAA 1KTVA 3AZQA 4TLCA 5CJJA 2FVXA 1FDTA 1E99A 2O2DA 2QGFA 2FFBA 3GLHA 3QOXA 4ZEOA 4AMZA 4R9SA 2ZSHA 3EXFA 5D3QA 4IOJA 3UW3A 2V0CA 3KV1A 4DSUA 1QZXA 1WQ1R 2LP4Y 1EP1B 2ZKLA 2B2NA 2YWBA 3SQMA 4OVKA 1C8KA 1UKBA 1PZNA 4HL6A 2DGDA 1OSNA 3KS9A 3MMSA 3OUTA 3EIUA 4GMFA 4G5XA 5EUBA 3RYCB 4P83A 4AN1A 1ZCBA 3IDAA 4IDNA 1QG0A 3BJIC 3BWVA 4R68A 3ZWQA 3FDJA 2VOEA 4ZK6A 1VMIA 5H02A 4GBGA 2ZIZA 4F7WA 1F2VA 2BM1A 3B85A 3PXDA 4MI3A 3KT3A 4ARBA 1WB6A 2ZG6A 3H1GA 2Z4SA 2YOFA 3LHFA 1SPBS 4B0PA 3Q41A 5G0UA 4CCWA 5E4TA 2VR1A 3ADCA 3U60B 1ESZA 3AVXA 3OJ0A 3GFSA 4M0DA 1JEDA 2Z83A 3N8GA 5HCIA 4AG6A 1A7AA 3QUCA 2VJDA 5D5QA 4BFUA 3ASVA 4ALIA 1RWPA 3OBIA 3N58A 4A03A 3ER6A 1AD2A 5FWYB 5ELLA 3N2ZB 1GAQA 1UBHS 3D6TB 3LLMA 2YS6A 3I5UA 3QW2A 2PH7A 1Z0AA 4LCEA 4UVIA 1SPXA 4KR9A 2QVGA 4LX8A 2D1TA 4WK4B 3T1TA 3E4CA 3LYLA 4JZKA 2Q3CA 4DV5B 4X54A 1P2SA 3MFYA 5TMEA 5E3HA 1H05A 1LU9A 2DWOA 4XGRA 5IKMA 5IJZA 4V2UA 3MRSA 2ZRGA 1EK1A 3H0KA 1VSVA 1N5MA 2GFIA 2WJ3A 1X8KA 4XR4A 3FWZA 3RIYA 3DYBA 4CMIA 3E6AA 4ERNA 1K5PA 3D54D 3SZGA 5FJJA 1MC1A 4UW9A 1DG1G 1E32A 1FDIA 5CJPA 1V4NA 1BH6A 1KDYA 3QA9A 2BHSA 3OI7A 2GCPA 3HDJA 2FMKA 5FPYA 5BQOA 3SC3A 3UH1A 4BNNA 4MHTA 4GYYA 4R2JA 1E7YA 1B8VA 3U4HA 3U61B 1K5HA 4C7JA 2ZZNA 3DP9A 4IQ8A 5KDDA 2Y68A 4PWZA 3OY2A 1FLNA 3P9QA 3P9XA 4I0WB 4HNAB 4F2DA 1WHTB 3Q1KA 1ODCA 4X60A 2ZJFA 1MFPA 2I6SA 3KZXA 3MCVA 4II2A 3BQNB 2XB2A 2J45A 4RJJA 1EUCB 4NMMA 2D7CA 3C15C 3QP9A 2WAMA 4EPYA 3B2QA 3G88A 3OCXA 4ITRC 5T6MA 3WNQA 4RMHA 4OB8A 4J7XA 5CB0A 3VI4B 1IQ0A 3E5RA 1BX0A 3UOWA 5IJ0A 1BMTA 3GGJA 3NIFB 4HDKB 3SX2A 3FTFA 1UOQA 2XODA 2FZVA 5LMUB 2CUZA 3LT0A 5L3ZA 2X3FA 3I23A 4FPXA 1RRFA 3T0FA 3AUUA 5BSKA 3BDAA 3HHPA 2YFHA 2OAEA 3IEKA 1I8TA 4RHUA 2XZOA 3MIIA 1XO1A 1LVHA 4WH0A 4R7TA 1ILWA 1NAHA 4WZBE 2ZJAA 3CZ9A 4P0TA 1Z4IA 5DHUA 5TIIA 4M55A 3DBRB 4KX3A 4L0CA 3VSAA 2YZMA 4LHZA 2XT0A 3UENA 3ESAA 1YZ3A 3RK1A 2YIVX 4DOMA 4ITUA 3PU6A 2ZBDA 3MA0A 4DYHA 4WLNA 1R2QA 4QRDA 1XDGA 3SE0A 3UCXA 3AERB 3RABA 3VX4A 2VHEA 3BJZA 2DBQA 2BGKA 1XZEA 2IITA 3V7FA 2AJDA 4MK4A 3W3AH 5JQGB 3ZY2A 4CV2A 4HVLA 3T5TA 4KXVA 2VHYA 4O4JF 2Y2VA 1J2RA 4E09A 2JCGA 4HBZA 4Q02A 4ALNA 4CHGA 2EATA 1BNCA 5I7SA 4JLUA 3L7BA 4ZJYA 4WVFA 3G2QA 4BFZA 4COOA 4ETWA 4MMXB 3HM9A 3LE8A 2QGZA 3T1OA 2DFNA 2R6HA 2M6SA 4NICA 1VKRA 3JAKA 4KQ1A 4EB3A 4ZZ2A 1SCIA 1ZRHA 4UATA 2YZ2A 2GCGA 1LDYA 2GZMA 2JAUA 4XYEA 2QL5A 5A7HA 4R16A 1N0VC 3HFGA 4PSVA 5TQJA 2I4LA 4PSAA 3KAQA 3L49A 4P7JA 1MRZA 4ODIA 3NHZA 3DCNA 2R751 3H65A 4RVOA 4CMCA 1KDRA 3UCEA 1LK0A 3AVUA 1V7QA 1KMMA 3DM5A 3LLSA 4CCSA 2QN6A 3G9ZA 3Q2KA 1BHSA 3ORFA 4EB6A 4TPKA 4EJSB 2ZGVA 4F4IA 2B3DA 4AAYA 4KOAA 1PJZA 2XQJA 1GY8A 4DQUA 1FRFS 2C0CA 2H1CA 2YJ6A 3BQMB 3EGOA 3PR3A 3N70A 5FORA 4INZA 4MW9A 3QPWA 4UAUA 4Y6RA 5DK4A 4GR4A 2OFFA 1AS0A 4HQLA 2V7TA 3OZIA 4MGYR 5C51B 1I36A 2J5RA 1ZJJA 4UBKA 3FZQA 3GRYA 4PINA 5GIPE 4LNUB 4MVYA 1WPXA 2HJSA 2OGTA 4GP9A 3ZVLA 4RPIA 3S2UA 2PS1A 4O2AA 1KFKB 1D2RA 4HVTA 5KJCA 2FSFA 3FNFA 4QJ3A 2R6ZA 5DNDA 5GWXA 2H7VA 1Z3IX 1NYTA 4UNIA 4DM7A 5HKAA 1V9CA 4GKKB 4QGAA 2ZXFA 2YINC 4NOLA 3BWDD 3EFBA 4G01B 5JS7A 4J7UA 1SG6A 2XUDA 4EVSA 3G9UA 1ZRNA 3OZFA 3JAWB 4F3RA 2LVBA 4B3TB 3LBHA 3DAYA 2P9FA 4PYNA 3L92A 3ROGA 3ZWCA 3FVTA 1L8AA 2WTEA 5EJFA 2VP2A 1Z18A 4KDCA 3TVTA 1EUDA 1Q3TA 1QJCA 1V43A 2BGTA 2V65A 2XMBA 1KI1A 2HU2A 2Z08A 3GZNA 3LOQA 4MJXA 1EUYA 1MAUA 1JI3A 2Q9CA 1ZW1A 1BE6A 2IK8A 5EEHA 2FHPA 4MPPA 4B3MB 4UHHA 1TVEA 1DBQA 1XVAA 2RGWA 4QRHA 3ROMA 4BNKA 1R0SA 4KO3S 1P75A 1I33A 1RJ9B 4NFLA 5EPOA 1RI5A 3MCUA 4NFYA 1DAOA 1BW9A 3MQFA 4IFBA 3E3MA 5DGDA 4JI4B 2N1MA 3GUHA 3HJUA 1WTAA 4IUBS 4WSOA 4HLCA 2O7RA 1ZGCA 1EVJA 2F3QA 2R7LA 2C7OA 1BE1A 2RGNA 3C1UA 1KI6A 2PSFA 3HV2A 2Z6UA 2RCNA 3HL4A 5I7AA 4GBMA 4UUMA 4W9RA 5CLGA 1JHUA 4LXIA 3EQ7A 4QXMA 1V9SA 3DEJA 2I34A 4YALA 2VJOA 4YGYA 2HGZA 4W5QA 4HQFA 1BH2A 1XQ9A 2HWWA 3CR8A 1ZSVA 4EKEA 5EJEA 4JGIA 3WKDA 2WW8A 3PXAA 1YI0A 1W76A 4AP5A 4PQYA 2Z5LA 5ITVA 1M2OB 1IDN1 4MULA 1L5LA 2QORA 1UDAA 1KO4A 1R0RE 1U8UA 3F8TA 3N2GB 5KYWA 2XQVA 1QMPA 1YS2X 2X0FA 4DPKA 5H80A 2X3YA 5EIHA 2HSZA 4G09A 4K28A 3RRFA 1W5BA 4KQKA 5CHEA 4GMDA 5AT1A 4E88A 4OLBA 5AUQA 4EEZA 4GICA 1TJ3A 1CZLA 3KL2A 4H18A 4LJ7A 4YUAA 3KAJA 3HA5A 5AESA 2XE6A 3N7UA 2V55B 1EFVA 4HTFB 4YAUA 4YR9A 3FMVA 3TYXA 3HJAA 3RRBA 4M7PA 2LBPA 1P7YA 2PWPA 3UNXA 1C81A 1NVUQ 2YJTD 4N03A 2JLBA 3IOMA 3K9GA 4F2HA 3RWBA 1Y5MA 1XTPA 3DXFA 4IVPA 4M54A 2X2FA 4P08A 1O6CA 1O96A 5JASA 5JQGA 1D5CA 1FFGA 3OPVA 3PL1A 4TWRA 4CF6A 5FEMA 4D3YA 4KACA 1U3FA 1SOVA 2XITA 4RTLA 2BTQB 2ZVJA 5HJEA 4E5VA 5JD4A 2DP4E 4HWGA 4RS4A 1YO6A 5ES4B 3PITA 4M36A 4XYMA 1SURA 5CDYA 1VL2A 3HWRA 1T3ZA 2IYWA 2INGX 4TSFA 4WWHA 3OURA 1ZXBA 1EFRD 4QQFA 1ZVJA 2RI6A 1C1XA 4MS3A 3VU3A 1II0A 1GCIA 4FFPA 3CRVA 4U63A 4WZAB 4M83A 1X7DA 2VP0A 3CNQS 3C3KA 3IV9A 4L2IA 4F4UA 1VHJA 4QYIB 3D02A 4XUEA 1G9TA 3A9SA 4MUFA 1SKMA 3ZGNA 2VTBA 3QKRB 1SB8A 5G1OA 3OQIB 1DBVO 3E22B 3URMA 1XAIA 4M7OA 2C1EA 3TEJA 2B1RA 3DBVO 3O03A 2ZJ6A 3FFAA 4FCVA 4OJKA 3KJIA 2J46A 1ZK2A 1DAEA 2FB9A 3NT5A 3IAS6 4C0LA 4L4ZA 3T3DA 4CI9A 1X3LA 3GZTB 1GZ6A 4C0BA 2MU1A 5I7VA 2DMRA 2IBMA 4R9RA 4FM9A 2W11A 5E8JA 3VHXB 3WLAA 1RQLA 2O6LA 2UXDB 3P2KA 4N3NA 3TQIA 2BFMA 3E1KA 1U8FO 2G88A 3HS3A 1WXQA 2Q2WA 1WMSA 1ULTA 2R6JA 2X0JA 3A06A 4ETIA 1SXPA 1L8LA 2YVKA 2XQFA 3C5VA 4E1BA 4B2PA 2GRAA 1E94E 1DT3A 4KK3A 2FUG1 1SOAA 3ECSA 1W1WA 3C5EA 1G6KA 3EZ9A 2PQMA 2O8FA 4C5AA 1K4YA 1ACMA 2QRHA 3NANA 4ZQEA 5DTIA 5DW0A 5AK0A 4IH9A 2J3JA 3MT9A 3OLCX 3IXQA 1D2MA 1E1CA 1XDWA 2BMVA 1M75A 2UU9B 2GVDC 1JG6A 4GZ3A 2MDTA 2YNMC 2EBWA 5K3FB 3VRHA 2CKMA 3PNLA 4HT3B 1WXDA 2X41A 2YN4A 1CRQA 3TQQA 3V1MA 2AN5A 3AY0A 1TVMA 1GWNA 4QEZA 1DQYA 1ULSA 3OU7A 2E55A 3U0VA 2GF0A 2QGNA 2OENG 1XVLA 2W2LD 1Y34E 4B71A 1A5SB 5KNDA 1MO2A 4ZICA 4TLEA 3DEIA 4PLCA 1H66A 4LE0A 4NEHB 5AI6A 5A5VA 5IPFA 4EFDA 4LBYA 1OB2A 1AA6A 1T1IA 2BUAA 3KEMA 5LDGA 1AKRA 4FOPA 4RD4A 4CG0A 3OT5A 4QARA 1QYXA 1YE8A 1YS1X 3NAMA 4HDRB 2OYCA 2P35A 3TCKA 4YRRA 3NI2A 2D54A 4MRAA 4XB2A 3HVIA 2Y67A 2P3SA 2PD3A 4O4LF 5KCZA 1B4DA 2R6R1 2AGVA 2ZXEA 1I7SB 1CULC 1Z45A 1JQDA 1Z6QA 2BCGY 2YWRA 2PHZA 1R6TA 1L7RA 2CY0A 2C96A 4OFWA 1OXMA 1TM5E 4LJAA 3G23A 1GL9B 6PFKA 4I55F 1U63A 3WGVA 4PY2A 1I2CA 3OQOA 3VV2A 1PKEA 1LPBB 1PR1A 1YJQA 3T7TA 4U6QA 4XA8A 4XJXA 1YHNA 2IYAA 1YZUA 3LDGA 4OAPA 5BW5A 2VAPA 9MHTA 1VL1A 4WFQA 2CFOA 1E1YA 3EZ6A 4PLHA 4JJ4A 2QPTA 1RXSA 2VSYA 3VOBA 4ZODA 4U2FA 1HE3A 2FQQA 1AA9A 3BN3A 3HA7A 5EHNA 1YR6A 4NHOA 1NVKA 2DBZA 2HREA 1EYZA 2EYQA 1RYDA 1TUBB 1PZGA 4FMCB 5CITA 2XOKA 1R0KA 5EESA 1P7WA 2BFDA 4O59O 3LLVA 3T3HA 4O63O 2XQIA 4CTKA 1XMSA 2NSDA 4WJKB 5T4EA 4M87A 2HHHB 2WTMA 3K0HA 4I55B 3IELA 3DC2A 3GJ0A 2O2YA 4RPGA 5TV2A 5EQDA 2HIMA 3AR3A 2AT1A 2ZCJA 2XZPA 5H9VA 2OXIA 5TPWB 5EJIA 2PRSA 3L5KA 2ZTHA 4IJ5A 4YXWD 4OHBA 1I4EB 3N2LA 4H0CA 2JEZA 4ZVKA 3ZDCA 1E60A 1THTA 3SHOA 4WUTA 4Q9IA 1A2BA 1GSIA 2DFVA 3VBEA 4BLVA 3FZNA 3EOAI 3WGHA 2G9NA 1A9XA 1M2WA 2RGNC 2RAUA 4BX8A 3ADOA 4HLNA 3F9IA 5EZSA 2NUAB 3AL2A 4EW6A 5J47A 3TTXA 1SUIA 2O05A 1UC9A 3OG9A 1V2HE 2QN8A 1XL1A 3B51X 4HAOA 3SF0A 2RHCA 4C4XA 3K2IA 4WKBA 1NPYA 4IDHA 4BRWA 2ZJ3A 5KTOA 1JUDA 2I54A 1TO6A 2ORVA 2Y9MB 1DC6A 3DDUA 3CVYA 4MOWA 4FEGA 1HC7A 5TJ9A 1KXJA 1B0PA 3O3MB 3LVRE 3EPPA 4I1OA 3TL3A 4CEIA 4Z7NB 1TVKA 3V4SA 1D8TA 1N2GA 1Y8AA 1TLLA 1GILA 1SN7A 2XUJA 2ZQYA 3WMWA 4FCWA 4W7SA 5B2EA 4CQMA 3TOCA 2XJ9A 3T9FA 1S2NA 2VJLA 3Q72A 4XE5A 2WPNA 4N5NA 1FYWA 3SVLA 3PFKA 3KKLA 5DOVA 4D5GA 3KQSA 5JI2E 3KKKA 1FRVA 1CUXA 3IALA 2A67A 2NVWA 2GK6A 4FFRA 2CXUA 3A4VA 1SRRA 1BXKA 1Z4JA 3M6WA 4GX2A 2PMCA 5H1YA 2DHDA 3WJ7A 4B1FA 3JAMA 3FYUA 1VPWA 1JHVA 2C9CA 3FUCA 1GR0A 2V6GA 3IDZA 3WFIA 2ZPAA 5JS1A 2OHGA 3HFJA 4PS1A 3AV0B 4V0NA 3DPSA 4I36A 4KPYA 5FPTA 2BC9A 4R8VA 2JLXA 5B1HA 2PH1A 3FPBA 4TS3A 2IHVA 3LPMA 5FLYA 4XUDA 1E2NA 1WX1A 2R97A 5L3SB 1NKVA 5IRCD 2CL0X 3PK0A 1ZO8A 1TYCA 2ZPTX 1NBWB 1OZHA 5DOZA 3UF0A 1WZEA 5BN3A 1P31A 2A0FA 2R1VB 5ALOA 1B0AA 2HTEA 1MR3F 5IT4A 1W0KD 1XWWA 3DEZA 5HTKA 5HJ5A 3M6IA 2OQ2A 4ZXFA 4A10A 4RMGA 3R6WA 4PFSA 3B6EA 1MB4A 1G7CA 1HDYA 2C78A 2RBEA 2ZQ5A 3LQ4A 2QPOA 4OI4A 2J6BA 4DMCA 4XI9A 2C20A 5DTQA 3LWZA 4DIEA 1L4LA 1VPEA 5L6MB 2VJYA 1ZIOA 1JYFA 3GY0A 4KW7A 4OQZA 4WA8A 4PZAA 1ZESA 2ZJ7A 3A9TA 4EMBA 2B7BA 3JCZA 3IPXA 1JWLA 2RGAA 3I2JA 2QAGC 3IO5A 4JC4A 4XLTA 5EOVA 1VFNA 3AJ9A 1ZUNA 4BYGA 5EIEA 1KKUA 5JCPA 3H5VA 1K2VN 3THWA 4ZV4A 1U6KA 2H57A 4KO2S 1HT0A 2Q3EA 1CHNA 4LIPD 5G0TA 3KQKA 3MWYW 3M33A 2M98A 3K6SB 3EC7A 1X1AA 1D4AA 3FTDA 1AN0A 4Q93A 3ZI7A 4OBEA 1CS0B 3ZE2B 3PLAE 3UPTA 3AY7A 1E2PA 1VSBA 1UJ4A 1FUUA 3TLMA 5J1SB 1OB5A 3PBKA 3W9UA 1NNI1 2JJ2D 4WT7A 4RJ2A 3UJCA 4GKAA 9ABPA 3SEQA 1M0SA 4G0MA 2NU9A 2FFRA 4RHYA 2EL7A 2Z9BA 4X3CA 3NHBA 1GEEA 3F3KA 1G5PA 1PG2A 3GYBA 3DD1A 2XW6A 2I1QA 4DV2B 4HDRA 1ORHA 1PQPA 2B34A 4RV5A 3OVMA 4XVQA 2CVFA 4LWQA 1HMPA 2PVSA 2J09A 4KAAA 4EKIA 1EPUA 1U0FA 2C4MA 1WMEA 3EGIA 2A30A 3R23A 1V16A 4MQBA 3GUZA 2DWQA 3EVAA 3L7AA 3GDWA 3WLHA 1L7DA 4C6TB 2QUKA 1LUAA 1U7OA 1Z15A 3LXXA 2QN7A 1ELOA 4NCNA 4G2TA 4CKXA 1H22A 2JIDA 3GNTA 1A4RA 1UWKA 5K3FA 5IEBA 1PS0A 2NVUA 2FZWA 4MQMA 3KRTA 5CHYA 1SA0A 1UKEA 5DHSA 2DUUA 1UAAA 5CLQA 2WICA 3HFSA 1TTPB 3BC1A 2P62A 1CBUA 4G0YA 4BNGA 4TTQA 4EMUA 3GDGA 2HNKA 3U48A 5CYGA 4G8CA 3V5NA 4FZJA 4CFZA 2IHZA 1Z6TA 3IAEA 2DY0A 1AZWA 2UAGA 2W6CX 1YWGO 3AVQA 3IQDB 5E9QA 3TMKA 2MYTA 4JH0A 2PFGA 3U1BA 5A6SB 4DFDA 3BWYA 2CEAA 5HMMA 4KREA 3JS5A 3P71T 4KG7A 3PJEA 2P6UA 3GMIA 3E70C 3BRWA 2OBXA 5CDHA 3AL0C 2ZAOA 4IG9A 3EH2A 4KR0A 1Z26A 4RK6A 4CIAA 1C9KA 1P5ZB 3EGDB 2QZSA 5EINA 3ROZA 1FYFA 3CJRA 1YE3A 2XOKD 3HA3A 4QSMA 1M67A 1H94A 2CVHA 4U7DA 2WWYA 3T5PA 3PDWA 3G2KA 2HWKA 5F1PA 1OFTA 4YC7A 2ORYA 3GMTA 1ZITA 5D7NA 1E7RA 1U1CA 2PWYA 2DJIA 3H9EO 1QH8B 1UKYA 3OT1B 2BZSA 4S1PA 1UDBA 1EVQA 5ILQA 1M74A 4P7GA 4ZOAA 4FHGA 4YAGA 5JY1A 2FK7A 1ZD2P 3FX2A 5KQRA 4M9QA 1OV4A 4QYIA 4CEJB 3PHBE 1Q7EA 4ID3A 2Z8YA 4ZOQI 4CTNA 2WQ7A 4OAOA 1QCDA 2I67A 7GPBA 1MN6A 4KQHA 1W0JA 3N7AA 4G6ZA 3OLXA 5F5XA 1UXJA 1X6VA 2JAOA 3GW8A 5P21A 3V4PB 2D13A 4BCBA 5LOVA 3HB1A 3QOYA 4JBLA 1KDPA 2GX6A 3G13A 3V3TA 2BTQA 2PZMA 2VXCA 4W5NA 4BE4A 1VGRA 1MIOB 1JPVA 2PBLA 1O96B 1XX6A 2IY7A 1LFAA 3ET4A 1EDEA 2OD9A 1FNBA 2NN3C 2P9GA 4ZOLB 1WKCA 1EX7A 2BMEA 3G02A 5LZ8A 3U80A 1WZ2A 1KAGA 1EBUA 3TXXA 4CUZA 4OMDA 5HUJA 4OLAA 2VYVD 3PFIA 2UZ0A 2XECA 1T43A 3TR6A 4RXUA 1P62B 2JAPA 1EJ6A 4OSOA 4I14A 5AQEA 4XOUA 3DT8A 1E1QA 1UM9B 4LS3A 3W8RA 1UBFA 4EBBA 1K86A 3D3EA 3T94A 1MVOA 3UQZA 2X5OA 4N3BA 1ESMA 2CB0A 1KBQA 4LF7B 4O2AF 3VKWA 3AYZB 4C7OB 2JK1A 5EJMA 4MTLA 3P0FA 1DINA 3WLTA 1KC3A 1NJ1A 2OFOA 2Q4RA 3N2GA 1TYEB 4GPTA 4B6EA 5KYWB 4JVNA 1W34A 3FB4A 3U7HB 2HQOA 1T3TA 3ZQJA 5IJ9B 3HYTA 1PK8A 1RQNA 2OZEA 1B1CA 3L02A 3WK6A 3OTGA 4S2EA 1ZH2A 1MJNA 3E23A 3OLWA 3QX7A 2OHVA 1AQYA 1IYZA 4G1EB 1KAHA 2ZXUA 2VPIA 1Y9ZA 2HA7A 3GJ3A 4EB8A 2EX1A 3PRKE 3QLVC 2VF4X 3H5IA 4FDVA 4AO8A 3T5CA 1T26A 2FPOA 3NWPA 5CX4A 3WJAA 4MVXA 3GIWA 2H51A 3MELA 4UD6A 3WIVA 5EMKA 3WLLA 3CJTA 2G5GX 5T4FA 1MLDA 2Y1XA 4GSYA 4X92A 3UAVA 1E2IA 1RCUA 4CL8A 2PVPA 3F7MA 1P0IA 2D4HA 1A8PA 4MRMA 4AJLA 1SXJC 2IKSA 2IZ5A 3BCUA 1C4OA 2CNLA 4RK7A 3QFRA 3ANXA 4MR7A 3RO7A 1CY4A 2ZIWB 3OQNA 3GD7A 3MCTA 3SIRA 5B3KA 3FUVA 5I7RA 2C2HA 4LDAA 3W7BA 2F4NA 2RJNA 1E20A 1OYWA 4JI5B 4CYMA 4M0CA 3PKIA 5CW2A 2XCSB 3K1AA 4CJXA 3EXHC 3KEGA 3RRMA 1MORA 2BV3A 4BQRA 5JDIC 3IB3A 4HWKA 5LMCA 4RDCA 2AI3A 2C2YA 3L7OA 5IJ9A 4MUBA 1QHFA 1IM2A 2F2TA 2FLVA 5IZ4A 2H29A 2HA2A 3LVQE 1OMOA 1JWAB 4GI5A 4RVFA 1EFHA 4ZI2A 2BF7A 1CUEA 1Z39A 2QF7A 5KX5A 3G0IA 5TRTA 2CC2A 4JU9A 3MJVA 1UDCA 2I6GA 2I3GA 4I4TF 4KKXB 1TCCA 4CDRA 4CKCB 2GRJA 3TEMA 4MUIA 4MZXA 1VIYA 4Q4AA 4YRFA 5FHRA 3U17A 3I37X 5PGMA 5EWJB 2PZEA 3P2JA 1SBHA 2C1XA 2G1KA 3DKIA 3VSCA 1ANKA 3RQIA 5IU6A 4Q7LA 3VKGA 2VVTA 3E9NA 5DE3A 3GLIB 1FVOA 4UZEA 1PBTA 1T9DA 1E7SA 4I19A 4O02B 3ZDYB 3SC6A 3W6NA 5KOJB 3EVEA 3ES9A 4IVRA 1JDNA 1PDVA 3BILA 1W75A 2CJPA 5E38A 1IEVA 3RJ9A 3VU1A 3AVYA 3HU1A 1HOTA 3RVOA 3T3IA 3IAS1 1L4EA 1ZMXA 4EH1A 4P53A 1CQPA 5LZ5A 4F9FA 2B5OA 5JNUA 3L3BA 3UMMA 2DT5A 1O4WA 1X74A 1I3MA 3X1KA 1GZ7A 3JWGA 2KM1A 3I2IA 4MX8A 4R2KA 3AC0A 4F5ZA 2AOVA 4B3SB 4OJYA 4BVBA 1VI6A 2P4UA 4X1YB 4GM1A 1OFUA 3H0CA 4JVMA 4F6LA 4DBLE 3QOWA 4RIIA 4Y9DA 3HCAA 4IMJB 1VKJA 2QUBA 4UTVA 4NMHA 4WINA 5LBUA 3E4DA 3PNMA 4OK3A 1KJWA 3GDFA 1WB4A 4FCCA 4HDSA 1RLMA 3ZVMA 4HR7A 1NG9A 1KC1A 4PVDA 1IVNA 4YIHA 1M1NB 2FEWB 2P2DA 2PGOA 1P1RA 2ZJ2A 1SOMA 1XA4A 5AKZA 2DRIA 1SHLA 4TMVA 3C70A 4IFEA 4UMEA 1V4VA 3DBRA 4S0ZA 1RYZA 2ZUSA 5AKLA 3JQBA 4PIMA 1Z47A 1UWLA 4OIFA 2Z58A 1T5OA 2X76A 3HMKA 3WADA 4P93A 2Y1EA 1ZVQA 1O03A 1ORIA 4ESHA 4ZC1A 3SX0A 1M83A 3W2TA 3ZOKA 3ETDA 3DF7A 4FFWA 3U3MA 4JSTA 3K4PA 1V4BA 3UB4A 3PE3A 1TT5B 2XA9A 3QX3A 2W98A 1Z13A 1T8WA 4JQZA 2J87A 2OFPA 1FPQA 3HH8A 2C58A 2ZAIA 4ISBA 3H9UA 2IPAB 2OB1A 3GEDA 1R4MB 2IXAA 3R20A 2DR2A 1SNYA 4YV7A 3TVDA 4WY5A 3V8MA 3I5XA 4LY3A 1L5ZA 2A4MA 4B4DA 1UPTA 4ZI7A 1XKXA 4RKWA 1OOEA 1EUCA 1V16B 1FYVA 2PNFA 1VMDA 2FEPA 1JA0A 1SD1A 2GOYA 3COYA 3JZDA 3OJWA 5AHRA 4Z0HO 3VYVA 4D9IA 3IT1A 1UXIA 2KW5A 1WHTA 2YV2A 5FUXA 5J4KA 3KQPA 1GA1A 3TQTA 3HJBA 4PNZA 3U7IA 3HJCA 2NTJA 4MVJI 4U8GA 1ZJ5A 2BGMA 3OE4A 3M4JA 3KXKA 3L43A 4QQKA 1OH6A 2FR0A 5KHAA 4GVLA 2BLLA 1OREA 5JMOA 1ACJA 2NUTB 1VIMA 3JALB 3K05A 3LQFA 3HJRA 1JDBC 1HYBA 2R60A 1L1FA 3VYTB 1D2GA 3FJOA 4PYQA 5HK9A 4RV9A 3N6VA 5H82A 1QGDA 1T6BY 3LW7A 5BV1A 1JQAA 3NU1A 3PFFA 4F97A 2JHFA 5TF4A 4BMPB 2OQIA 1CS0A 1ZJ6A 2AJ8A 1UWVA 1TCAA 4R1UA 3TIIA 1S8OA 1EUQA 1CEEA 2HK6A 1D0VA 4QHYA 4I4IA 4Y2SA 5KU7A 1FYEA 4QOHA 1JXQA 5JATA 3AMVA 4JX9A 1J90A 1V5FA 3DLAA 4M9UA 3GLQA 3IDSA 5CIQA 5DCLA 4DIFA 2HZBA 4EI7A 3SLRA 2DFPA 1D4FA 4HAYA 1NFFA 3RTCA 3CUEF 1NE7A 3IYLW 2OXTA 3KLNA 3N39C 5HQJA 3K1JA 3TS1A 2V1UA 4EHJA 4L5CA 1L4UA 1IHPA 2OKCA 4HN9A 4E70A 1VZ3A 1P7CA 1XCLA 2L19A 3BREA 2AJBA 4IMIB 2K5UA 4JA2A 3OZVA 1SU6A 4PHTA 5AUOB 4KQ9A 1UXGA 2Q9BA 2YMQA 4OQXA 2N0SA 4BJ3A 3GRKA 3PSHA 4P54A 3U4GA 3OQMA 1GG2A 2HQSA 5L45A 4JHLA 1N3IA 1PU2A 2OXCA 3ZQKA 1DE0A 1P4GA 5DEOA 3TL6A 4BC1A 1CDDA 3PIDA 3NM4A 2YJGA 4DF3A 1N57A 1OFIA 1EM8B 3DTNA 3HY3A 3PGLA 4QELA 4EZEA 3TLJA 1ZM7A 4O1MA 1S9HA 2B21A 2JI4A 2P4QA 5CX1A 1T8RA 3STXA 4BNTA 4PO3X 1BD3A 1P77A 3UPDA 1RXIA 1PJBA 3GGOA 4NTZA 5HEKA 3OQHA 1R5OA 4L02A 3NJ4A 4PPNA 1HZZC 3UUEA 1J5XA 2GMWA 3LCVB 2VKTA 1G59A 3WSVA 1Q12A 3VPHA 1QIDA 4GQBA 3SK0A 5CCEA 2GT1A 1KRXA 2QRGA 3VNQA 2FG5A 3PNYA 4TYNA 3ETNA 3JQDA 1VXRA 1O6FA 4OY3A 4BNFA 5HHTA 1DOZA 2CJYA 2JZOA 2JIMA 1T36B 4DLVA 3GPIA 3RAPR 1SCBA 3FXAA 2PM8A 3KJEA 1V3QE 2O7NA 3W8NA 2WKRA 1KIAA 2CXRA 3DYVA 1IXKA 2IXDA 3GT3A 3GPBA 4B4OA 4Q39A 4Y1FA 2IF2A 1DEXA 1X38A 1JR4A 1H69A 1QFZA 1Y63A 1E79A 2BEJA 4RWZA 4CM4B 3H13A 4EFLA 1UZAA 2RB5A 1M7BA 2ZBEA 4MVJP 4BX3A 5A4AA 1IXRC 1NW5A 1C2YA 4KV7A 2GTPA 4L75A 2WB2A 4LTMA 5FTWA 2A9VA 4CM8A 3KU1A 2OZLB 2WNHA 2HHAA 1OFHA 3QPVA 4MKGA 4J90A 2NZJA 4PGGA 4QASA 4A6EA 4CEHB 3EN0A 4J0IA 1Z2DA 4YMLA 3JASA 4RVCA 3I1YA 3ZCQA 3EPJA 4KXWA 4KN8A 5JMWA 3EVZA 2EKZA 1V41E 1BXZA 1Z0ZA 4H7HA 2NUAA 3O1IC 1J2UA 2BMDA 1OFGA 3BXHA 4Z8YA 1JLHA 1EHIA 1QZZA 2YUIA 4DXAA 3VTFA 3NH9A 1AKEA 5CCDA 5KOYA 1KEUA 1PV1A 1P9LA 3GNQA 4FYMA 5DT9A 1C7RA 1H3EA 2YFQA 1YB4A 2O5VA 3IIIA 5BYAA 1UMCB 3THYB 3DE5X 1V45E 4DSOA 1VECA 2JGEA 1M2VB 3AFMA 4G97A 5IAGA 5CLIA 5TJHA 4W7HA 5KTRA 3IDOA 1GAEO 4QBHA 5I47A 2UYGA 5D1HA 1UDRA 1NXPA 2UV8A 3WFZA 3T6KA 4J0KA 4E5UA 4WJZA 4D2IA 3QW4B 3VDMA 2EXXA 2HCTA 2C99A 2WKWA 4W6QA 3EZLA 2YRWA 4IV8A 4EA9A 3WB2A 3G6WA 2AFHE 3RJMA 1IN5A 1L7OA 4BEJA 2A7XA 3HJGA 4HXGA 2QAGB 3WLSA 2DETA 3EPHA 4AIRA 1UMKA 5IJWA 3LVBA 2WFLA 1MGPA 1I0IA 2WU4A 3Q7EA 4KWEA 3S2YA 4F86A 4YAEA 4Z1OA 1IK6A 1JZSA 1GYRA 3EK2A 4UZSA 2B1QA 1L5SA 1QHSA 2CDNA 4X91A 1SUWA 1ZW6A 1UBKS 1TIKA 3K5WA 3B2EA 4AY4A 5JALA 3K73O 2FV8A 4H6VA 1Q1NA 2IP1A 2MSKA 4MW2A 3GH1A 5IVKA 3P2OA 4CVNA 3DG9A 1HYGA 4FYIA 4EEKA 1D3AA 1UOEA 1W93A 4U0JA 2QIOA 3KSUA 3EEBA 1NNUA 3NWEA 4W8GA 2QY6A 1A8SA 1CWUA 1GADO 2HDOA 4H15A 4ZVNA 2FUCA 1G98A 4JOSA 4RENA 2H3HA 2V6FA 3NKFA 3RJ5A 4A8JA 3KTAA 3HXOA 1C41A 3MGBA 1J23A 3SS9X 1YIDA 1RM4A 2EU8A 3CLSC 1HL7A 5CVTA 3QELB 4BE7B 3MWDB 3UMJA 1W8DA 3T0IA 3QKSA 5CH8A 1ODLA 1QQTA 3CLRD 1O87A 3DBLB 2PUDA 3NZEA 2F6RA 5AW3A 4Q34A 3ZHUA 1W52X 1BVRA 5JS6A 2C4NA 1CNMA 4NULA 4U02A 2RCYA 3H9GA 1XI2A 2PGIA 2DG2A 3FF4A 3ITKA 4XX0B 2MOKA 4QYXA 3LQKA 1Z4OA 3DE4X 4GM0A 4A6PA 4B8YA 1JAYA 1WMAA 4JKOA 1E2JA 4B84A 3GLFE 4HFMA 2ZVPX 1TUGA 4OREX 1C0IA 1CNFA 3UA4A 2IXEA 1PGQA 2W42A 4XIGS 4BP9A 1P1IA 4JITA 2R65A 5EY5B 4CLOB 1HTTA 5CA1B 2JKVA 3H4IA 2FF5A 4QOJA 4FMBB 3NV7A 4JB8A 2ZUTA 3WC4A 5K6RA 1G8FA 3FF1A 3GRUA 3O2SB 1XEXA 4BB9A 1Q1AA 3SX4A 1ZD4A 1DKLA 2JL1A 2Q3FA 4A73A 3JXEA 2XD4A 3SJUA 4DR1B 1RXWA 3F6SA 1I2BA 3QVKA 4AKEA 3C16C 5ARDA 5FWDA 5BV7A 4KYUA 1FC0A 4QHTA 4E3ZA 5L4SA 2I62A 3FPAA 2Q2NA 1LF5A 3IEMA 1LBQA 2CUNA 1Z83A 3HKCB 3LFUA 4HMQA