25C8H

Catalytic antibody 5c8, fab-hapten complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
217
structure length
217
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQKPEQGLEWIAQIDPANGNTKYDPKFQGKATITADTSSNTAYLHLSSLTSEDSAVYYCAADPPYYGHGDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for antibody catalysis of a disfavored ring closure reaction.
pubmed doi rcsb
molecule tags Catalytic antibody
molecule keywords IGG 5C8
total genus 40
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 25c8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 25c8H02
4X4ME 4JDZA 2A73B 2DQCL 1N26A 1WLHA 4GAYA 4JFPA 2BZDA 4PS4L 3RU8L 3LRHA 1KGCE 3CMGA 4Z78B 1BQHG 3G5XB 4TSAH 4WW2B 3VJ6B 4NQCE 3PGCA 3LKSB 5E2VL 5FKAB 5JPNB 3BMWA 3H42H 4PJCE 4RGNE 2Y9RT 5HYFA 3DX8B 5KVGL 3TVMD 3FJTA 1U8MB 2R4SL 4H26A 1R3KB 5GGVL 2EEBA 4DKAA 1INEL 5IB2B 3EIFA 1BF2A 4CDGC 5A1AA 1H8SA 3FZUD 3LSOA 5DMGD 4MB4A 2IG2H 1BFOB 1KIPB 2VLRE 4IMKA 5E2UH 3QG7L 1FN4B 2BOCA 2VQ1A 3HNTL 4N9OB 5BVPL 5TGBB 4CVZA 4PRDA 5MEND 4JPIB 4R0LC 5LCVL 2VIRA 4PRHD 1FC2D 2HJKB 3NPZB 3RTQC 5IB4B 4ETQB 3OKKA 4F57H 1U3HA 2FJFB 1EEQA 3QCTL 4G6AD 3PNWA 4GG6F 2DKMA 4J6RH 3QQ4B 4P5TB 5TH2B 1OP5K 1P84J 2W92A 1ZHKA 2BMKB 5E6YA 3DUHA 4LSPL 4HG4K 3OX8B 1LDSA 1A6WH 3I75A 4HFWB 5LAXA 3T2QA 4MXVE 1HYRC 5ESQA 5FYJL 1FFPA 1LO4H 1JGEA 3QHFL 4EN3A 5JR1H 2Y06H 4Z95L 1EERB 1DQLH 4F2MB 3B8YA 4HS8H 2YN3A 1EHAA 1KPUA 2A6IB 3T0EA 3MUGB 2C26A 3GHEH 2JB6B 4YJZL 3T0DA 1DBBH 3MGOB 5EBLA 4GW1A 4PJ5B 4F37K 4XWGL 1F6LL 5SWZE 3REWA 5L2JA 4P9HL 1A1NA 5FA3A 3T65A 5E2UL 4M48L 1QBMH 4HHAA 1ZT4B 3SGEI 4X8XA 3W81A 2YD9A 1IC5L 5FM8A 5BJTA 5T1LA 4KROD 3IJSB 4F9LA 1WIOA 4JFYA 1NMBH 4ODWA 4OFDA 3WHE0 1CFQB 2VDQH 4I1NB 4GKOA 4Z7NF 2XTJB 4G7VL 3VFWA 4FQXC 4M1GL 1U95B 3WIIL 2K9UA 4WHCA 4CAGA 1FO0A 1QFPA 4WGWB 3QZWB 3F7YA 2PYED 4OI9A 3BPLB 5SWSA 1SJHB 3KYNA 3I2CL 4JRYA 4ODXB 2A9NH 3BEVA 4MQSB 1S7VA 3TPUB 3TV3H 3KPSE 1ZGLM 3WS6C 2CRZA 2F5BL 4X6FA 3V4PH 4JAMB 2XNAB 2YOCA 3DO3A 2NXYC 3P9MA 12E8L 3L1OL 3MFFA 1GAFH 3OR6B 3MOBL 4JRXE 2X4PA 5IKCB 4YDIH 5E6ID 1A2YB 5KVGH 2YC1A 4XVSH 2VTFA 4WFFD 5EG6C 1EFXB 3QHZL 1GGYA 2DWDB 2ZWLT 2BC4B 4GMTL 2R9HC 3MX0A 4P0DA 1NMCC 4XTRD 1MFAH 1WVZA 4M48H 5ERWB 3W0WD 3LS5H 4O51B 4JM2F 2YWZA 2X1WL 4PJFE 3C2SA 5C0JB 4LASL 1RZ7H 4EI5C 2XWJA 1QVOB 1VEPA 3F7VB 4ZO9A 5SX5H 1CLZL 3U30B 3DGGA 1JPTL 1ADQH 2OJZH 3MC0A 2A1WH 4QRTB 3WNPA 3EO0B 5D72H 1T21B 3SKJL 4NZRH 3SJVD 1A0QL 1NLDL 4XCYA 2MCPL 3OPZH 3PWPB 1IC7L 4Y4HD 3MLYH 1VGKB 3IYLW 4XP1L 4D9LH 3CFJA 1AHWB 1RU9H 4HKJB 1QSFD 3VXRB 5E4IA 4D3CH 3MJ9A 2R69H 5F7LB 4TNVF 4K71C 3B2UC 3BP6A 3IDJA 4AT6A 5D2LE 5CP3A 4PIRF 1T89C 1FIGH 2GK0B 4PJ9C 5TE7H 4PJBB 3P9WB 3BX7C 4M7LH 4L4JA 3D3VA 5DJYA 1FO0H 1T66C 35C8H 2IBBA 4JFHD 4IHOB 5EU6E 2F74B 1RULH 1QSED 4OZFH 1Q9WA 1CK0H 1NCUA 2CKBA 1F8TH 4HC1L 4OF7A 4RGNB 5ADPH 1FLTX 1G6VK 3ILPB 3MRIB 2XZQH 4EUPA 1MY5A 3WMSA 4O2EB 1IM3A 1IAIM 4I13B 3FTGB 1I8MA 1N0XH 2VLKE 3RVXC 4MVBC 3S37X 3BE1L 3TP4A 1NCAL 2UV3A 1GZQB 1S5HB 3VFVB 2KL6A 5CMAB 1GGCL 4AG4H 4HIIA 3RVWD 2L7UA 4YBQD 4PRHE 1YEHL 3GB7A 5C0ND 4PGEA 4JN2A 2EKSA 3DX9A 3X17A 3NZ8B 1SY6H 1H3PL 3P9LA 1UG9A 4ENEC 1V3KA 2O26U 1N5AA 3TBYA 5FKPB 4LAQH 5L2KE 4AEHH 3VGAC 2VC2H 5L88L 4JRYE 4I8DA 4MJ5B 5AZ2L 2CKBH 3MA7A 5HGAA 5HI3C 1FQ9C 2HJLB 5BOPA 3BIKA 1U58A 3IU3A 5MENB 2HJLA 1MHEA 1WUNT 5IQ9A 1WBYB 1DL7H 4Q6IC 2LFGA 3UP1A 2FB4L 7FABL 2NMSA 4JZJB 3DXAE 4R96A 1KIRA 5HHNA 3I6LE 3FQRA 3BISA 2XFXB 3MJ9H 2VRAA 4JKPH 2Y25A 4CW1A 1FBIL 1DVFA 5TQ2H 3CH1A 1MREH 4TUJB 1ORSA 3JVGA 4ZO7A 5BO1H 3OKDB 5F9DC 5I76A 1ZLWK 5LBSL 3V95A 3KJ4C 2IGFL 4TVPD 5DA4A 5HVGB 1LK3H 4J4PD 1Q9KB 2VDLL 5FHBH 3PWLA 4YUEL 5E00B 3CMOL 5KZCD 1TCMA 5I8CA 4UIKH 1GPOL 5CEXB 1RU9L 3E2HC 5J57B 4NQEA 4S2SB 1CGUA 4MAYD 2BJML 4HWBA 4XMPL 2A83B 3KPLA 2BJMH 2XG5A 5TF0A 5J6GA 4PJCB 5GGSY 4JFFB 1Y18A 1YMME 1MI5A 3RI5K 1RIHL 2GTWA 2X4RB 3MUZ1 1NDMA 4P46D 2WLZA 3IXTA 3TO4A 2L0DA 5DZNA 3QJHB 3D25B 4JB9H 3NN8A 2QV2A 3OAUH 3CC5B 4DK3A 3U79A 4BA8A 4GG6A 3KPTA 1Q72L 4G7YL 1BECA 2APTA 3BPLC 2BRQA 1XGQB 3TT1H 2V17L 3NCCB 2B7DT 1E27A 4LSUH 1P7KA 4JDVA 1UENA 1JI1A 5EZLA 3H9HB 4K8RC 4NQXA 3EGSB 2ZUYA 5BVJA 1UM4L 3CMOH 5E6IB 2VITA 4J3WA 1A6AB 3O2WL 3TO4D 4LMQI 5DLML 5JNYB 5T1DL 2MQ3A 4PLNC 1M7IB 3DTXA 5DHVH 2CKBL 1MCQA 4U1GB 3VXOB 2DI8A 4NCDA 4X5WA 4UB0L 1JUFB 4XPHH 1SJEA 1S5IH 1U3ZA 2HFEB 1MRDH 1GIGH 4TRPH 4YHNB 4TN9A 2O5XL 3P9MB 3BGMB 1C5BL 1MUJB 4JY6B 4RGND 3U1SL 1WFTA 3VXRE 4OM1L 3MLRH 1OL0A 1FH5H 1OGAB 5IBUB 1KCUL 1ZGLB 4OGYH 4MS8C 1J5OH 3LQMA 1MY7A 1I1YB 4HGKC 5F9JA 3QRGH 1PEWA 3F7YB 4AM0A 3DI3B 4YFLI 5LGJA 3PWUB 1KPRB 1QSFB 4BKLB 1LEIA 4ZD3L 3H0TA 1OCWH 1U8PB 1DLHA 4P5KB 3K3QA 3TCLB 1EEUA 5CD3B 3LKPB 4QOKA 3D0LA 5BJTB 4DUVA 3HMWH 3RZCB 5E99H 2V7HA 5TE6H 1V8HA 4PJGB 3D87B 3A6CH 3TJEH 1CVSC 5DMIH 5T1DH 5C0CD 4OIAA 2P45B 4K3JL 5KSBF 5L2JB 3R1GL 4G6JL 3G5VA 3QJFB 5DK0B 4YAQB 1OP9A 4UV7L 4X99B 5HDQH 4UV7H 1WAAE 3ZDZE 3O2VL 2WINA 4BKLA 1IGTA 4DKFH 2NY3C 3MNWB 3DMMB 3QA3B 3PL6A 3OMZA 1HHGB 1QTYT 1VPOH 1A6ZB 5C0IB 1E4JA 4UOW0 2OI9C 3QXTA 2IAMD 4ERSH 4XNZB 5A43C 1IRAY 5GS0D 1CFVH 2VLJA 1FAIH 1V05A 1HH9B 3JTSB 3QXDA 4GKNB 5HGBB 2VDMH 3SOBH 1T1WA 1I7ZA 2CJUL 3BD3A 3C5ZB 4PJEF 3HCVA 3B9KA 4K9EC 5GIRA 5ADOL 1ZVYA 1KIUA 1C1EH 1MFBL 3WUWB 4F8QA 5T3XE 3DHJA 1CU4H 4WI2A 3VFMB 3GNMH 2HVJB 4N0YL 1AXTH 1YEDA 1KELL 4Q9QL 3PQYA 1E4XH 2GUOB 4PJ7E 1AD9A 4LDOB 4LSPH 1TTFA 3RWFA 5HHOB 4MAYB 4IRJC 5A2FA 2YD4A 4R7NA 2EDDA 2N7BA 2R2EA 5HHVH 5KAQF 2PCPB 3CFIC 3V0AC 4HKZB 3O2DL 1ZS8B 2B20A 4JFFD 2A6KA 2BVQB 4P23A 4HV8B 1P4IL 4XPGL 4XP6L 2H32A 2VITB 5HHPA 5E6IA 3QH3B 3GMLB 1KIQA 5C08B 3AREC 4JO2L 3GHEL 5E56A 4WNQB 2ZNWA 2Q8AH 3VH8A 1ZA6A 5DRZA 1WC7A 1MRDL 4JFFE 4J1UB 5D71H 3RKDC 4O5LH 1A14L 4JRYD 4QF1A 2PXYD 3HMXA 3ULUL 4MWFA 3AREB 1IEBA 2YZ8A 3EYUL 3MPCA 4JHZA 3P30L 4NUGH 2G75B 1Z9LA 5D6CB 5T3XD 2AJUL 5EZIL 4JFPB 3BH9A 5J0BA 4HGWB 1X5ZA 2H3NB 2JCCA 4NKMB 3C9NA 4OLWL 3WJLC 3L5XH 4CKVX 2AXGB 4RAVB 5DUML 2A0LC 1NDMB 4LSUL 3OKEA 1H15A 4M61A 4XBEH 3ZLQC 3OKMA 3NFNA 3S5LB 5D2LF 5KSVB 1WT5A 1N7ML 1HYSC 2EYRA 3HPLB 2H2PD 1VGEH 2A77L 2YUWA 3QUMB 4P46B 4XHJC 1OSPH 3OKYA 2IQAA 2VC2L 4V2CB 4NJAH 5B4MC 2E7HA 4PG9A 2ESVB 4OZIA 4XH2A 4PJGE 4QRQA 4MJ2A 1U41A 1RZGB 4XVTH 4PJDF 1HK6A 1QFHA 1J8HE 3BIBX 2FATH 3VWJD 2W9EL 43CAB 3NCFB 1HKFA 2NY3B 3VXSA 4L4TA 4PLKD 2ILLA 4ZFOA 3QHZH 2G75A 4P2RA 5I8KH 2OTUB 3TNMB 4AEIL 5EIVA 3EAKA 1ROWA 2YPLE 2XXMB 4RGOL 3WIFB 1X5XA 3AY4C 1FG9C 5DYOA 4LHQB 1PG7H 3UMTA 1J05B 4XBPA 2ERJB 5E0QA 1S7TB 1BAFL 1PDKA 2ZSVA 4BH7A 1WZ1L 2XQYG 1Q9OB 4PJAF 3GJFB 2VSCA 4L9DA 2JJSA 5HYSG 3QDHA 5LBSH 4XBEL 1HHKA 1U8QA 1ZS8A 3AB0B 2GJZB 3ZTJG 3LD8B 1G9EA 5D1XB 1QA9B 2IPUK 5T5FL 1T1ZB 4Q2ZB 1VFMA 1KJMA 4ZO8A 1KC5H 5GS1C 5FKPA 3RUGE 4BUGA 3IRZA 4UT7H 4CMMA 4K3JH 3T3MF 5GGQH 4FFYH 4YXLL 2VABA 2C7UB 3V4PL 4JN1H 1F90H 4LMQE 4HH9A 3QWRD 4P9MH 4LKCB 3VMNA 2YD6A 3MREA 5CINH 5HHQB 5ICZA 3ARGB 2VLJB 2EDLA 2YA1A 3GMOA 1T22A 4N5ED 4KHXL 1OD9A 3TZVD 4YDKL 1JGDA 5TDOB 5DSCB 1HQRB 4Y19A 4RX4A 1QSVA 4A2MA 4UQ2A 2BCKA 5E2JA 4K3EH 1E28A 1Q0YL 4GRWH 4KKBC 2MMXA 5HGDA 1Q9WB 1VFAB 1S7XB 1YY9C 3T77A 1PKQA 3LKRB 4PJAE 5BRZD 1PSKH 5F97E 1A4KA 4V1DE 4HCRL 5T1MB 4OLZL 3D0VA 3BO8A 4HCRH 5ECJE 4G6FB 2HFGL 1V3JA 3OKLB 5JIPA 4PJ8D 4IRJD 2DYPB 4K8RD 1EO5A 5BS0E 3GIVB 4AH2B 5JDSB 3MRQB 4WTXA 4LCYB 4OV5B 3UJIL 5FF6A 3L95B 4HK3J 1UWGH 1T3FA 2B39A 3H0TB 5BMFL 4R90L 5K9KA 5ALCL 2KDGA 5GSRA 1LEIB 1R3HB 4MD4A 3UAJC 5GXBB 1LD9A 3GSNH 4LCWE 4Y5VC 1RUPL 1G7MB 4XMLH 4R4NC 4U6TA 1YEJH 5DD3H 2VUYA 1QRND 1L7IH 5F9JB 4JO4H 1MF2H 1X4YA 4UNUA 3GMMB 4MJIE 4WFGE 3MJ8A 1M6OB 1S78D 1YEIL 1CE6B 1N4XH 3MNZA 5JMRA 4ORGA 1OAYH 2VDNL 2P8LB 4YHNA 3E2HB 1NAKH 3BWAA 4FP8L 3V5KA 1F5WA 5IF0B 3OAYK 3S96A 4G42A 5I1HL 4KK9D 3DO7B 4NUJB 4R2GB 5D72L 1ZT1A 2GSGB 5CP3H 5DHYB 4U49A 1M7IA 4NN7C 2D4FA 3PHOA 1ED3A 1B6DA 1A21A 1HNFA 1GGIL 4TSBL 3EOBA 1J1OH 4FQQB 1DN0A 2EO1A 4BJLA 5CJXA 1QLRB 1BOGA 1CD1A 1U93B 3SDAC 5IMOA 4EDXB 5CFHA 4K55A 1KG0A 2HFFB 5F3HB 5HHVL 5JR1L 1EFQA 2PXYB 5ID1A 1YQVH 1QG3A 4QY8B 3X13A 3I6KB 3NA4A 4O2FB 3VA6A 3RX8A 3OTTA 3DLQR 2LU3A 3DIFB 2FL5A 4Q6IB 1ZV5A 1LO2L 4OD3L 4G6ML 5CSZA 5I18H 2Z9TA 4L4VB 3FOLB 5M95B 3KPRA 1IGCL 5T1KD 3VMOA 4BQ9A 3NN8B 2VLLA 1J7VR 3K4ZA 1YEFL 4KDTC 1YPZA 4LVNC 3LEXB 1D5XA 1BIHA 3O3BA 4G3YL 5CSBA 2BY1A 3WJJA 3RWCB 4N8VB 5FK9A 2P5EA 2RFXA 4F37F 3U0TA 5HXMA 2OK0H 3EYVA 4X0KA 1PX3A 4P4RA 4YGVA 1X5IA 5DFTA 5E8OA 5F7HA 2OK0L 3TIEA 3GNML 5DGRA 5DQJA 4ONGL 4QWWD 4GBXA 1QPXA 2J3SA 5KJRH 4QRPB 4YDJB 1N5YL 3HZKA 4IMLA 4JVPA 5I8CB 4ZSOE 4Y5XC 4GW5A 3QIUB 1F97A 3ZSTA 4FFZH 3TZVA 1DR9A 2JIXA 5BMFH 1OSPL 4OCWH 4HS3B 3T4YB 1G7HB 2R4RH 3SPVB 5L2KA 3LIZL 2XRAL 3FQNA 5IM7B 1I3GH 1UM5L 4NHUB 4WO4B 5I0ZA 1MCPH 2AJYH 4IJ3C 4CU8A 3BZ4A 1LO2H 4YDLB 5L8KB 2QTEA 2FJFA 4L8SA 5F1NB 2VISA 4P57B 2P47B 3RI5F 3RGVC 2O5YH 4HIJB 5I1JL 4XC1H 3P4LA 5AZEH 4JPWL 4YO0A 2B8OT 4KHTL 4ZYKB 2BNQD 2NY4D 1AR1C 1TPXB 4U2YA 1X5JA 1CFBA 5D9SB 2DM3A 4KJQC 4JKKA 2J6EA 4P2OC 1NBVH 4XGZB 2EKJA 4NFCA 5HGAB 4R8WL 5I8OL 4FG6C 2X4QB 2HLFC 4HJ0D 1ITCA 5E8EA 4N8VG 4IMKC 4MCYA 5CLTA 4I5BB 4PPTA 4L8CA 2DKUA 1MFCL 1FVCA 2DQEH 3NZ8A 4WU7B 1QNZH 2AJXL 5HTSA 5F7FA 4GKSA 4ODHH 3QCUL 1RV6X 1LWRA 4U3HA 2YMXL 5TF1H 4G8GD 1RUMH 2ATPB 3FO2B 3V5DA 3MRBB 1FJ1B 4PJBF 3N1FC 4MD5A 1P4LA 4BK5A 2W0FA 3RGVA 5IG7A 1IM9B 2YR3A 4KROC 4BSVA 1UACH 1MIMH 2FSEA 2CLZB 3BSZL 4MX7A 1KOAA 4X7TA 3UDWC 35C8L 3QUYC 3WFEH 4S10A 3HI5L 3QQ3B 3GBML 1S9KC 2NXYB 3ULUH 1IC4H 4P23D 5CZVH 3ARGC 4PP2A 3KNBA 4WU5B 4DZ8A 3GMNA 4PJFA 3D3VB 5LQBL 8FABB 3ZHLA 5KSUB 2VLJE 4MMZC 1FYTB 1KLFA 3GMPB 3AS1A 4D0DA 3U4AA 1GGCH 4HZLB 4PGBB 3LZFL 1FNLA 1HCFX 4O4YL 3WLWD 1OF2A 2BNUB 2DQTL 2J7LA 1CGWA 5BV7L 3ARPA 4LGSB 3C5ZC 4MNGB 1DBMH 3CNKA 1UC6A 3L3JA 1ZLUH 4X4XB 2R1YA 4B7LA 4K3GA 4KKNA 1UJ3C 2VDKH 3FRUB 4XCNB 3O6KH 1UFUA 2X4NA 2ITCB 1IKNC 1ZLVK 1X5FA 1IJ9A 2EEAA 1NCNA 5SWZB 2D2OA 5KS9E 3L3DB 3JWOC 1ZOXA 2UWEB 4H0GA 2NY6C 3QIUA 4UQ3A 1YYLH 2V9RA 2AK4A 1ZHNB 4OD1L 1T7WA 2ARJQ 3ZMRA 1N8ZB 2F5AL 4GT7A 2E6QA 1FGVL 5C07E 3MLVL 2BC4A 2DWDA 2VO5A 2MFNA 3EYVB 2DM4A 2YEZA 1AFVL 2ICEB 4X7FC 4OCMC 1HWHB 3VFSA 4UMGA 2XZQL 3HNVH 1C7SA 3FO0L 3TA3A 4L4VE 3MFFB 4JR9L 1D5XB 3O3BB 4M5YH 4N8PA 1HDMB 4DAGH 3L3OB 3UROR 4FZEL 1RK1A 3BWUC 2OR8A 1S7VB 3F7QA 3IFPB 5TE4H 4K8RL 3KYNB 1CVRA 5FYKH 2YUZA 4RIRA 1G1YA 3BP4A 4FFZL 3VXPB 4LOUC 3BZFB 4FA8A 1JPSH 2AVGA 2FRGP 1JF5A 1J0KA 4MQTB 4XCEB 2F58H 3PV7A 3C6LC 4TVSa 5DQ9A 3I6KA 1UXSA 3LS4L 5D7LB 4JDTH 2ZCHL 4KZEL 4JY4B 3FN9A 3S5LG 1D5ZB 5DD3L 3QEGH 2H1PL 4MA1C 5GPRA 4KI1A 4XVSL 1NFDF 1XGTA 3AXLA 5F6IC 5TFSH 4GRMB 2EDWA 2NW2A 3CJJA 4DZBB 3MLRL 1ED3B 1NAMB 2OLDA 3PHOB 4HC1H 2FYYA 2KZ1B 3EYSL 1RULL 4J12A 4UT6H 4H88L 5FUCC 5IF0A 4OCXL 1PZ5A 3SDAD 3WFBH 4M5YL 4JJHA 2IH1A 4TVPL 4OAWB 2GEEA 2R2BB 4AG4L 3AY4A 3VW3H 2QADB 2WANA 3BKYH 4D9QE 5ESQB 4OJFH 3ZE2F 4HC1A 4U2ZA 4PRIA 5H8DA 4LGRB 5DJ0B 4HJGB 4L4VD 5F9OH 4TVPE 1BWMA 1M4KA 2NQCA 3O6FB 3RWJA 4NKDB 1WISA 4ODSH 2IQ9H 4IIQC 4ETQA 4FFVC 4KK8C 1G9ML 1EFXD 1JTPA 2VNCA 5I66A 2JK5A 3H3BC 4BH8A 1VESA 3IFLL 1MIML 4S0TD 2ZOLA 1JZ6A 2VQ1B 5HSFA 5I1EL 1N6VA 2QEJA 1CGYA 1H3GA 5D7JB 5ENWA 4L5FH 1XZ0B 4W68A 1KN4L 5EU7E 2PW2A 3MLTB 5DD1L 4DN3H 3OKLA 4RGOH 4M03A 5F96L 4HLJA 5CHNB 1P5UA 5GRYA 1K5NA 4DZ8B 3BN9C 2APVA 3ZYIA 1CLCA 3HR5A 1LK2A 3X11A 4X8JB 3MQIA 3TO2A 2CXGA 4UTAL 1T0PB 4GG8B 1MFBH 4M7ZB 1PFCA 2P5WD 4X6BA 3G5XA 4IOFD 3C8HA 5MI0C 3D3VE 5F7UA 3MRHB 3HZMB 2KQMA 4ZS7L 1IBGL 4MA3A 4Q6YA 3GMOB 2PTTB 3QUKA 4K94H 3ARGA 1U6AH 3MV11 1IGYA 5I1KL 3STBA 3V4UH 3BDBA 3GMQB 4GKSB 5IVNA 4Z7WA 4QCIB 2Y06L 5CJQL 1RZFL 2EXYC 2P5ED 3A67H 4PRBB 1INQA 1PYWB 4K7PL 5DFWH 3DJ9A 5HVHC 4W6XB 1V7NL 1WEJL 4GQPH 5GRVL 3TIDB 3KLAA 5JXED 3IFOA 3WFCH 1HSAA 1UH2A 2J88L 2D0GA 3BPOC 1BREA 1DQML 3EYUH 5TPWL 3MV9B 1H3UA 3CFBA 1BBJB 4JE4B 4KC3B 3G6AA 2FWOB 1BZ9B 1FCGA 5CEZD 4FQCL 3DUUB 3TO4C 3VGHA 5I1HH 1I3UA 1JNJA 1K4CA 1CDJA 1Q0XH 2GJ6D 1J05A 5FYJE 4LKXA 5DJAA 2DQJH 15C8L 4Q0XL 2BNRE 1WFNA 4YHYB 1EXUB 4CMHB 5E4EB 3OKOA 2EDQA 4YHZL 4NHUA 3VFSB 1SVCP 1DQJA 2FLBT 3QO0B 4S1DC 1DSFL 5SWQA 2OJEA 4LVNB 4QXTB 4RGNC 4HUKB 3OKNA 1UM6L 4FQPA 4XX1G 4XI5C 2E27H 3QUXA 2KQNA 4JFOA 1RZFH 1N8ZA 4Y0GA 1HNGA 1MWAB 3HZKB 3U9UB 1NLBH 2AJYL 1CICB 3SGKA 4ZUVB 4F7PA 1S5IL 3L3DA 3SY0A 3GMRB 5C6PB 1W72B 1TQBB 4ZOEA 1ZLWH 3BFOA 4D0BA 3PXHA 3WYRA 3PGDA 2QQLH 1JN6B 2VH5H 4MB3A 4I9WE 3RL2A 4OB5H 3D5OF 3S5LA 3B8SA 4XCNA 4K71B 5IMMA 1T89A 4I0PD 3LEXA 3QG7H 2C3HA 5HHOE 1AQDB 3E8UL 4YHOH 1KB5H 1QPPA 3WO4C 3QEQE 1EGJA 4CUCA 5FA4A 5HD8C 2ADFL 1DLFL 4Y2DA 3RPKA 3HZYA 1V3MA 4U7MA 3UBXG 1QSEA 3DIFA 1VFBB 1B2WH 1G7PA 1G9NL 1F6AB 4KTYA 2APXA 2IFGA 3UTTB 5IW3A 3LVEA 3K7UA 4WNQA 1DFBH 5ANME 1LVEA 1F02I 5K59F 4U7KA 4KPHH 4LSSL 3IKCA 4B53A 1IAIL 4Z7WE 1T7VA 1K6QL 3BGFB 4JO4L 2FLRT 4JZJC 4MD5B 3B9VA 4HIHB 3FQWA 5DHYA 1AE6H 2KPNA 4HKXB 4URTB 3AU1B 1NSNH 3RNKA 4TNWK 2YA2A 4LCCB 1CE1H 4NO5A 5J3HC 1WFUA 2DYPD 3GKZA 1JYVA 1KCUH 4H8WC 5GJTL 4N1HB 2BXZA 1WZKA 3CVHB 1GZPB 4ORGB 2PUQT 5GIRB 2K7PA 4F7TA 3MOAL 2H9GB 4DCQA 4WFHE 1BBDL 2C1PB 3QWRA 3X14A 5BS0D 2D9CA 3ABZA 4EDWL 1MQKH 3WIHL 1G7QA 1EEZB 1G0DA 4DJMA 4FQXB 4E41E 4YR6B 1HHGA 3TBSA 3ZE1E 1FL6A 5I19H 2BVPB 5ACMA 4WHTA 5IK3A 3BKJL 1SEQH 3MNWA 5BV7H 1UB5A 1BJ1J 1JZ2A 2X1XR 2AEWA 5D7IA 4RDQF 5CZXC 5D7JD 2PTUA 1SMAA 1WTLA 4H5SB 4LOUD 2DLEA 4G9DA 5ISZD 1FNHA 3E6HB 3T8XB 3LS4H 3TN0C 4PLOB 5JZ7C 3U9PH 4L3EA 2W60A 1TZGL 3STZB 1JZ3A 4RRPG 3QI9D 5DEFA 2BFVH 3KG5A 2LE9A 4F9PA 1EGJH 1K85A 1X9QA 4D0CA 3D0VB 3D0LB 2QQLL 2VH5L 3RFZC 1K8DB 1WK0A 2F19L 3BD4A 3C5JA 2FGWH 3ZTJH 2EDYA 1NUFA 1A3RL 4LIQL 3GBMH 1MFDL 4F8TA 1GHFL 4EXPX 1CDGA 1Y6NR 4LLAA 3LRSB 4AK1A 4F7CA 2Z35B 2E7LC 2IADA 3PWUA 3KWWA 3HC0A 5JLZB 3C09B 3F62A 1NEUA 3UTOA 1DBJL 3FAXA 3OGCA 4WFED 3FO0H 4OLWH 5DI8A 4DEPC 3UDWA 3CLFH 3KHQA 4OZHE 5H2BA 3ZE1F 5LKNA 4FMFA 3EDFA 4JPVL 4TULL 4KFZC 1TVBA 3T09A 4QRUB 3AB0C 1OGAA 1DQDH 4UOW1 1IT9H 4YHZH 4M9OA 3N9GH 4N8VA 5HY9A 5CEYA 3VFTA 2C7UA 3CK0H 5FGCE 4UIKL 5E99L 3SDXF 3X12A 3UC0H 5K9OA 4AEHL 3NH7H 2GITB 1I8IA 3U30C 4I0KA 3DPBA 4PYHA 4E9LA 3CAFA 4UB0H 3FOLA 1NC4D 1JFQH 3SCMC 4P9ML 2YD3A 4OFYD 3G6JB 4WI7A 3VFOA 3OXSB 4CU6A 5EORH 1CD0A 4G8EB 1EGJL 4JHBA 5GISH 2W9EH 2Z31A 4I3SL 3HLAB 2OQJB 3OR7B 1KLGB 5ID1B 1Q94A 2XA8H 1QRNB 3D48R 5JIIA 1TFHA 1EVTC 2HFFA 5F3HA 1IGFL 4LPWA 3BW9B 3P0YH 1U2HA 1HZHL 1T04A 5EWIL 5IMOB 3RVXD 1VACB 3E8UH 3QDMA 1N3NB 5DHVA 1F4YL 1JCKA 3TVMB 2VLRB 2XN9D 4MJ6B 2HT4C 3BT2H 5IJKC 2Y36L 4U1JA 1U3JA 4ZFOB 6CGTA 1RURL 1AC6A 3VD7A 5DC4B 2HWZH 3D2UA 3UTTD 3B5TA 4MXQD 5CBEA 4PJIE 3LN5A 3HE6C 1KN2L 1ZKAA 3QULB 2AK4E 3LV3B 1FYHB 2VLKD 2GTWB 5HI3D 3S4SB 1NDGB 4D3CL 1WITA 4NM8L 3ZKMC 4PUBL 1RZ8B 4X98B 3RBSA 2A83A 4KJWC 1BQLH 43C9B 4RSVA 3S3JA 4XNXH 5DD6A 1QFUL 4WDIA 4OCYH 4LHUG 1RUQL 1FLRL 4LEOB 2NX5A 1F6FB 4X9IA 3LKNA 1NGYB 5AD0A 4BSJA 1AGEA 3ORJA 4C58B 3UBXB 5EC2B 1ULVA 3CVIL 1A8JH 3ARDA 4CADA 4OV5A 2B5IB 4LCYA 5F1IB 2NZIA 3ULUF 3CXHK 5CGTA 3MOAH 4OD2B 1MCFA 2CUHA 4M6OL 1CQYA 5TQ2L 3DRQB 3RY5A 2ZUVA 4M1GH 1J18A 2NY2C 2J8UE 3NZHL 3TT3L 4LLYA 1CU4L 3VXSE 5T1MA 5AUMA 4JZJA 3ZT5A 1JZ8A 2UZIL 4JRXA 3MOQA 1XMWA 4JM2D 2J8HA 1RAMA 4NCC1 1XF3B 3OJ2C 3MLYL 3QR2A 5IFAH 1GPOH 1HEZB 4HUXB 5IJVB 4OZ4A 5FGSA 1YMMA 2Z31C 2ZCLL 1T1YA 3B9AA 3TN0D 4CVXB 2AEPH 3ULVF 1NCBH 1JTOA 1X5AA 3W2DH 1MAKA 4KKLC 3MV8A 3I02A 1YEDB 4ZAKD 3O41B 4RMUA 5D4QA 1FIGL 1EK3A 3LEVL 3JV5A 5L9DL 5L8LB 1HSBB 5TFSL 2AJSH 4MGXA 4OZFB 3RIAF 5EOCH 4KRMB 4AEIH 5D2NB 1XIWB 1P5VA 1DANU 3FT2B 5C0NC 4LSTH 4LP4A 3MRCA 1JP5A 4P3DA 3FTGA 3NA9L 3RWDA 3WSQH 4GO6B 1I9IH 1GGBH 3PV6B 2GJZA 1UWXH 1JWSB 2ED7A 1R5WA 3DMMA 5I74C 5CGMA 4BH7B 2BVOB 2JELL 4Z8FL 1QLFA 2RIKA 1BVKA 5FO7B 5IV2B 3QJFA 3CVHL 3G5VB 2HT2D 5DJYB 3VU2A 3SKOA 5D7SL 3W0WA 5EOTB 4N0UB 3KYOA 3BI9X 3JWOL 1BLNB 1KTDA 3ULVL 5J1TC 2UYLA 4PJGA 1CDUA 5F7MC 5IW6B 4JN1L 2FR4B 4XB8A 5CD3A 2R29L 3FB8B 1DLHB 4P5KA 5DEGA 3HUJE 4NNYA 4F7MB 1WQVT 4HUUA 2VDOH 2F5AH 1UXWA 4TYUA 1J8HD 4YHIB 3WLBB 1QBML 2DQHH 5DMJB 1DQTA 5DVKA 1CGVA 4ISVB 5FGCB 1WIUA 3MGTB 5C6WH 1RJCA 4H88H 2EYRB 3DUSB 3VDAA 1QVOA 3F7VA 3MSPA 5I2IB 4EI6B 4D9RD 5E6IC 4JR9H 5DC0A 1I1AB 1CLZH 2Z91A 3QIBB 3T0EC 1LILA 1F4WH 5K33A 3VXTA 1FZMA 1YNTA 5HGGS 1DLFH 4Z7VB 4X4YB 1FYTD 4HIEB 3J7HA 2VR4A 1JZ4A 1B4RA 5GGTH 3ARYA 3BH9B 3ESVF 1T20A 1A6WL 4P4KA 5EBMB 2WBJB 5D6CA 1J8HA 1T0MA 4K9EL 5JNYA 3NFPA 4XP4L 2A6JB 1BD2E 1HE7A 5CJ8A 5CUSH 3Q3GA 12E8H 3L1OH 3FO1A 5T3ZL 4NQXB 5I2IA 3H9HA 3LEVH 3VXRD 3M1BB 4LCCC 1IGMH 2DQDL 1QBLL 4YNYA 3LCYA 5BV7C 1VERA 3P4OA 1KUMA 5MHSE 1AXIB 2ZUXA 1KCVH 3MCKB 2HLFD 4LHJB 3UZEA 2WP3O 3HZVA 3FN3A 3SDCA 1XGRA 4PREA 4HKZA 3V52H 1OM3H 3PP3H 4NNYB 3VFWB 3PHQA 5FM5M 3P0YL 3F65A 4PG2A 4A6YB 1OAYL 2VDNH 5M7QA 5HHOA 5IROA 1TNMA 4OFKA 1QFWH 1NMAL 3VRIA 4AQ1B 3PQYB 3DROA 4NNPL 1R24A 2XZCH 5EU4A 1NCDH 2HTLC 4C83A 3QCTH 3NZHH 5JPMA 3MRPA 3B83A 3GM8A 1T66D 4F57L 5F7EL 2X4RA 5TDNB 4CU7A 4WCYH 4HIXH 3K46A 5GRXG 2NYYD 4JFFA 2JJSC 3REWB 1MI5E 4P3CL 2FIRT 5JORA 3JTSA 1NQBA 3H9YA 2CDGB 1BVKB 5FO7A 1U6AL 3IFNL 4ESKA 1TQCB 1UWGL 2CQVA 1A6ZA 1IKNA 2QQNH 5GRZA 3KXFA 1F42A 5DDHB 2D7TL 2XKNA 4KXZH 1RY7B 3HRZB 3PV6A 5EFIB 5I1CL 3KXFB 1U8HA 3O3AB 2P8PA 3VFGH 3FT3A 3MRCB 2HMIC 3NABL 5DK0A 5ETUB 2LVEA 2QSVA 2VLJD 2BMKA 2X4TB 2Q20A 3BKCL 2H6PB 4P3WA 4OM1H 2V5MA 3QWOB 3LPGA 4LHUA 3ZYJA 1FZKA 4HX1B 5IB1B 3QDME 3WNOA 2X5PA 2GI7A 3ULSB 4OCLC 4XP9L 1CD8A 4PRDB 1R6VA 3OB0H 3C60B 2QR0B 2Z0BA 1U8PA 2HT4D 1BJMA 4OFPA 1EHLH 1JPST 1GC1C 2P49B 1JHKL 3VMPA 3SDAB 5E24E 3IU3B 2FEEI 1CFTB 3ZHDA 1AD0B 3QISA 4P3CH 2IBGA 3TBWA 4ZNCD 2WUBL 3GSWB 1MRFH 1T2JA 3U4EA 1OSZB 1AGFB 1ZVHA 3Q5OA 5MEOB 4M8VA 4WGVB 3TWCL 3BZEB 1XEDA 4KK8D 2RGSA 4LLYB 2BY2A 1JHLL 1NGPL 1NFKA 5EPMB 3QXAA 3BHBB 5D1ZB 3WDJA 4X6DF 2ESVE 1MCPL 1XIWD 3DSNA 3BYTA 2A6JA 4YHKH 3WE6A 2LAGB 1ADQA 4LRIC 5LWYH 4ZUWB 5SWSE 3VXMB 4U6VH 4JDZB 1BEYH 3K4AA 3STLB 5HPMB 2FHBA 3WV0A 1EEYB 1A5FH 3NIFF 1XGPA 1FZMB 1TITA 4RISH 2CDFA 3VD3A 2YHGA 1FORH 1AHWC 2B0SH 2F74A 1QEWA 3EZ8A 2Z93B 1S9YA 3PWJA 1NH6A 3HUJB 3AM8A 4WI3A 4FFWD 3KHOA 1ZSDB 3OHXA 3ZYZA 1FRGH 4NO0D 2ZUQC 3VXUB 4PJBA 3HTLX 4WJ5A 5ALBH 4YC2B 2ZPKH 1GGIH 4HUNB 3HMWL 4NSKB 3Q6FB 4ZAKC 3HE7A 3NGBC 5DEGB 1JPSL 3VE0B 3VI4E 1HOCB 4Y1AE 1ZWIB 1CG9A 3RDTB 2IAND 3TCXA 3VGBA 1QKZH 5HDBE 1WFOA 2FR4A 3QJHA 3HAEB 4KK5D 4QHKI 2W0LA 3TZVC 5DHVB 1N3NA 1MCJA 3FONB 1FLRH 4WJ5B 5FV2A 2BK8A 4X5XB 3EO0A 5D1QD 1MIEH 2BSSA 1NSNL 5CBAA 3RWIB 4H25A 5J6GB 4KI5E 3IJYA 1FFOB 5JOFB 2AQ3A 2XWJB 3OR7A 3CGTA 3ARUA 4RRPA 2Z93A 4BFGA 3V52L 2COQA 4XXCC 4P4KD 1R3LB 2IALA 5EC1A 2R56L 3RWEA 1OGAD 3P2TA 4J3VA 4G7YH 1O7SA 1BD2B 5DO2D 3CLEH 1JPTH 1MREL 1KGCD 2GITA 2CLRA 3OL2A 5D2NA 1RUKL 1MLBB 4NQUA 1GJIA 3RWGA 4CW1B 5HVWA 3PP4H 5DRWA 2XTJC 1H8OA 4RBPH 2VN7A 1W0VA 4LCWA 4JCLA 5JXAL 5F70A 5JDJA 3UAJD 3EKCA 4XPFL 1MWAL 3BZEA 2Y72A 3LEYH 1JNHA 4ODXA 4O00A 1OSZA 1ACYL 5HI5C 2GT9B 2R1WB 4XMPH 3W9DB 5E2VH 5DD0H 3OGCB 2E9BA 1UCBH 5BS0B 1CZ8H 4KZDH 5D2NC 1YYLL 3SDAA 1HEZA 3UBXI 4JFXB 1C5BH 6FABH 3O3DA 4YHPB 3HNSH 1VB9A 3QEHA 2XI9A 4FQXD 4Y4KD 3VGGA 3KLHC 3O6ML 3O11A 3OAUL 2L7JA 4PJIA 3CZJA 4K3DH 3N1MC 4NIKB 4YQXL 3MZTA 1VHPA 3C60D 2EZ0D 4JREB 2VSDA 1YC8A 3U0PA 2OBGA 3WFHB 4YLQT 3F6IA 2HG5A 3GSXB 1MVUA 1JBJA 3SKNA 2QHRL 1XF5A 3T3ME 2VJXA 3T0ED 1CGXA 1REIA 2CIIB 4P5TC 4UINH 4CADB 3BJ91 5ANMB 5EOQL 3UYOD 4LSVH 1JGLL 1I8MB 3UBXA 1WBZA 3CIQA 4NDMA 4F9LC 1MRCH 3MUGA 1IM3B 2UZIH 4RMWA 5D7IB 1Z5LA 2VR9A 3O45A 1JNNL 3ARDD 3MCLL 2FO4B 2FZ3B 5D1ZD 4YUEH 4N5EC 4FXKB 4F2MA 5D2LA 1W0WB 3E1F1 2NY2B 4RGMC 3MV8E 4ZFGL 2A9NL 3T2OA 3V6FB 4EN3B 3O9WA 4PJ5E 3TJEL 5K93A 3OAYH 2HT3C 4U0RC 1CBVH 5DD6B 3V79C 4LIQE 2FJHB 1OAUL 3ILQC 2B5IC 1L6XA 3QQ4A 4C4KT 3WL9A 3Q6GL 4AIZB 3PNWB 1HHHB 3KYKL 4CNIA 4G6MH 4LPVA 1UACL 2NY6B 4PJEE 2IPKA 2W1NA 1T6VN 1TTGA 2DWEB 4PJ7A 4CN1A 4JO1H 3HI6L 3GHBL 2HTLD 1PKOA 4NQCD 1CXEA 2EICA 1AHWA 4OLYH 2JCCE 4HIHA 2HRPL 1WIPA 5EZJA 3TYFA 3PWPA 1KCKA 4G3YH 1K4DA 4PB9L 2VLRA 5FEBA 5FIEA 4FQLL 4Z0BH 5DMYA 3VGEA 3CSGA 2OJZL 1EH9A 4NQVB 1JF6A 2OP4L 3FAWA 3DGGB 5D5MB 1RUKH 3N85H 2MCG1 3GBLA 3RDTD 2NYYC 3PGCB 3L3KA 1YEEH 5GRUH 2BOBB 5I1LA 3ULVD 4J3UA 1PEZA 2HMID 5IFAL 3NFPB 3REVB 1YPZF 4Z7OF 5DLMH 1YQVL 2WBJA 1UGNA 3L5IA 4K2UL 2DAVA 1QD0A 4KU1A 4R4BA 5FYKU 4HXBL 2P43B 4O9HL 2YRZA 4PG2C 3T04D 3X12B 1A7PH 4OBRA 4NQDA 4O5LL 3TC9A 3QPQD 1IKFL 3L7FB 5F9WC 4LLMA 4BFEA 3DUSA 5GS0L 1QQDB 4XRCA 1W72A 1A02N 1NCTA 3HFML 3SQOL 4BFIA 4IIQA 4LARL 1FBIH 5JW3L 1TLKA 2CPCA 3LN9A 1MWAA 4NKQB 4FTVA 5FYLH 3Q1SL 3QUXB 4HUUB 4EN3C 1J88A 2JF1A 1OPGL 4S0SD 4F7CB 4MJIA 5B21A 4DK6A 5EOCJ 3CPLB 1DJSA 1G7LB 4WW1A 4ZUUA 3ZYOA 1YC7A 1B3JA 2MCPH 3MZGB 1I9RL 1FP5A 5BRZB 1PQZB 1EXUA 3P77B 4LFHD 3K8MA 3PGFL 5EU7C 3PIQA 5I1KH 3LHPL 4ELMB 4OSUH 1X5GA 5FDWB 1AQKH 3BDYH 3OWEA 3W0WB 1I7RB 2DQUL 3MLSL 4PJ5A 3PABA 2FECI 5F89B 2JB6A 5IBLC 1NL0L 4LAJH 2BNRA 5IBTL 4X4MA 1GGTA 4FMKA 4EI5A 2W07A 3NIDE 4IJ3B 4PRNA 4RFNC 4WO4C 3FCTB 4YWGL 5ID0B 5CD5D 1IGFH 5IROC 4P3DB 1FFRA 3F58L 4FNLH 4V1DA 3OX8A 3ARTA 5IMLB 1KBGH 3TN0B 5IESL 3S9DB 2X4OB 4OLEA 1INQB 1HHJA 1N0LA 3IDXH 3BAEL 1F4WL 5DUPH 5CCKH 1A7OH 1U3HB 2K7QA 2R0ZL 3W11C 1J0JA 2GFBB 1KACB 3FB5B 4YPGA 4AL8L 4XTRC 4OI8A 2UWEE 4OZIF 1JMXA 3ARRA 2DLGA 3BKJH 1EHNA 2ZSWA 5D7SH 3O6LL 5I1AB 1MJJA 3QIWC 3I3BA 4YIQB 2CK0H 4FN0A 2XYCA 3WEXA 4AIXA 3R0NA 3MMEA 3UYRL 4OZHB 5C0EB 2AXJA 3IETA 4U1HA 5DJDB 1L9NA 4E41B 2NY6D 1AR1D 1I1RA 2R29H 3O8XA 2HLAB 2KBGA 5GJSH 5T3ZD 4PJ8C 4LDEB 4PRHA 1K5NB 3DX8A 3NIDF 4N8CL 1F4XL 4I0PB 4UUJA 1G7JB 3VI4F 1D5BB 3K1DA 4U1LA 5KW9H 1YN6A 4OD2A 3QG6B 3P11L 3PDOA 3T3PF 1N2RA 4PV8A 2NY5C 2LTQC 1O7VA 1P2CA 2D31A 2A73A 2JK5B 3T0BA 3H9SA 5JW4Q 2ZSWB 4XP9H 4Y2DD 5EC2A 2W9DL 3H7BA 2NY2D 1C08B 3EHBC 4LU5H 4YK4C 4LVOC 4N5UA 2QKIB 3PJSA 3RWJB 1PAMA 3O6FA 3NGBB 1TMCB 2ID5A 3K8LA 4PLJC 1OVZA 3KYMA 4J3SA 2YPVL 3PGDB 3T0WA 1AIFA 1QBBA 2QSCH 2EH7L 1OP3K 3VXUE 2ZUQB 3CX5J 1NANH 1RZKH 1RFDL 3CXDL 4RZCB 3WD5L 1S7WB 3ULUC 4XCCH 4NJAL 3IF1A 5IGXH 1MJ7H 4K94C 4EIZC 1DZBA 5FHAH 1A1MA 1TZHA 4L29B 4PFEA 5I71B 1RUPH 1F3JB 3ZDXE 3PABB 1JPGB 1DBKH 3OZ9H 2YA0A 4Q7DA 1QHPA 3NACH 4MJ4A 1NAMA 5F44A 2WIIB 4HUVA 5DVMA 1X5KA 1I7TB 4OTXL 3IAQA 3QEUB 1CR9H 1G6RA 1CICC 1AFVH 1BZQK 3P4NB 4NWTH 2JJTC 3FB7B 1G7LA 5C9JB 2CH8A 5D1ZC 1Q94B 2E9IA 2GW5A 4N0UE 3MLPA 3JSSA 1OAKH 4RNRA 1B9ZA 3RVTD 3MLUL 3MV9A 3EFFA 5DUBA 2BNQB 2NY4B 5D70L 1HSAB 1NBQA 3N85L 3VFPA 4RMTA 5J9PB 1IILE 1QQDA 4XRCB 4HT1H 4UIMA 1I3RA 4UTBH 1XGUB 4BQ6A 3HG1A 4XVJL 4QRPD 2AEQL 4OSUL 1SQ2N 4HULB 4OFIA 3QIUD 5DJXB 4K7PX 2JLLA 4UI2A 3F7PC 4I4WA 5B8CB 1WV7T 1UZ6E 2ICEA 4JQVA 3ZKNC 4QRUA 1A7PL 1SVZA 1TVBB 1WCBA 3QDGA 4U0QB 2QQQA 4L8BA 4WO4D 5K9JH 2CXKA 1T5XA 4QHNB 2LQRA 3NPSB 3WFCL 2VL5B 3WNKA 1XFPA 1KJ2H 3WDIA 2NY0D 3REVA 1DUZB 3W39A 5JUEH 2JJTA 1NGWB 1MPAL 1IMHC 5EO9A 2IAMB 1OTSC 1IM9D 2VAAA 1GC1H 2QQKH 1KB9K 2ITCA 3FB7A 3WIHH 1WZ1H 3C5JB 4OLVH 3KXFD 3TJHC 2BVEA 3K0WA 3MRRB 4GMSL 1Y6MR 2R23A 3CDFA 4RFOH 5I74B 4K3HA 1YEHH 3L3JB 5GS2D 2IMMA 4GH7B 3ARZA 3N9GL 1K3IA 1RK0A 3KR3L 3HMXL 3QUXC 5JIKA 4JVWA 4QYOA 4ODHL 1RJLA 1ETZB 2WP3T 1V5JA 5MHSD 3O4LB 2OL3B 4JHAL 1B0WA 3N50A 3SDCC 1X7QB 3FN0H 4JZOB 5I73B 3WL9B 4YR6A 5J56B 4JGUA 4J23A 2FJHA 4H0HB 2EC9T 3L3IB 1KTRL 1CDBA 3D39E 4WU5A 4E42A 5DVLA 1NGZA 1MFDH 5I6XB 2QSTA 1IE5A 1KEMH 3OF6A 2PYEB 1KCRH 5IWLC 5GJTH 2BY0A 2YRLA 1HYSD 3CVHA 1DVFC 1LO0H 1MCNA 2QKIA 4HEPG 3MJ9L 3FO9A 5IG7B 5C09D 5GS3A 1C12B 3NA9H 2Z4QB 1MAJA 2C4XA 2EC8A 3H9SB 1ONQA 5C0CB 2I9TA 5H94B 3FKUS 4KDTA 1KEGL 1J11A 4PV9A 2ZUTA 1R3JB 3QG6A 3SKMB 5E08L 2OR9L 1A0QH 1YEKH 2MPAH 3IKCB 4GRMA 5F7DB 1RZKC 1XGTB 4GXUM 2UUDH 1JGUL 3V6BR 2EDFA 4M7LT 1OT1A 3O11B 4Z7UF 4JLRB 5DXWA 2V5YA 4OQTL 2VXUL 5F7NC 5B39B 1FVEB 4HLZH 4NO2A 1TJGH 5JW5A 3ARXA 4JO2H 3BZFA 1EJOH 3E6FA 3WEXB 5J89A 1OP5H 3C5ZD 3D85A 2GT9A 2R1WA 4ZYKA 2CUMA 2P5EE 1U42A 4KI5C 4XT1C 3LDBC 1AGCA 4P9HH 2HVKB 1AQDA 3CD4A 25C8L 4WUKL 3D69B 4RCAA 5FB8B 2ZUUA 4PRID 1U8OA 3Q0HA 1LGVA 4U0RB 4KTDH 5DRNB 1AGDB 4WO4A 1OAXL 3I3EA 4JY5L 1JN6A 1IFHH 4UNTA 1MCLA 2CLRB 2H2SC 3FQNB 5EULV 1D9KB 4D0BB 1A4JB 1I1FA 3V0WL 2EXYD 2JIXB 5GGUB 4DVRL 1IAKA 3BGAA 3M45A 4LSRH 4ODUA 1ZHNA 3AS0A 3BH8A 3CUPA 2ATKB 2HYMA 5DZOA 2VN4A 2BDNH 5E2TH 4R0LB 3SGEH 2Y1VA 5IMKB 1GXEA 4P59L 5CBAB 5FK9B 2BSSB 4GFTB 1A7NH 1CL7H 3ZKSD 5FDWA 3FRUA 2KKQA 2UWEF 3B9KD 4PR5B 3SDXA 4GQ9H 4XMLL 5J3HD 5GGTA 4GAGL 3F12A 5ESAA 1NEZA 3THMH 2FBJH 5KVEH 1PD6A 4XWGH 3WXWH 5HPOA 1GHFH 3RDTA 3BUTA 4IS6B 3SJVB 2Q86B 5IB5B 4PGZA 5CZVL 1ZAGA 2OL3L 3MACH 3ZT6A 1HINH 5IFJB 1A9EB 4PJCF 4JQXA 4ZFZA 2V9QA 5JW5B 3IDMB 4NNPH 4MS8D 4KVCH 4O2FA 1OWRM 4B41A 3VD9A 1KTLA 3IXAB 2BSRB 1UEYA 4PJHA 4H0IA 1X6NA 3FZUC 5ALBL 3P0VH 3MRDA 4DVBA 3HUJA 1KG0B 1NLDH 3KPSD 5EN2A 1QEWB 4OGXH 4J6RL 4HS6A 4X7TB 5F7DA 3CZFB 4OZGE 4NQDB 3C09C 2VDRL 4M3KB 4JQXC 2BHYA 4V2BA 1P4LB 4JGMA 1CDYA 1KJVA 2VDPH 4NN5C 1JIBA 5J1SC 32C2B 5DEZA 2VXUH 1E6OH 4XNMB 1UM5H 2Y7QA 2ADJB 1NFDB 3KPMB 4HS8L 4XPHL 2G5RA 4B7IA 1X44A 4I2XA 5D7IF 4LVHC 2DB8A 5TE7L 3VI3F 3K2UH 4KK9C 1PG7W 4XZUB 4J3OC 4M4RA 3BEWA 1LO3H 4HG4J 5D1ZA 5F6HI 3HI6H 5EU5B 2J88H 1Z6JT 5IW1A 4U1GC 1KJ2L 3TESA 1FSKC 4OKVA 2J8UA 2Q7YB 3UTPD 4Z7UB 1YN7B 3RPIB 5ADPL 5INCB 3MLTA 1QFWI 4HPYH 3WXVL 1OTUC 3VG9B 4G5ZL 1OAQH 3F6LA 2OTPA 3HE6A 1ETZA 2M2DA 2DJUA 1BD2D 2EDOA 4EQ2A 4D9RE 4AH2A 5HYSA 4ZS7H 2YSSA 1G9NH 5LJYH 4ZPTB 1B0GA 1RZJC 4HX1A 2GJ6E 2YD8A 2IPKB 4QEGA 2GAZA 3BN9D 5C0AD 2X6MA 1RZIA 1SY6L 2DICA 2OS7A 3QWOA 1RFDH 4O02L 4OFVA 1FYTE 4Z95H 3BO8B 4JANB 1U2CA 4HJGA 2X4TA 3H42L 5DQDH 2OR7A 3ZO0A 5L2KB 3SPVA 4K7PH 3BPCB 1JYWA 3O3AA 1SBSH 3V6FA 5EO9B 4Y4KC 2R2BA 4UDTA 2GY5A 2R0LH 3H9SD 4P49A 4ZMAT 3O45B 3PWVB 5DD1H 1C16B 4JFQA 5JMOC 4P9HC 5SX4I 4WRLA 2CRYA 5EO0B 5KZCB 5BZDA 2CDGA 1OP3H 3HFMH 2ZCKH 1XR9A 3SJVE 3UTQA 5GZNC 5CIPB 5IHUL 3G04A 2V5RA 3RWCA 4DZBA 5DTFB 1IGIL 1U8LA 4X83A 5BO1L 1FHGA 1KCSH 3QUYA 5CCKL 3QI9A 4Z0XB 1R24B 3GSNA 4L9LA 5EOQH 5GGTL 3LKOB 4TOYL 1QA9A 5D1XA 4ZOCA 4LGPB 3UTSB 4X9BA 5CLWA 1CXLA 5DMIL 4ZUTB 2X2YA 2GTZA 1GOHA 3GJFA 3JWDH 5HHME 1Y0LA 3AS3A 3RVUC 4F33A 2HA1A 1JNHB 3OB0K 1DVFD 4XBPB 4GAGH 4M7LL 2DQDH 4EDXA 4RDQG 5E8PA 1I3VA 1YNLL 3HC3L 5C6TL 2P8MA 1I7TA 2WQ8A 1KPVB 4NKIH 1IGCH 2W38A 1JV5B 2J4WL 4MXWL 1X3DA 2WIIA 3VH8G 1IGJA 2JIXD 4BZ2H 2BHUA 3BXNA 5F3BB 3MROA 4GS7B 4OLYL 5IR1A 5C1MB 1S9XB 3OGOE 1HI6A 4YHLH 1RSFA 4Y16B 1E0OB 3BWAB 2R1XB 1HKLL 3L9RA 2X7LB 2Q87A 3UO1L 5I17A 3RWEB 5FYLD 5MEQA 1N0XL 3KPNB 4PJ5D 5JW4N 4WIQA 1R3LA 2B1AL 1CE6A 4M5ZL 1XF2B 3MJ8B 1JPFA 5T3XH 1DEEA 5LXGL 2ICES 4KQ3L 4CBPA 3CK0L 1MH5A 3CSYA 4NFBA 4X6DB 3FRPA 3ROOB 1SJXA 3BVNA 3QBTB 1TETH 2AEPL 3SE8L 1G9MH 1UXWB 1J9CT 4M1CC 2VZUA 4L3CA 2IQ9L 4QRSA 2H45A 5C07D 3MYJB 2CO7B 2Q6WA 4WTWA 1NBZA 4TSCL 4I3RH 3MXVH 3QUZD 1AGBA 5CWSB 4YDIL 3L3HA 3B6SB 3HE7B 5I1IL 1YN6B 4I3SH 2J4WH 4MXWH 4W81A 5FFLA 5FM5O 5IEHA 4NUGL 2OZ4H 1T03H 4IDJH 1KTDB 3BGFC 3SBWA 1S7QB 5HYJE 8FABA 4I77H 3WHE1 2NY1D 3SDDC 4JJ5A 1DUYA 2AGJL 4MX7B 1AKJB 3AVEA 3LPFA 4UQ2B 2YBRB 5ACZA 1YEGH 5A2KH 4PP1D 1Q8MA 1PZUB 1FJ1A 3B9DA 1KFAH 4Q97A 3U6RA 3VG0H 4RX4D 2CMRH 4ODTL 4QHLA 2PF6A 3FB5A 4JM4L 1I1AC 2WUCL 4XVUD 1XCQA 5KANI 3VRLF 1B88A 1NGQL 2AJ3B 3DRTA 1T1WB 2LTQB 3BHBA 2CK2A 1OGTA 3G9VA 1Z3GH 3ZKXB 3B2UD 4M6NH 2WV3A 4I5BA 1RUAH 2DBJA 1DBBL 6FABL 4DUWA 5A3IC 2F19H 3FCTA 3BKCH 3WFEL 1HHKB 5D7LE 3WKMH 4XNUH 1A1OB 2HRPH 5JZ7D 3HC4H 4P2YA 4NWTL 3MXWL 4UU9A 2ZOKB 4JRXB 3ZSSA 3R8QA 4LLVB 3DHMA 3HN3A 1KB5L 4PJ8A 3JUZA 1JYNA 1I7RA 1SHMA 2DQJL 4OKDA 4WUUD 2VWEE 4QO1A 3TT1L 3OV6A 5DYOB 2G60H 1E6JL 2D3VA 5E1HB 3VW3L 1KN2H 3ARWA 5BRZA 5HDOA 4YHYC 1FVDA 4M93C 4N68A 4AIOA 3N1PC 2XN9B 2BY3A 5A16A 4UOJA 1C8PA 2HTKC 1CLYL 3S36H 4NBXB 4POYA 1BQSA 2GQHA 3L7EA 1UKSA 4QRQB 1DDHB 5C2BH 2VKWA 3IDIB 3HRZA 1RQ5A 4FTVB 1BIIA 2EDJA 5EFIA 3N1QC 1W72L 4I3RL 2IQAB 1XGYH 1QUNA 2OCFD 3MUHL 4J3XA 4AY0A 3UPRA 4U1KB 4RFEB 1M05A 1R3IL 3EYOB 5E8DH 3EJJX 43C9A 4KRPB 1Z0NA 5LG1A 5KSVA 3WFDL 5AZEL 2F8VA 5BQ7B 1S3KL 5D1XD 2GSIB 4OB5L 3BGMA 4F80A 4HGMA 5T5NG 3MRPB 4RAUB 2AI0H 5FCUL 3C9NB 1SJEB 3LKQB 3FHAA 5FYLL 3BD5A 3U7WL 3UTSD 1S7SA 2VAJA 3VXOA 3HUJF 5HYJA 5CJOL 3OAZH 4R8WH 1OTUD 2APBA 2NTSP 4PJHF 5DJ8A 1UEMA 3BKMH 3T1FB 3ARGD 1H3XA 3HZVB 2IMNA 4QF1B 1DQDL 2LABA 5FO8A 2MPAL 3VG0L 4I48A 2XWBB 1MQ8A 4J1UA 4RMQA 4DN4L 2UZYB 5E94B 1S8DA 3UYPA 3G08A 1P84K 2PXYA 3O3EA 1MFEL 2P5WA 4R26L 4G9FA 1RHHA 2CRIA 4E5XB 1S8DB 4FABH 2F5BH 3ESUF 4XMKL 3FO1B 5JHDA 1MCIA 2DM2A 2ZG2A 4X9FA 1O0VA 3RJQB 1CT8A 3IDGB 2CLVA 1A6UL 5C8JB 3NAAH 5CILH 3RNQB 3RY6C 1SEBA 4WFHD 4OD1H 1SMOA 4MAYA 1ZGLP 1ACZA 4GW4B 1S7SB 3DV4A 5TPWH 2J1KA 4HIEA 4ZODA 4M00A 4CDHA 2V5TA 2VERN 1L7TL 1CDCA 3INUL 4R7DA 4WW2C 1F4YH 3ARBC 1S9VA 2ARWA 3HCVB 2DTSA 2H32H 3QIBA 4GBXC 2J5LC 3QQ9C 4PB9H 3B2VL 4ZXBB 5DK2A 3IGAA 1MHPL 2V17H 4LQFH 1MHPH 2P24B 1URLA 5E5UB 2ZP0T 2WWKT 4JQIL 3QA3A 3M8OL 4K07A 1E4WH 1XCTA 2B1HH 4LVOB 1Q9KA 4MCZA 4M1DH 1PVHA 5IWLA 1U36A 5K9KB 4WENB 1T3FB 3RHWK 1EUTA 1TVDA 4YAQA 5KTEH 1Q1JL 4EUPG 4Y1AB 1ORSB 2EE3A 4GRWF 2XRAH 3CH1B 2DTMH 1QBAA 2ITDA 4RQQA 4NO0A 3U0PB 5KSBE 1F4XH 1FNSH 3H3KA 3MRGA 3V9FA 4QOKB 1U91B 4PJ8B 3TFKD 2WWKO 4P99A 4OGYL 1WBYA 4DN3L 1PKQB 3LKRA 2X9YA 5AWNL 2X10A 4KKLD 4FQIH 4HDIB 1R5WB 4YBHA 4Y5VA 3TBSB 5JOEA 5IVXB 2P48B 5F9AC 3SHSA 3MBED 5C70A 4LRIA 3T2NL 4OCRH 1N5AB 4DVRH 1LDPH 3PE9A 3RIFK 3VFRB 1TDQA 1U8KB 4WEBL 5HGHA 1MUJA 2VL4A 4JN2B 4XBGB 5CP7B 4N90E 4PJIF 1SJVA 3UC0L 3EUUA 1TZIB 5DFVD 3VFRA 2F54E 1RJZA 3QAZC 1U3YA 1YJDH 3BQUD 4FABL 2YK1H 4I18C 3IDNB 2NNAA 4R26H 3ME0A 1G6RL 4UBDD 5IVXA 4NZUL 4G9FE 3DSFL 3MRIA 2CLVB 5C8JA 4HUXA 5IJVA 5L8JB 2C1OB 4X7DC 5BVJB 5C0DA 4YZFE 3U1SH 4WUUB 1DUYB 3TBTB 1JL8A 1F2XK 2W0KA 3P11H 1YZZA 3G08B 5I15H 3OB8A 1BFTA 4PJDE 5FCUH 4CJ1A 4FP8H 5IBUG 3WIFA 3GKWL 4PLKC 1UJ3B 3RIFF 1RJYB 3IDXL 2K1MA 1ZANL 4OLXH 3VXRA 4KAQL 4L4TB 4XVUC 5HYJB 2OR9H 2XICA 4KUCF 1NBZB 4LLDB 4EJ1C 3ZDYE 5GHWL 2VKXA 3SE4A 4Q9BA 4LF3B 2OX5A 2ESVA 3V5HA 4XPTH 3VXNA 1UVQB 5JA9A 4JRWA 5GRUL 2CK0L 3RTQA 2AV1A 3T0EE 3HHRB 1L4IA 4P46A 3ZT7A 4HPOH 2NY0C 3W2DL 1JHTA 3IGAB 1E6OL 4F7EB 5AZ2H 1AI1H 3MNVA 1XF2A 4U1NB 3C8DA 2CDFB 4M61B 3UPAA 1FE8L 1S9VB 1FZOB 3BUYA 5FAAA 5DR5H 5FGBA 3LV3A 2X7LA 5I17B 5I18L 4LBEB 4JB9L 4Y5XA 1H5BB 5A3ID 4FTVE 4GRLC 3VXME 1MCOL 4GW4A 1S9XA 5I76B 3QZWG 2PXYC 1IC5H 2YC1B 4TUKL 4U05A 2H2SD 4GRWB 1IEBB 1CT8B 1KPVA 3IDGA 3NCYS 3V8OA 3DXAA 3TH3T 5E8PB 1EHLL 1MFNA 3WNLA 1UZ8B 5KAQG 2B2XL 3ZL4H 1WC7B 2JELH 3ZL4L 4JRYB 5GGSB 4R9HA 1A7RH 4G6AC 3M8OH 3O6LH 1KIQB 1MHEB 5L7XH 4I48B 4EI5D 5FO8B 3RA7L 1A1OA 5M94B 4H20L 4PB0H 4FXLA 1XR8B 4QT5A 4WHYG 4G8EA 4HK3N 3QNYA 3QHFH 3G6JA 1MJ7L 5GGQL 3KLAB 5D96C 1WCQA 1V7MH 4ODWB 2E6PA 4DGIH 2NNAB 3IDNA 3VRJA 2D9QB 2C3WA 4FFVD 3VFMA 4Y8AA 4IOIA 1I85C 3Q6GH 3QI9B 4RAUA 2OM5A 1BX2B 5L9DH 1MF2L 3T65B 5CEYB 2HKFL 2AABH 5T3ZE 3JTTA 5CMAA 1HH9A 3VFVA 1BMGA 1LEKA 2KH2B 5IT2L 4BZYA 5J06A 3HNTH 4QKXB 4JKWA 3HKFA 4MJID 1BQHA 4O2EA 1KCLA 1NAKL 3GRWA 4FS0A 4HPYL 1CGSL 3WXVH 1MEXH 4NP4L 1E4KA 4A2LA 4FQLH 2ICWA 1CYGA 3HC0B 4GG8A 5L2KD 2CKBB 3MBXH 4Y1AD 5GRJH 5HI5D 1UB6A 1GOFA 1WF5A 4W70A 5AYUH 3MV8D 3HS0A 5SV3A 3C08H 4CMHC 4YBLB 4NQDE 4ELKA 1UYWH 3DETC 5EA0L 5JIHA 3BN3B 2ADIA 4JANA 1DEDA 3A6CL 4XAWL 2H8PB 4O02H 3K80A 5HYEA 5I1CH 1NFDE 2ZOLB 4GS7C 1RVFL 5KSAD 3W0WE 3QT2A 3CFJB 1IGML 3S3PA 5I66B 2NW3A 4RWYH 4Y2OA 2YWYA 3GRWH 2WWMD 4MAUH 5MEPA 1P6FA 5DK3A 5KVEL 4HMDA 2AK1L 3BSZH 4PJHE 3OJDB 4K7PY 3BESR 3CCHA 5GGRY 2IG2L 2P24A 4HWNA 1WJ3A 1YY8A 4TUKH 5HVHB 4DKDC 1MH5B 4YNYB 1LHZA 2CSPA 1U8MA 5DJ0A 3HAEG 4ZTPH 2IH3B 3FQTA 2VDQL 1RMFL 4U6HA 5ADOH 3Q3GB 1ZANH 3JXAA 4JQVC 5E95B 4O51A 4LCUB 3EJZC 1BOYA 4OCRL 1BM3H 2JCCF 2FCBA 3U6RB 4U6XA 2WM0A 3I2CH 4BZ1H 4HKXA 5J1AB 1KJVB 2DQCH 3FQWB 3VDBA 2DJSA 3DTXB 4X4YA 2YPLB 3SBWC 2YBRA 3KVQA 1INDL 5F71A 3IJHA 1KENH 1AKJA 3BJLA 4JAMA 4FFYL 1AQKL 5C0AB 3S88L 2DLFL 3VFUA 3MA9L 4QXGL 4PY8J 5DD0L 2HFTA 4IM8A 5D8JH 5KSBB 2WSKA 3FQUB 3Q5TA 4U1IB 2FIKB 4WWKC 4WHYH 3OAZK 2H1PH 3S8WA 1R3IH 1E27B 5MP6L 4XCFH 3LB6C 4MHHI 2DIJA 1DP0A 5D7JC 1Z2KA 3H7LA 3FB6B 1KEML 1NGXA 1QSEB 3T1FA 3RWHB 3WUZA 2VXSL 3B6SA 1OLZA 2UY6A 3U4BH 5I15L 3RDTC 5J13B 1AGBB 3RGHA 3U4BL 4UT6L 5JW3H 4P46C 2VZOA 4IS6A 3SJVA 1BAFH 2Z31D 3ETBF 1YPZE 4Z7OE 3CLEL 1EX0A 1KULA 1IVLA 1X6LA 3QFDB 3S37L 4OI7A 2YZ1A 1NCAH 2BVYA 1NC4A 2G60L 4PR5A 4YXHH 4OV6F 5BQ7A 4QHMA 4PJCA 2QADC 4Y4KA 5TJWK 3EYOA 2X05A 1MCWW 3K4DA 3LH2H 3GMRA 5EO0A 3I85A 1WICA 1AR2A 3T0EB 3SE8H 3U9UA 3R1GH 4PGJA 4MDIA 3GEWB 1G1CA 4DKEH 3ZTNL 5IIEB 3DARA 2ED8A 2UWEA 1NCCL 3GRWL 2V7NA 4EBQL 4NJ9L 3F5WB 3JWDC 4LCWD 4EN3D 1MNUH 2C3VB 5JQHC 1AGDA 4WTZA 4NWUL 3GK8H 3JV4B 2NXZD 4NQTA 2XFXA 4X4XA 4EVNB 1KF9B 1RIUH 1J1XH 3H2WA 1OT2A 1UWEH 2E9JA 5CJBA 2ICCA 4PGBA 5T5NF 4TULH 3H9ZA 1X5LA 4WHDA 3KLHD 2QLVB 3ARFD 3BKML 4LSQH 5ITBH 3LSOB 4KMTL 5INCA 3DETD 4PJXE 4ZFOL 3UTSA 3IS1X 4M4PA 1IL1B 3C60C 4OUUA 4QWWC 5KSUA 2Q7YA 4U1MA 3KNBB 2FJGA 1CIUA 3QDJD 4PP2B 3LMJH 4L9LB 1JVKA 2DN7A 2VDPL 2EH8L 1OGTB 2Z8VC 2VDKL 1T5WA 1ZVSA 2AJ3A 3BRFA 4LPCA 1F90L 3DX9B 2UVEA 5BW7A 2FSEB 1JZ5A 1U8LB 1UCBL 4WY7L 3QCVL 5GGRA 3MRMB 3VJ6A 2FEDC 4HCRA 1A6UH 4N1CA 3THML 4APQD 1QFOA 1QR4A 2CIKA 4GAYB 5HHMD 3WN5A 4XNMA 3VGFA 3FO2A 3V5DB 2YKLH 5EBWB 4Q58C 7FABH 4NKIL 1INEH 1R5VA 1C12A 2YD7A 3MRHA 4NOFA 1DL7L 4AZ8A 3IU4H 3U46B 2XA8L 2HT3D 2NY1C 3SDDD 3T1WA 1L7TH 3DWTA 4UDTB 4OCNC 5FOBB 3VWJA 1FG2A 4JM2B 4I77L 4LU5L 3BPCA 1G7IA 1JK8A 4NZJA 4NKOB 4E42B 5DWUH 5DUPL 4ZOBA 3OSKA 1WT5C 2X4QA 1F3DH 3MJ7A 4LPUA 3S4SA 4AENB 4Y19E 1EUUA 4FG6D 3I9GL 3T3PE 5KJRL 4TOYH 5ISZA 3MCLH 1MELA 1UM4H 5HYSB 1FAKT 4U3XA 4PJGF 4D9LL 5DZLA 4QYOB 1LEGB 1M71B 3C5SA 4GLRI 4U1JB 1VGKA 2Q6WB 2VXQH 1PLGL 4GRLA 4M43H 3GSNL 3G5YB 4XNXL 3WIHA 5D6DC 3MBEA 2D7QA 3RUGA 3BVNB 1XGYL 5DJZB 3W9EA 1T21A 1T04B 3B4NA 5EIQA 5L0QB 4QRTA 1RUAL 3P4MA 4Q9RH 1SYVA 1KLGA 4Z7VF 5CEZL 5KW9L 2XACC 4JKLA 5LQBH 2DQHL 3BEWB 4WV1B 1P4BL 1ZLUK 1A3QA 5MEQB 4JFDD 4YDJA 1IAKB 2VL5A 2ADJA 4G7VH 1HI6B 1C1EL 4HMEA 4X0KB 3AUVA 1XT5A 1I8IB 4J8RA 2RFXB 5IKCA 2YN5A 2WZPD 3V4UL 4I4WB 3UXFA 3QUXD 4KJPC 1U8OB 4F15B 4A6YH 5FYKL 2NW2B 1EZVX 5BXFB 3JWOH 4Z7QE 3IFNH 2SEBB 1FL5A 4BZ1L 1B0RA 4BUHA 1R0AH 5I30L 3SDCD 3G6DH 4GLRH 2AP2A 3C2AH 3BEVB 4WI5A 1VSCA 2VR5A 2JJUA 1FSKB 5SWSB 3U48A 4ODSL 3RY4A 3DV6B 2C5DC 4NRYA 1RZJL 1WZLA 4YX2L 4JFHE 1EVUA 4HXBH 2FL5B 2HT2C 2D0HA 4NO2B 4XHJD 5B39A 1U95A 2AW2A 2GJJA 1FV1A 1N59A 4QY8A 3L5HA 4YWGH 3IJSA 3WFDH 4K7FA 5C0BB 5LGHL 2E8YA 1P4BH 2E7MA 2DI7A 4Z0XA 3F12B 1QACA 1UWEL 1U8JA 5FUOH 3V7MA 4OF5A 3SDXB 3O8XD 3EOTH 1UT9A 3M17B 2VDML 3SOBL 4ZG1A 4L8DA 4D8PB 5B22A 4M7JH 1ZT1B 2E7LA 2AGJH 5C0CA 3QIUC 4GMSH 4GW1B 1F3JA 4G42B 4PJ9A 1I9JH 3IS0X 1MJ8H 5D70H 5D6DA 4JFQB 1UZ6F 3FMGH 5JOPD 1I9RH 4R97C 3WHXA 2A74A 4FQXA 4Z76A 2LU7A 5JHLL 4L1HA 4QTIL 4JM2C 4WW2F 1EEZA 4NM8H 3IRPX 4P48A 3GMMA 2J6EL 1F00I 3VFNA 1TJIH 4HK0A 5FECB 2R69L 3P4MB 1AP2A 1AIFB 2A6DB 3X14B 1QYGL 3KYMB 3RQ3A 2XV6B 3PWNB 1BPVA 5F72S 3I50L 4F7TB 1OAUH 1ZHLB 4ZQKB 2PO6B 1TXKA 5I1EH 3U82B 4PJBE 3VWKD 5D7KD 4OIBA 1AGCB 1BGXH 2UUDK 2VIRB 3WKML 3VGDA 5E9DA 5IT2H 3ARFB 3AU1A 2BNRD 3CVIH 5DMGC 4HZLA 5J7CC 1RK0B 3GIVA 4FQIL 3U2SA 4C57C 1NANI 5ISZB 3EOTL 3JV0A 3EOAA 3NFSL 5JXEC 3MRRA 3RPIA 4UTAH 4OKVB 2VMFA 4DQOL 2FD6H 4U6YA 2DQEL 1A6VH 4LSRL 1ZTXL 1YEEL 3L6FB 1AY1H 3RIAK 3QDGE 4G80A 4N0FB 1VFBA 3IETB 5C0EA 3OF6D 2DQFA 1D6EA 3T2PA 1MCCA 1KB5A 1DUZA 2DQIH 4WW2A 3TH2T 4ONHA 5D7KE 1RZJH 2NR6C 1EPFA 1RVFH 4S1SL 32C2A 2UZXB 4KZDL 5B38B 3QNZB 5ICZB 3TYGL 2FHCA 2VZSA 3UX9B 2UY7A 3ISWA 4EEEA 3EO9L 1E4XI 4WU7A 2ZKHH 1TIUA 5KS9F 1T5WB 4XC1L 5ITFA 3TN0A 5IMLA 4L8CB 5E8EB 3V4VH 5B3JF 1ZT7B 3MJGX 2GIYA 4NRZB 1KTLB 3IXAA 1IL1A 1QFWL 3BIAX 4RMSA 2R15A 5C86A 1TJHH 4HWBH 3O4LA 3T2NH 5I1GL 4KJPD 5F89A 3O0RH 3GSRB 1N7MH 2EYTB 3I84A 1ZE3C 1JNNH 3OKOB 4OZIE 2F15A 5EBGA 4APQC 4HF5H 4PBVC 1CTNA 3QEUA 3NCYP 4XCCL 4BSWB 1P4IH 3D39D 4JHAH 3R06B 1NKOA 3PP3K 4KI5D 5HD8D 4OM0L 3NIGF 4Y5YB 1K4CB 1NJ9A 1PLGH 1F58H 3KDMB 4ZUSB 5IMKA 3T0AA 2VLRD 2EE9A 5MERB 3O4OC 5D7LD 3SE9L 2X70A 3QO1A 4N8CH 4X7CC 4UT9L 3EYFB 3CUPB 5FM4A 2VXTH 1NGWA 4KWUA 3IF1B 5BRZE 2EXWC 2FX8L 4QRPA 1ERNA 4JRXD 1HXMB 5GGUA 3UEZA 5DQJB 3N1GC 4PRAB 4QTHA 2CO6B 5TDPB 2PNDA 1FAIL 3EYQD 4LLMB 2P5EB 5E7BA 2NY0B 1NCWL 3FFDB 4LASH 3L7FA 5DURD 4GSDL 3QRFM 7CGTA 2V2TA 1C5DA 1FCCA 1H15B 5DJXA 3GI9H 4G6FD 3PJSB 2IANB 1UQSB 2HKHL 3GMQA 3FQXA 1IGYB 4HIXL 2JCCB 3ILQD 2ARJB 3LZFH 3H7BB 1MRCL 3LD8C 1A7QH 4UIMB 4R4BB 1KELH 3IVKB 1OW0C 3N0PB 4DEPB 5D1QB 3D85B 1OTSD 4OT1L 3H3PL 4MNQD 3RRQA 1KB5B 3KJ6L 4GAJL 5IVXE 1LE9A 1DFBL 2BOBA 5F7YC 5I1LB 1FVEA 4YEFA 2FH8A 9CGTA 4NFDA 4X8JA 4JLRA 5C0BD 5KVDH 4JEGB 4N9GB 1NCCH 5JW4R 5ICXB 5E6ZA 1S7RA 1U8NA 3NPSC 4U1IA 4YHKL 3VWKC 5LWYL 2WAHA 4NC1C 3CSPA 3O4LD 3OXRA 1BQUA 4LPXA 2E6JA 4R4ND 5C08A 4Z7WF 3I3DA 3DI2B 4E41A 4KTEL 5D2NE 1AXSB 1H3TA 3EOAB 4U1SB 3EOBB 3MBEC 3ALPA 1U9KA 5I8EB 3QB7C 3GM0A 2VOTA 4OGZA 4KJQD 1F45A 2C3XA 4R7NB 3QDAA 3V6OA 5BZWA 1ONQB 2I9TB 3ARFA 2X4UB 2F54B 2ORBL 1NMBL 3WSQL 1OD7A 2AK4D 1MCBA 2XOTA 5D1QC 2J12B 4TUOA 4YPGB 4YBLC 2DWEA 4PJ7B 2P8LA 4GXUN 2ICWJ 2BSED 2NY4C 4Z7VE 4RZCA 4U6HB 1VADB 2O5ZH 2IPTH 2MQ0A 2IH3A 3FQTB 2O5ZL 3CVHH 4HK0B 4PRIB 4PRPE 4OIIH 3UCRA 4WUUE 3KPPA 2XQYK 4Z76B 4ENED 1UM6H 3OG4B 1W0WA 1G7MA 4XP6H 5KOMC 4JZOA 5IUSA 4EI5B 4HPOL 2IH1B 3NCJL 4KKAC 4M43L 2BNRB 4HXAH 5MEPB 1F58L 1WBZB 4NDMB 4GRWE 3L95A 3QEQB 2O5YL 5T1KB 1N2RB 5GGVH 1L7IL 4D8PA 2EIEA 1XF5B 3O4OB 5J8OA 2AJSL 4DWHA 5IOPB 3ZE0E 1MHHB 1KCRL 2ADIB 1NCWH 3SQOH 4POUB 4JY4A 3LKPA 2A2QT 5ICXA 3TCLA 3ZDZF 3QEHB 4OF6A 2Y36H 3LQAC 4P2CG 4MQ7B 4XCEA 4YHPA 1S7XA 4XWOC 1Z9MA 2VQUA 5JTWA 4MAYC 5E08H 3HR6A 5J6HA 2F53B 3U36A 5B38G 3MRJB 3AGVA 2WMPA 3BP4B 1W0YT 3D9AH 5T33H 1K3ZA 4PJEA 5I16A 5TDOA 4NZTL 5EZOH 1DN2A 2AJZA 2EE6A 1D6VH 2NPLX 4NN6C 3RZCD 1RK1B 3LQZA 4HH9B 1HDMA 1EAPB 1S7UB 4QXWA 5HYIA 4JDTL 1EA9C 5DRWB 1C5DB 3TA3B 1EBAA 3P0GB 1JFQL 3HE6D 4FTVD 4CMMB 3TGXA 2ZZUT 2HFEA 4YE4L 1TQBC 1TCRB 4X5WB 4Q9RL 3IAGC 2Z8SA 1FO0L 4QTHB 1BEYL 3W11D 3VFPB 3LQAL 1NUGA 3BZDA 4PRNB 1J87A 2QL1A 1ZLSH 2QSQA 2QBWA 1CDIA 3Q48A 2RQ8A 1I9EA 1KBGL 3QRGL 5IESH 3JV6B 1RMFH 4NT6A 4P4KC 1FFOA 4JPVH 1T2XA 2IBZX 3RJDA 2X4NB 3P4NA 2B4CL 1C5CL 1LNUA 3MTRA 2VLME 5DJCB 3S97C 4Q0XH 2X9WA 3FONA 2FX7L 3NTCL 1CXFA 4KK6C 3RUGB 1MVFA 4YHML 5GZOC 1U3HC 4HUVB 3IDYB 2E7BA 4Z5RB 4X6DE 2EYTA 3C5SB 3W5NA 1M71A 2NXZB 4D0DB 5L88H 2VLMD 1A1MB 1TZHB 5IGXL 3UJTH 4NQDD 4WWKD 2BNQE 1TZGH 1JI2A 4M8QB 2IC2A 4FQ2L 1DCLA 3VXUA 3RKDD 5DURB 1ZT7A 1H0DB 3Q5YA 4GMTH 4KRPC 4AYFA 3SE3A 1LP9B 2OMNA 4ALAH 2XZAL 2AXHA 3C6LD 5H37H 2QHLA 4K23L 4PLJD 1KCVL 5AAMA 1FG2B 4JM2A 4LNRA 2CLZA 2AV7B 4MD0A 3OKEB 3O4LE 1YECL 1FORL 2FO4A 5DHXB 4RAVA 5E00A 4S1QL 2P7TB 4LARH 1Q72H 5H35B 3VD4A 3U46A 1Z5LB 1N64H 4LF3A 4ELMF 3TF7C 4LQ1A 4N90D 2CIIA 3HB3D 4CN4A 4TUJA 1L6ZA 4WWID 3MRLA 1FIEA 3ELAT 1UJ3A 3WO3B 3PWPD 3KGRA 3WFHA 4WI6A 3QUZC 1E4XL 3IT8D 5I9QC 4I0PA 4U6YB 2WWMC 4UT7L 3MV7E 3CXDH 3GFUA 4MQXC 4KMLB 1D6VL 3EDDA 3VH8B 2EXWD 2J6EH 2Y07L 1T1XA 5JXEA 1CIDA 3QUMH 3TBWB 4JHWL 1BJ8A 2DQGH 1P9MC 5EZJB 3TYFB 1NL0H 4ZOAA 2AK1H 4YIQA 3CFEB 2Q7NA 3C60A 5C0CE 1MJJB 5I1AA 1PBYA 3ULSA 4QOKD 1A3RH 2E7CA 3DBXB 2HVJA 4HIJA 2ZJSH 1VFUA 5C7XH 2GFBA 4H1LB 5AWNH 3WUWA 4JFZH 5EUOE 4ZQKA 4WFFE 5GS0C 2FHFA 1I7ZB 1U8KA 3C5ZA 1I9IL 2EDEA 1RHFA 2NY7L 2X4OA 3UO1H 2R0KH 1G0XA 1GZQA 1S5HA 5C0AE 4IOFC 1WGOA 4PYGA 1AJ7L 4X7SH 4N0YH 4UILH 2P8PB 5CD5C 3BPNC 2EECA 5ID0A 4MSWA 4W6YB 5D2LB 3ES6A 3ARBA 4E0RB 3WHXB 4PS4H 4NZTH 1EHXA 3QEQD 4L8SC 5ILTL 4GBXB 1Q9LB 5HJ3A 1QRNE 2WLYA 5ELIA 3TM6A 2PKDA 5ANMA 4PRPA 5EU6B 1U91A 4HEME 2PW1B 1NBYA 1NLBL 4X5XA 3M17A 5IQ7H 1RUQH 4D2NA 3GSXA 3KLDA 1A3LH 4PJXB 5JPMB 1CFNA 2DS4A 4RMRA 1Q38A 4C83B 1F4HA 3RZCA 3RTQD 4XCFL 4PJIB 1J1PH 5DJ6B 4BELD 4MJIB 5F96H 3RHWF 3NCEB 4Y4HB 1LP9E 3EFDH 1FV1B 4L4VA 1SBBA 4NC2B 3AM8C 4JFZL 3RAJL 3Q6FA 3K74B 3RWHA 5F7WC 2OXHA 2XT1B 4MXVF 4RGMB 3IKKA 3GKWH 5IVXF 2I27N 4Y8DC 1Q0XL 3QNXB 5IB3A 3C8KA 1I9JL 3O0RL 4FZEH 5KSBA 2CGRL 1B0RB 1FL5B 2Q76B 2X1OA 1W0VB 2XY1A 2YD5A 1DN0B 5MENE 4NQSB 4V1DD 5K59E 5CGYC 3RWGB 3UTZA 5TF1L 4JREC 3QP3A 3CFKA 1UJTA 2VXQL 1JHLH 4P4KB 5DMKB 3QCUH 5JA8B 3E0GA 5SX5K 2E27L 1G6RH 2DI9A 3DECA 4QLRA 5DMKA 1BD2A 1M1SA 3WN5C 3UTPE 3NABH 4QXUL 3RNQA 5IBTH 2O5XH 5C07B 1KNOA 1KJ3H 4IRSA 5KG9B 5CJXC 5JHDB 4JFDE 5D5MA 4HUMB 4ODVH 1VDGA 1IC4L 5MEOA 3HE7D 4X9HA 5DJ2B 3ZE2E 5ACLA 4UZGA 3QNXA 5IB3B 5E94A 3TA3C 5BVPH 4ZAKA 3OJDA 1CFTA 2FECL 2VE6A 5C09B 4G5ZH 5J11B 4M93B 1TQCC 3G5YA 1HKLH 1A7OL 5DJ8B 4OLZH 1C5CH 4OQTA 2MWCA 3NCMA 1CFQA 5DJ6A 1HOCA 4Y7MA 4O58L 5IHZB 3ZE0F 3RL1B 2DMBA 4TNWF 3D25A 4HJJH 2DYPA 1RIVL 4M7KL 4NQCB 1FZKB 1QHOA 1Y18B 1XAUA 1CLOH 1TETL 1EO8H 4PJDB 4PRPB 1TNNA 3CDGB 4NPYA 3TLRA 5EBLB 5IV2A 1M05B 3HS0B 3O9WB 4MHHG 4NQEB 4RWYL 1NMCB 4LLWA 1KPUB 2P46B 2XKNB 2VDOL 1VEMA 5KS9B 1XGPB