25C8H

Catalytic antibody 5c8, fab-hapten complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
217
structure length
217
Chain Sequence
b'EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQKPEQGLEWIAQIDPANGNTKYDPKFQGKATITADTSSNTAYLHLSSLTSEDSAVYYCAADPPYYGHGDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG 5C8
molecule tags Catalytic antibody
publication title Structural basis for antibody catalysis of a disfavored ring closure reaction.
pubmed doi rcsb
total genus 40
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 25c8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 25c8H02
3VWJC 4MLIA 4PD4J 1A1NB 2AJUL 1EAJA 2BDNL 2O5ZH 4JQVC 3BZEA 2GITA 4U7SA 1KGCE 3L3GA 3TO4C 5J1SC 3ZE2F 1CL7H 4L8DB 4ELKB 4NPYA 5ENWA 2H2PC 1TVHA 1O7SA 3QUXD 4M6NL 4UTBH 3VFWA 1JMZA 3W2DH 3NACH 3TPUA 5T5FL 1YC8A 2F74A 2E7MA 1BX2A 3E6HA 4NRXB 3RVTC 3MLVH 4YPGA 1O5DT 2F19L 1AO7E 3F5WA 3G6JF 1NKOA 5IESH 4F8TA 1S9VB 1BEYL 5DR5H 5E9DA 5IOPB 2BP3A 4KHXL 2GHWB 4GAGH 2NY5H 5CLWA 1XF2A 4YHPB 2IQAA 4U6HB 4KVNL 1HYSC 1MF2H 4NO0D 1OAKL 3QFDA 3OL2A 1CFNA 1T0NA 1GHFH 5IMLA 3AGVA 4U1SA 3VXUE 3PE9A 2NY5L 2VN7A 4K3HA 5SX5K 3RWIA 2JCCA 1R3IH 4I0PC 4IDLA 1WJ3A 5HBBA 5FHAH 3BGFB 1V7MH 1WWBX 2DJSA 4YHNB 3RA7H 1A6AB 5TE7H 2VAAA 1G9MC 2E8YA 2QSVA 1SJEB 1NCWL 4CMMB 3SKMB 4MNGB 2YOCA 3OKOB 3RWCA 3SKMA 1I1AC 5DZOA 5EWIL 4KI5E 3CDYA 2JELL 2GTZB 1SYSB 3X11B 2V2XA 4RQQA 3KPRB 1T5XB 3F7VA 3DRTA 2DI9A 4U1JB 3KHOA 3BP4A 3SDAC 3VFMA 1JNLL 3V6FA 1CLOL 1BREA 1R3LA 5FXCH 4KQ4L 5DSCA 1HWGB 3TYFA 2IANA 3L3OB 3DRQA 1ZA3A 4PJ9C 4KVCL 5DEGB 2BSTB 1JPTL 4ZAKC 5AZEH 3OKDB 3RWFA 2XNAB 3P9MB 4JFDA 4EDWH 5J13C 4N0YL 3GMMA 3MRJA 5E99L 4HWBL 3VWKB 3MLZH 2YEZA 5CGMA 1OSPH 2F74B 3U4EB 4OGAD 2IAMB 1MJUL 2CJUL 3O6FD 4ZS7L 2APFA 5JXEC 4JFED 3H2WA 4OUUB 3BKCL 3RVWD 5J1TC 3UTSA 4LCCC 4AM0A 3VGDA 2HYMA 2F8OA 4IOFC 1T1YB 1TJGH 4FTVA 3RWDB 4P2RE 4HWEL 3MRCA 3VFUA 3EJYD 2BRRH 3KYOB 2CDGB 3ZDZF 1FDLL 5CKAA 1U95B 3U30B 4JFXB 5TQ0L 2FB4H 1DQJA 3QDHA 4OFYA 2R4SH 4U6XA 12E8L 4PJGA 2ZUQB 2XKSA 5I1JL 4JM4H 3OQ3B 5EUOE 1BZ9B 1RIVL 2XY1A 3HHRB 5JOEA 3CDCA 5I1CL 1FZJA 2VABB 1LQSR 1UJ3C 5GGUA 4EN3D 3FMGH 1D9KD 3QG7H 1F4YH 3ARBC 4JRYD 1S9VA 1FORH 2JJVA 1U8HA 1Q9KA 4CW1B 2XWBA 5DO2D 4UDUA 5KSBF 2FLBT 1I9EA 4ODWB 4Y89A 3VGFA 5C0JA 4N8VA 4Y2OA 5DHVH 1X5XA 1UWGL 3TN0D 4WI2A 2ZPKL 5D1QD 3JWOH 5I76B 3G6JA 2ARWA 3P73B 3FJTA 1M7DA 3K4DA 3PHOA 2MKLC 3QNXB 4GO6B 4ONGH 5IG7B 3PWPB 4ELKA 4Y7MA 3LEXB 1BD2B 1I7RB 5HD8D 3DI2B 4PYGA 1YEEL 1BVLB 3QAZB 4Z7VE 3QDGD 4KJWD 2FEDC 2JB6A 3TFKC 3QA3B 3NIGF 4LSDA 3E6FB 4PBVC 1DBML 5C0BE 1CT8B 4YXHH 5L88H 3C9NA 4P48A 5GHWL 3E6HB 1A2YA 4LKCB 1BFVH 4HUMB 2FSEB 3K46A 3ZHDA 3L3KB 1Z3GL 2B39A 3BISA 4GRLC 1KCSH 3OB0H 3IJHB 4JFZH 1TZHA 1X4ZA 2VDNH 4ISVB 1S7UB 3GJFH 4AENB 1YUHA 5KS9E 5HHOD 1H15B 4LDEB 4WJ5B 2M26A 4DKFH 1T66D 3MODH 2GITB 2FCBA 1ADQL 5E7FA 5HYFA 1U92B 5HI4D 1EDQA 4NKIL 1CXHA 1FFRA 4P59L 1CBVL 4TSAH 1DQJB 5EO9B 2R2BA 4LNVA 4GBXB 1ZAGA 1OTUD 3PQYD 5CINH 4KK8C 2DKMA 5J3HD 1EZVX 3O4LA 4H25B 4PGJA 4I18A 4L5FH 2HT2C 5TDNA 4OJFL 5EZLB 3MBXH 2WBJA 4PJIF 5SV4A 5B3JE 4ACPA 4PJBA 4O2FA 2IPUG 4ZUTB 3GSVA 3G04A 5EN2B 3G04B 4RGMB 3GMQB 1A3LH 1RFDL 3PWLA 4X7FC 3CXDL 1VFOA 5HYSA 1CD9B 2EO1A 3TIEB 1N6QL 1EJ6A 2J88H 4FQXB 3QIWD 4J1UB 5ELIA 3OHXB 1X5YA 2E7CA 3MMEB 3BJ91 4ZOAA 2QQNL 1FIGH 1GOFA 4KRPD 4PJ8A 4WI5A 4R4FH 5DHYA 5TDOB 3TZVA 3T3MF 3B5GA 3SDCC 1EXUB 3H42H 4YEFA 4UNTA 3FT4A 1I8IA 1MNUL 2PW2A 3K3QA 2VKWA 4LDLB 3ARGA 4BKLA 4JRXE 3CFIC 1BZQK 2PKDA 1WTGT 3C8KB 5K9JH 3ELAT 1R6VA 2D4DA 3FN9A 2P5WB 4POZC 1DQQA 4NBYB 2AJYH 1FVCB 4LLAA 4KKAD 4NP4H 2YXFA 5FDYA 4N68A 3PDOA 3TT3H 3ULVH 1A4JB 3HI5L 1OGTB 1MH5B 4C58B 5GGRA 1AR1C 5IROC 5I74C 5J56B 2FX7H 4Y2DC 4IRJC 3RDTC 2LU4A 4LHUA 4QRSA 4NZRH 3HE7B 1CD0A 1S7VA 1QP1A 1X5JA 4U6VL 1DBJH 4HQQL 1BAFL 1IE5A 1Q0YH 2GKIA 3LKRA 4DK6A 4HXBH 2EDWA 3W11C 3NFSH 4OM0H 1NSNH 2CKBH 1ZLVK 5FM8A 3HB3D 3IFOB 5E2WL 3WKML 5F88A 2Q76A 3UTSB 4UQ2A 1IKNC 2YBRA 3TO4D 1T4KA 3I84A 3BHBA 1WFOA 4HJ0C 3SOBL 3RWGB 5GGTA 4F2MB 2EDKA 3P0YH 4P2CG 1SMOA 4PJXE 4PRAB 2H2PD 1X6NA 5D2NC 1FNEA 1VFAB 1FGNH 2YRLA 4B7IA 1RJCA 1T0MB 4QWWD 3T0WA 2QBWA 1TDQA 1F8TL 1S7TA 4L9LC 4QOKA 5T1LA 1A6AA 1NUNB 4XWOC 2HMIC 1N5YL 4JZJC 4NNPH 4ODBD 1TZIA 1NFKA 1XFPA 2IPKA 3HAEB 1PZ5B 3A6OA 5DRXA 1HHIB 4F3FA 1U3YA 4TNVK 4X6CB 2H1PL 4YUEH 3BZ4A 1MCWM 1YPZA 3VWJA 2IQAB 4BQBA 1UENA 3ZE0E 5JLZA 4ISVA 4ZPVA 2B1AL 2P7TB 4ODHL 2L7JA 5LCVH 1CD1B 5JO5B 3BPNC 5D7LD 4NO5A 2Y5TA 3BESR 5B22A 5EU4A 4KK5D 4D9RD 3L5XH 1JNNH 4I2XE 3OKNA 4LF3A 2FECL 5BV7H 4NUJA 2CIKA 1HEZB 1KIQA 1UEMA 2X1PA 5FYLE 3VXPB 4JRYB 1VCAA 2PYEA 2E6PA 4CL7A 2WQRA 3GMMB 4YDVA 4ZQKA 3GSUA 4MXVF 2FX7L 2DLFH 5BRZB 4Y4HB 4YAQA 1N7ML 5E4EC 1XF3A 4ZOBA 3TV3H 5EU7C 5CBEB 3ULVL 1G9NC 4H1LA 1HSBA 4OLWH 2GCYA 4OCRL 5FIEA 5EC1B 3SKUD 3P9LB 4P49A 1HE7A 1RJYA 4PP2B 5EU5B 4CVXB 5JW5A 3C87A 2DWDB 3OGOE 4HKXA 3WO3B 1T7VA 2DWDA 1NMBL 2E8ZA 1CR9H 3R1GL 4FNLH 3VJ6B 1MFBH 1T0NB 5IMLB 5FF6B 1SVZA 3G08B 5MEQA 4ODUB 2KZWA 5C0AB 1CGXA 2K3TA 4X6BA 4R96B 3WFDH 2A6KA 3D1MC 2YWZA 3A6BH 1XGTB 4NDMB 2QQNH 5D7LA 4NYLA 5C2BL 5F6HJ 1Z9LA 4GAYA 3D0VA 1WZ1H 4V1DD 3BN9D 4Y5XB 1YY9D 3MBEB 3VA2C 1IJ9A 3UPCA 4AQOA 3CK0H 3MQIA 4YHNA 4PGBB 2XOTA 4GQ9L 1CD8A 5CIPB 3ARBA 3LPFA 3SE9L 3F7VB 4ZNCD 5BS0B 4ZXBC 3MV9E 4X7TA 5DVNA 5CZVH 4G9FE 2ADIB 4MNHB 3BPLC 2BOBB 4Y0GA 5CJQL 3KYMA 3WXWL 4YR6A 2Z35B 1X3DA 2Z8SA 4XP4H 2DQFA 4JFEB 4ODTL 3OKEA 1HHGB 5DSCB 3MCLL 3MBXL 1J5OH 1BFTA 1IGMH 4IMLA 1BJ1J 3QIBB 3TBVB 4L5FL 2YR3A 4NZUL 5FECB 2WIIA 3OXSB 1EV2E 3VFMB 1ES0B 4U6YA 3U36A 2XTJB 4X6DE 2CD0A 4A2MA 3RZCD 1ONQB 1YQ2A 2XZQH 1EJOL 4Y4KB 4PRDA 2QJDA 1AHWA 4LFHG 4TSAL 3BXNA 4JVWA 1ZSDA 2EDQA 4YC2C 4QXTB 4MS8C 3V0VA 4DFIA 3F58H 2D4FA 2P24B 2B8OT 3BX7C 4JJ5B 1I7TA 4ZAKA 1JP5A 4JQXA 1MRDH 4GXVL 5DJ8B 2Z92A 4JM2A 1D9KB 4R2GC 4P4KC 4LU5H 4BH8B 1GSMA 4BZYA 4J23A 3WFHA 4PV8B 4D0CB 4FQQB 3TA3C 3TM6A 3V5KA 3AS1A 4C83B 3QYCA 1V5JA 1ZHLA 2AJVH 3PL6B 4LHUD 3SJVD 2UWEB 3N9GL 3UTTB 4R96A 5HYJE 3GBMH 1B4RA 4ERSH 4G6MH 1B4JL 2W9EH 4YK4B 1M7XA 4GAYB 2X70B 3VFPB 3VXQB 1BD2D 3WV0A 3WLWC 3STBA 5EC2A 5GSVB 3I02A 2EIEA 2JJSC 2VDPH 5CP7B 1QYGL 3DUSA 4LAJH 4HMDA 1P69B 3MOQA 3GIVA 3O9WD 1RZKC 1IL1A 2J6EL 4NFBA 1UWGH 4U1IA 2DQGH 4MA1C 4LCWE 3QG6B 4PS4H 3RY6C 1T1YA 3IETA 5H94A 3MJ8B 1BGXH 4QLRA 4P3WA 4M1DL 1U8IA 1P1ZA 4E41E 4PJ8D 5CMAA 4X6FB 5DJXB 4R6UA 4IHOB 3FMGL 3ARED 4YWGH 3T08A 1JHLL 3HNTH 1SHMA 4HIEB 5FGCB 2VLJA 3O9WA 1A7NL 3ZKNC 5I1CH 2F9BT 4KUCD 5GS0C 3LIZH 1EEZB 1T0MA 4Y5XA 1EGJH 2HH0L 5DVLA 3HC0A 4N8VG 4JJHA 1QRNB 1U6AL 3U1SL 4J3OC 1I1AD 2L7UA 3NCCB 3D3VE 1FDLH 1ITCA 4U1LA 2Y36H 1MQKH 4AL8H 3I9GH 4W4OA 5E9DB 4UNUA 1VHPA 2NZ9D 4X6CA 1IT9L 1ZLWH 4D8PA 2FEEL 2CR3A 3A6CH 5L2KA 4PP2A 4LSUH 4O2CB 5EULV 5IVNA 1CTNA 4PJBE 5H37H 2W0PA 1LD9B 5GGTL 1TNNA 3FFCA 3O6KL 1KCRH 1ZXQA 4XNXH 2RAMA 2IMMA 5E99H 5A16A 5I73B 4HFUL 2I5YH 3UP1A 4EIZC 2LTQB 3OR7A 3I2CL 1SBSH 2EXWC 4XBGA 4W6YB 4KVCH 1KTRL 2FD6L 3DECA 1HOCA 1U8KA 1A6WL 1ZVSA 4QRRE 4DUVA 3WJLA 3BD5A 2BZDA 4Y1AD 4YHLL 2WP3O 1H3UA 2XPGA 2DMBA 4ESKA 2ZCHL 5F93C 1XAUA 1MFAL 2R23A 1X4YA 4OCXH 1H15A 3O4OB 2EICA 3D9AH 4NWTH 4JO4H 3QDGA 2P5WD 4Q97A 2YMXH 1B6DA 1EEYB 3S36L 4OZGB 1RAMA 2O5YL 1MAJA 1HZHH 4WUUE 1NCWH 5DEFA 4PG2A 4F37F 1HQRA 4QRPD 1NEZB 1BBJA 5D6DC 5B8CC 5SWSE 5AWNH 4IDJL 4U1MB 4P5KA 4IRZL 4UT6H 4JPKH 3QUKA 3BRGC 1DBBL 1ZT1A 3HG1E 3O3EB 4ALAH 4PR5B 5D2LB 3QH3B 4QRTA 4E0RB 5ITBH 4HUVA 4PR5A 1FSKB 3SCMD 1FLTX 1I8LC 1JFQL 5LBSL 3SE3A 2V7NA 2HP4A 3G5XB 2HLFD 1GPOH 4OQTL 2R8SL 3TESA 1VERA 4RMUA 5I1EH 3WFBL 5JMRA 2NW3B 4GAGL 1MCRA 1BEYH 4XCYB 2ITDB 2XKNB 2E7LC 1JHTB 2GY7B 5F3HB 4MGXA 4Q6IA 5T1DH 4QT5A 3PDGA 4JZNB 3D39B 4J3SA 2EDRA 3O6FB 5IMKA 3UTPD 4CU8A 2VH5L 1DUZB 3CC5B 3EYOB 1RUML 5D71H 4N1CA 3EJZC 5IHLB 5CCKL 5FO8A 3QQ3A 2D3VA 2GT9A 5CZKA 2IBGA 4K94H 4LCIL 2XZZA 2AAVA 1CL7L 1T7ZA 2G9HA 2PYED 3MXVH 2BX5A 4L8CB 4LSSL 5CIPH 4JDZA 2ICEA 1ZHKA 4JDZB 2P47B 1JI1A 3ZKXC 1A0QL 4FQ2L 4GKNB 3VXOA 3VFGH 4XVSH 5GS2H 1B0RA 3H0TB 3ARXA 3MUY1 5D6CB 4DUXA 4Q2ZB 4OZGF 4TUJB 4E9LA 3UJIH 4G42A 2AERT 5EORL 1PYWB 4Z0BH 2O26U 4LSTH 2H3NA 5D7JD 4ODVL 2ESVE 4HUXB 4MJIE 4XBGB 2YD2A 1VFAA 1KB5A 4BSWA 3INUL 5EO1A 4WWID 5CEYA 1JBJA 2AK1L 5FEBA 3H7BA 2HAZA 3DX6A 3K2UL 4ZTPL 1MCCA 4KJYA 3VXNB 4HUNB 3UJTH 1MWAB 2C7UB 2W1NA 4OIBA 5DUPL 3LZFL 4R26H 1VEPA 4MXWH 1E4JA 3RHWK 1R5WB 4PRIB 5DGQA 4XXCA 4D2NA 3O6LH 5BMFH 3EFFA 3RL2A 5ILTH 3RL2B 1B3JA 4M1GL 3O81A 2QHRH 1MLCB 5I1LA 3VH8A 4XCEB 4I8DA 3GKZA 2VLKD 3EO1B 3KR3H 3NTCH 3QPQD 3TO4A 1BVZA 3MGOB 2E5EA 3RFZC 1TVBB 3QIUD 2HRPH 3L1OL 1UB5A 5D1ZA 1C5CH 3KNBA 2MFNA 3DMMD 4JM2F 3VRJB 4YFEA 3PHSA 1SJEA 2XQBL 4WU7B 3QB7C 3NTCL 3FOMB 1OARL 4P57B 2NXZB 4NZDA 3S98A 4H5SA 2HTLD 4WHYG 3VXUD 2Z31D 2ZCKL 1QR4A 4FS0A 5JOPE 3CSBA 3E1F1 1LNUA 4QHNB 5ILTL 3LQAL 3EJJX 2Q8AH 2XWBB 1KBGH 4C56D 3SE8L 5BMFL 5IEHB 1RU9L 1UYWL 3M17B 5JIHA 2HKFL 1X5IA 4PRIE 2HKHH 4WEUD 1KB9J 1D6VH 2BCKB 5AUMA 1VSCA 3VG9B 2AK1H 2EXYC 4OI8A 1F3JB 4OLYL 1AR1D 4WV1B 1XGQA 4AEHH 1IMHC 4N90E 5HDBE 3CVIH 3D0VB 4A6YL 4MJIB 5EH1A 3T65A 4R3SB 3JVGA 2FJGB 1NBZA 4LQFH 1OW0A 4OB5H 4Q0XL 4K9EC 2AABH 2IEPA 2P24A 3QHTC 4I0CC 4JCLA 4HS8L 4YDIL 4GQPH 2XA8L 3SKNA 5E5RB 3EOTL 3T1FB 4OF6A 3VFGL 4IRSB 4CGTA 3ROOA 2DTML 4KKCD 4MCZA 1W2KT 1EEQA 4R2GD 4D8PB 3FB7B 1R0AH 4L4VE 3LKSB 4HUUA 4JY4B 4M7ZB 3ULUL 4M93B 5D7SL 3GSQA 4X7CC 4TQEL 4XP1H 2AK4A 4G7VH 1KYOJ 1FNGB 5BW7A 3ZKQD 3VFSA 2EE9A 2WBKA 5BVJB 4NQEB 4OUUA 5BVJA 2FH8A 1RUMH 5D71L 4EXPX 4FQLH 5KS9F 3BXNB 3WE6B 4MA3A 1HOCB 4OIIH 4X7SH 3VGAB 1XCTB 3MR9A 1CQKA 2FR4B 4C56A 3DV4A 2OZ4L 5GS1B 4LVOC 2FR4A 1UH2A 2HFEA 2NXYD 3IS1X 5CP3H 3HTLX 1HDMA 2A73B 4P46B 2X4PA 2R23B 3MJ9L 4W68A 2DL9A 1HI6A 2EH7H 4B41A 3S7GA 4JO1H 5GGVY 1GVIA 3OWEA 1QSFB 3OX8B 5F70A 5LBSH 4ZTOH 5E2VL 1T22B 3FRPA 5IEHA 3QHZH 1F3DH 1FVDA 2NR6C 3UTZB 5ITBL 1ZK9A 5FHBL 1OGAB 2JJWA 5BZDA 1G7IA 4JPKL 4XAWL 4I4WA 2P46B 2B4CC 3HZKA 3LDBB 4GRLA 3BEVB 3OB0K 5K9OA 1G7HA 1TTUA 5SWSB 3WO4C 2FWOB 1RJLA 1T7WA 4WI3A 3GMNB 2OL3A 4JEGB 3HKFA 4HW6A 5IBLC 5T3ZH 4JFFB 4YE4H 5IP4A 4X99A 4DVBA 2YZ8A 3QEUB 4EI5C 4NWTL 1RUPH 3BJLA 1PG7X 1RULL 5IQ7L 2AKRB 1JWMA 3PJSA 3S37H 4WW2C 1DCLA 4RX4D 1JGEA 1HKLL 2XN9E 2HN7A 5J11C 2R0WL 3RKDD 4ETQA 2C1OB 1C1EH 1CLZH 3EYQD 1C12B 3QCUL 2NMSA 3AY4C 3F12B 4YHZH 5JO5A 1LEKA 1MWAH 3D25B 4CJ1A 5L0QC 4QXGH 1UXSA 2OJZH 4C83A 2EE2A 1W0WA 3QI9D 5DFVC 3L6FB 1EFQA 1N64H 5FM4A 5L7XL 3KJ6H 4LIQL 5AYUH 4XNUL 4H20L 3U0TA 1S5HA 3QDME 1OSZB 3RP1A 4JRYA 3HE7A 4LLWB 5CILH 1S5IL 3N50A 5DUBB 4JHAH 4G8EA 4MA3B 2VISA 2FHBA 4NNXA 2F5AL 4P3DB 4YHOH 1KJMA 1R24A 2GI7A 1ZHBB 4HEPG 5DMKA 1A7OL 1BQLH 2EKSA 1I7ZB 4OFYD 3SGEH 2JJSA 1HINL 3I9GL 3JV6A 1MQKL 2HRLA 3PIQA 1PLGH 5AYQA 3G08A 4PTUB 4Y5VC 3GBNH 4FQHB 2DS4A 4JN1H 2M8XA 3RPIB 3RGVA 1EGJL 5FYJL 3WUWG 4ELME 5I6XC 3H3PH 2AS5M 4NYLB 1XGQB 5IB5A 4KMTL 4HLJA 5D7JA 5GJSH 5T1KB 3GI9L 3X13A 2BVQA 4JVPA 4FOMA 3E8UL 2QSCH 4YX2L 4X80H 4KDTA 1P84J 3QO1B 4LSRL 4E41B 2GJ6A 2N1KA 1WAAF 1Q94B 3MRNB 4TULH 3K80A 2VMFA 1HHIA 2NY0D 5DQ9B 2PN5A 2YUZA 3ZTJH 3BUYB 1HILB 1PY4A 2IH1A 2VLRD 5HVHB 2ITDA 2XKNA 2OP4L 4KTDH 1DVFC 3ALWA 2ARJQ 3B2VL 3I6KA 4HIJA 2ENYA 3C08L 3ZMRA 1FVDB 2DM2A 3MRBB 4HHAB 4H88L 2FL5A 4L3AA 1A4JA 3BE1L 4QHKI 4G7YL 5DYOA 3VRLF 3SE4A 3F7YA 2BJML 2VIRB 1JJUA 5F72S 1JUFB 1NJ9B 2P5WA 3N9GH 3UTTE 2R29L 1ONQA 3OPZH 4GT7A 4LF3B 2FDBP 3J8F7 2AJVL 1G7LA 3D2UB 2X42A 3ARFA 5IWLC 1A6TB 1LO0L 1WCBB 3ES6A 4K94C 1NEZA 4OT1H 4PJHB 4ENEC 1XGYH 5CJOH 5I15L 4ZUWB 4P9MH 4M61A 2B4CL 3GKWH 2PXYC 1PZUB 2P4AB 4OGZA 1J12A 4QHMB 4UT7H 5FUOH 1S3KH 1FFNA 4GXVH 3VMNA 1DVFA 4AQ1B 3IJYB 5HI5C 3C5JA 3MO1A 4JFHD 1T03H 4H8WH 3GSVB 4JPIA 1IGTA 4JFFE 5D7JC 2ATPA 1MOEA 4W4NA 4U7KA 1ORSA 1J8HD 2XZQL 4OBSA 4N8PA 1EXUA 3U7WL 5ESQB 3FT3B 3FQNB 1WTLA 1FFOB 4J3TA 2J5LB 1CLYH 1YECL 3LD8B 3QH3A 2FBJH 3FN3A 3TVMA 1XIWC 4QNPE 1J5OL 1QR1A 4E0RA 3MCLH 4FFYH 4PJDA 2X89D 3P4NA 3CMOL 4MAYA 4G6AC 5I1AA 5KVGL 4OBRA 1SJHA 3BT2L 2YPLB 4PRNB 2BNQD 2WZPD 4JGJA 1I1AA 3R0MA 5F88B 5DD0H 1FC1A 3MV9B 1BBDH 1V3JA 5FUZH 4UDUB 3WDHA 3SE9H 3BWAA 2NYYD 3KWWA 3MRIA 1KTDA 4XPTH 4KXZH 5J7CC 2FX9H 2N4IA 3TH3T 1QFHA 4YXLH 4CN1A 3VDAA 4Q58C 2DWEB 2NXYB 4PJ5A 4LKCA 3QQ3B 1AJ7L 5T1LB 2XG4A 4HPYH 2D03L 4WO4B 1QLEL 1WBYB 4OD2B 4EN3B 4U3XA 1NMBH 1UADC 2QADB 4XCFL 2OYPA 5H35B 5HHQB 3DURA 4F9LC 1X4XA 1YEJH 4X5WB 1YYLH 4R0LC 3GSNL 3HNVL 2ZKHH 4KK6C 3KLAA 3EOAA 5J9PA 2Z8RA 5IJVA 2DICA 1L0QA 1NDMA 1EAPB 4UQ2B 3IF1A 4J4PD 2X4RA 5F1KC 1KSRA 1T04B 1I8KB 3B8YA 4JPIB 1IKFL 4PTTA 5DJ2A 3QWRD 4M43L 5BVPH 4NO0B 4JFHE 5FA4B 4KJPC 2VL5A 1MCOH 5EUKA 5FA4A 5F9WC 4I18B 1GAFL 1YNTB 3KPSA 1RD6A 2DM4A 5E6IA 4IM8A 1MIML 4OLXL 3WLBB 1KXTB 1QFUL 1YQVH 5LCVL 2R1YA 2IQ9H 1SMAA 4LEOB 3ULVC 2B1AH 4RWHA 4B53A 1UJ3A 3IFPA 4N5EC 1NKRA 1T1ZB 4HWZB 4OV5A 1MCPH 1Z9SA 2CR6A 3N0PB 4JVUA 1IGJB 4JFYA 4FFWC 4GFTB 3H8NA 3B9AA 3MO1B 2X9XA 5HPOA 4P23B 3MCG1 1N5YH 3MX0A 3UYPA 4L3CB 2FL5B 4FZEL 3SDAB 1GGIL 4JQIH 3KWWB 43CAB 3TC9A 2C9AA 1YNLH 5C0GB 2NY6C 4KJQC 4LFHD 2EC8A 5EO9A 1CN4A 4MWFB 2VUOA 3GSWA 3T0EC 2C4FT 5K59E 1WK0A 4NJAL 4Q7DA 4DCQB 4G8GD 3LMJL 4YPJA 2EDYA 4P3CH 1P4BL 2KKQA 1F2QA 5ECJE 4OUOA 4PB0H 5GZNC 2F15A 4DZ8B 3SKNB 4QRPB 3WKMH 2AEPH 3L3OA 4PGCB 1A8JH 1FG2A 1B2WL 2O61B 4OCMC 3NFSL 4R4NC 4F7EA 35C8L 2LU7A 1V3KA 1M71A 3STLA 2CH8A 1U8MB 3SBWA 1MHPH 1RZFH 5FYKL 4NFDA 1ES0A 4FRWA 1G7JA 1F6AB 1UT9A 1A7PH 1T0PB 1ULVA 2ESVB 1H0DB 2IH3A 4PJCB 4ZO6A 3N06B 5IBLD 4Z7VA 1W72L 2X1OA 3WHXA 4D9QD 4XBPB 5INCA 1IGCL 3P0VH 1XGTA 4NDMA 1PY9A 1BOYA 2H32A 2VLRB 5D1QB 4K7PH 2CRYA 4P3DA 1ZA6B 5DD1L 4Y4FD 3VI4E 3WS3A 3DSNA 5CBAA 1EO5A 4BFIB 3ARBB 4ZUVA 1PG7H 4ZUVB 5K9JL 4LL9A 4H1LG 2YKLL 4G9DA 2P5ED 3C60B 3SKJH 4R4BB 2V5TA 5FK9A 3MV11 1QEWA 5LXGH 1JTTA 1Q9WA 2ORBH 3B6SB 3QWOA 4EUPG 2VXTL 3D2UD 3NCMA 4LMQI 3QWOB 3SGDI 4R4FL 3DGGB 3U6RB 1FIGL 5EBWB 1U41A 5I1KL 3MRFA 4Z7UE 4Z18A 3CX2A 4NRZB 3THML 2DQJH 4KKLD 1XCTA 1NAMH 3V4UH 4PJ5B 2FIKA 4Y16D 4EEEA 1U8LA 3WL9B 5F97E 4QF1B 4P2QA 1TJHH 1DBKL 1CZ8L 1T21A 3VXSE 2HTLC 1FP5A 3QDAA 4NKMA 1F6LL 3ZKMC 4QXUL 3BUTA 4FMKA 4FXGA 5DK0A 2DQUH 4JO2H 1J1OH 4KTYA 4OJFH 3U9PL 4LLUB 2E27L 3KDMB 2Z92B 1JYNA 3TT1H 1KOAA 1RY7B 3O45A 5EG6C 3ZZ1A 1OLLA 3WFCH 4ZSOE 5J12C 5HHPB 3ZE0F 5DVOA 1QRND 5GGSB 3HC4L 5CZXC 2CGRL 3BSZL 3KNBB 1JYVA 2HTKC 1S7XB 5DHVA 1Q72H 2UVEA 4WUUB 3Q3GA 4NKIH 1T3FA 3TBTB 4NHUB 4NT6A 5BZWB 1QHOA 5EU6E 1EH9A 1VADA 1XR9B 2AV7A 4EKXA 2MCPH 3ARUA 2BHYA 2AJZA 4U3HA 5T1KD 4KY1L 3C5ZA 1P84K 4DEPC 2F53A 4PV9B 5KS9B 4FQXD 1G1CA 1IEBB 2EC9U 3V6ZA 1U92A 1MLBA 1PKQB 4P5TA 5JA8B 1MPAL 1YEFH 5KVDL 4YFLI 1B88A 1LK3H 4HKJB 2XWJB 2VXSL 5CMAB 4BYHA 1UA6H 1CG9A 1Z3GH 2NY0B 4TSCH 3TH4T 2W38A 3CPLA 2EDNA 3TNMB 1CVRA 2YD9A 3CDGB 5C0BB 3U79A 2VRAA 1NCDL 4J6RH 3QUXC 5T1LD 1IARB 2XZAL 1MFEH 2VDMH 4Z7VB 1ZT4B 3K0WA 1K8IB 1CDHA 1K6QL 4Q6YA 2W60B 3AROA 2NX5B 1NDGB 4XPBH 3RVVC 3QA3A 2NX5A 3UYRH 4EXKA 4LRNH 1WIPA 4QTHA 3FZUC 1AE6H 4UV7H 5I1DA 3VA6A 1ZTXL 3OAZK 2B2XL 1CICD 2VNCA 5IQ9A 2DLHA 3BH8B 1CGSL 3HPLA 4BZ1L 3HR5A 2K1MA 3NPZB 3WUWA 5J9PB 3VXTA 3EDKA 2H6PB 4GG6F 5TE6L 4ONFL 4MJID 3VGEA 4A6YB 3RWHA 3T0VA 4I3GA 2ADIA 1QLFB 2PO6C 2NY2D 4CU6A 2JK5A 2AEQH 3TWCH 1JF5A 1UWXH 2PTTA 1QRNE 3BPCB 4XC3L 3IAQA 1WWAX 5C6TH 4EIGB 3ZDZE 1OAXH 1CFNB 4JGUA 4WTZG 3MLTB 4FMFA 3IDXL 3QWRA 4Z9KB 4RMWA 3HE6A 3QUMH 4Y2DB 2OI9C 5HYJA 5C08A 5TQ0H 4OGYL 3X13B 1WFNA 4OZIA 2VXQH 3MNZA 2OM5A 1E4KA 1AHWB 4HFWA 3EHBD 2Y06H 4X9BA 4G9FA 3S5LB 4YO0B 4GW1A 2ED9A 3OMZA 4WU5A 3RKPA 4BFIA 1NGZB 1MCKA 4HWNA 3MJGX 2A83A 2BMKB 3WIHH 3DROB 4I9WD 4XZUA 4LLUA 4ZS7H 1JGUL 3T1WA 5E8NB 4BQ6A 2AK4D 2E6QA 3GMRB 1WBZB 3G6AB 1YMMD 4ZODA 2FYYB 4I48A 3PGCB 1JK8B 3ALPA 5B39G 2AP2A 3MV9D 1ACZA 1CK0L 3PABB 3ZDYF 5C70A 2XY2A 5GS0H 3IDJA 2UWEE 3UO1L 3LOWA 2EZ0D 4APQC 4PJCA 4RWYH 4NN5B 5HHMB 1XF4B 3QEGL 1JGLH 4HMEA 2IPTL 3MRLB 5ESAA 1FRGL 1MCSA 3UPRB 3KYKL 2XFXB 1OAYH 4PY8I 4G80A 1YEKL 4JZJA 3HG1D 4Q9QL 3DPBA 5J6HB 1J1XL 1MCWW 3TVMB 3QXWA 2A2QT 2Y1VA 3P4MA 4HUXA 5HVFB 1FFPA 5C0DB 1EEUA 4HUUB 3EJYC 3NIDE 2A6IA 5EWIH 4HIEA 4M3JA 2CKNA 4HJGA 1M6OA 1F5WA 4HC1A 2J1KA 1VGKA 1N2RB 1JF1A 5TE7L 5IMOA 4X9HA 4LHUB 3GK8L 5ID0A 4LLWA 5IM7A 2O5XH 4I3SH 2Z31A 3UTTD 1IAIL 1S5HB 1TTGA 1R3IL 3EDFA 2XTJE 1ZE3C 2H32B 2YD8A 1MCIA 4X4XA 3VXUB 2ZNWA 1OP3H 1DN0A 1KIPA 5IMMA 4ZUUB 3ULVD 1KTLB 8FABB 5ESVB 4F80A 3GIVB 5AG8A 4RRPA 5D1XC 3BP6A 1CFSB 2V6HA 4O51B 1NPUA 4FFWD 4G9FB 1H9VA 5DR5L 4CADB 2Q7YA 1I1YB 3MLPA 3DXAD 2JB6B 1CFQA 5CD3A 4JG1L 3RU8L 3UJJH 3CVHA 3MLVL 4XI5C 1PKQE 2J4WH 5F7DB 1QFWI 5SV3A 1KB5L 1P7KB 5JOPD 2FHFA 3FFDA 1FN4B 3QXUA 3CMGA 15C8L 2YD1A 4U1HB 5SWSA 3SDAD 1P7QA 5HYSB 4M8QB 4DKEH 4N0CC 3FCTA 4N9OB 4Z78B 1RK1A 4JAMA 2BOCB 4TUKH 5D1QA 3UTSD 3DVIA 3MBEC 1L7TH 5DLMH 1E4XL 3GMOA 1AXSA 3BP5B 4ETQB 3GMOB 2XTJD 4OF5A 4LNRA 4ZSOB 1DDHA 5LWYL 3VH8B 3SN6N 4JR9H 4XZUB 3IJSB 4O2CA 4XNMB 2CIIA 2PO6A 1SY6H 1KIRA 4HHAA 2IGFL 3LB6C 1X5LA 4LEXL 5I8OL 4M6ML 4KUCF 5BRZE 5HI4C 2VZ3A 2VWEE 1N4XL 4I13B 1D5BB 2DQTL 4F9PA 3GSXB 3G5VB 4XX1G 3OAYH 1NJ9A 4OZFG 5IT2H 1UWEL 3FB6A 1BJ1H 1KCUL 1W8OA 3JZ7A 5JQ6L 4QRUB 5BXFA 3G6DL 4Y2DA 1JPSH 5DUML 4M4RA 3DSFH 4UIKH 3T4AB 1WWCA 1ZVSB 4AEIL 4OF3A 4Z7UB 1XIWD 4GS7C 2AEWA 4G5ZH 4M61B 3QUYC 4LARL 1MLBB 1R3HA 1T2QL 1T5WB 2X4OA 4G3YL 5F1NB 1JVKA 4U6XB 2ADFL 4N0UA 1A14L 3EYOA 3DXAA 1HQ4A 1WT5C 4XPFH 1QA9A 2DLIA 3UYOD 4NHCL 3LEYH 1FH5H 1GGYA 1I3VA 2FHCA 3IDNB 1CFQB 4NCDA 2F54A 1J8KA 4Q9BA 3ABZA 5DJYA 1HQRB 5I1HL 3N1QC 4XC1L 2IADB 4ZNEE 2GT9B 4Y16C 2I60L 4HK3N 4BKLB 1A7QL 1IBGH 4P46D 3L95A 5EU6A 4PJXB 5D70H 4G8IA 4PJ7A 1UZ6F 3CSPA 3QIBA 3TBVA 5EOCL 2R1XB 1M7DB 1MHEA 2BC4A 4FQQA 4RGOH 2ZNXA 1EPFA 4KHTL 2R2HA 4RIRB 2ARJA 1VKXA 3MLSL 2OL3B 2WBJC 3FTGB 4PLJC 2AEIT 3PGDA 3QJFA 3QI9B 5D5MB 5HGDA 2EYRB 3MRHA 5DJXA 4XNQB 2IALA 1GZQA 4HZLA 1LMKA 1INDL 1UM4H 3TO2A 4WEMB 4EOWH 4JY6B 2DYPA 2P48B 4R0LA 5DJDA 3IYLW 1GOGA 2GFBA 4KZEH 3MUZ1 4S11A 3SKOB 1SJXA 2FATH 2APVA 3SKOA 1CDUA 3ARYA 3MV8D 1JWUA 3I6LD 1IBGL 3IDIA 1AFVH 5KVFH 1FYHB 4WUUD 2WANA 1RV6X 4F3FB 2CK0H 4JANA 3CIQA 4OFIA 2P5WE 5D8JL 2HN7B 5F96L 4XVJL 3P4MB 4G6JL 4GH7B 4G8EB 4RAVB 4JRXB 3IJYA 2X4UA 1ED3B 4MXVE 3RY5A 5J6GB 4JB9L 1Y18A 3EO9L 2CK2A 1T2JA 1EZVY 2RGSA 2UY7A 1FE8H 4P9HH 1IL1B 1FJ1A 1W0WB 5LVEA 4HBCL 3DI3B 1CGTA 2CIKB 1LWRA 3VGHA 4F15B 1LDPL 3VI3E 2OZ4A 1PW3A 4TPRL 1JCKA 1JPSL 3U4BL 3A67L 5KAQG 2LTQC 5JQ6H 1NMAH 1CICC 2V17L 1OY3B 1JZ3A 4YQXH 3LKQA 5C71A 3WUWB 2BVPA 2VN4A 4EJ1C 3VDCA 4X6BB 3V6BR 2RQ8A 1YEDA 4M1CD 4UINH 4ZDHB 3WXVL 1LEGB 3B9KD 4KI5D 3NCYP 3MOAL 4H0IA 4HKXB 2XZCH 4JCMA 3P11H 5IEKA 1S7SA 2MTPA 4P2OC 3FHQA 1KENH 1V7NH 1OF2B 2Y9RT 3EYFB 2F5BL 5IBTH 4XNQA 5CHNB 3IDGB 5F9JA 4S10A 1DQDH 4POZD 4TUKL 2Z35A 1DLFL 5J8OA 1TVDA 2NY4B 1OAQL 2LV4A 4HDIB 3E3QC 5JOFB 5DMIL 5DMJB 4YHML 4WEBH 3RTQD 3L3HB 3CSYA 1QFWM 2BVUA 2NXZD 1XGRA 1CGUA 2DQCH 1GRWA 1HH9B 1U3ZA 1D6EB 3G9AB 5HTSA 5IOPA 1F42A 1HH6A 3VDBA 3P4LA 4NZTH 2MSPA 4H8WC 2W91A 2X4OB 4K9EL 1P4IH 5HYEA 1KEGH 4MHHI 3DETC 1YYML 3BPOB 2QKIA 4FQXA 5FYKD 1DEEB 4KZDH 1ZT1B 1KG0B 4LOUC 3U0WL 5E8PA 2PTVA 4MD5A 4YHKH 2YPLE 4K2UL 2EZ0C 5C07A 1YN6A 2ZG1A 1UJTA 1HCFX 4MJIA 2GSGA 4WW1A 5DJ2B 1RUKL 1BD2E 5GRYA 4TVPH 4PJAA 4NIKB 4WFED 4IIQC 3I3BA 1CICA 3MRNA 2YZ1A 2APWA 4BSVB 3OKEB 4ONHA 1IAIH 2C3HA 4JDVB 1U93A 5IIEB 5HDOA 3M1BB 4IRSD 1NAKH 4NQXA 5I1GL 1DJSA 3AS0A 3ZKMD 5HY9B 1QQDB 4R90L 3UZEA 1FLRL 1JRHH 4XXDA 2HMID 4GW5A 1LO2L 4YDLB 3FN0H 4KKNA 3WMSA 1OP5K 2VQTA 4HLZH 1CYGA 1ORQA 4WFFE 1FNSH 2W9DH 1ZT7B 1ORQB 1YEGL 3QNYB 2R0ZL 1MQ8A 2G75B 2XRAL 3DLQR 4WY7L 2EDLA 3M8OH 3RZCC 2KDGA 3V5HA 1LO3L 1P9MC 1DN0B 2R0KL 3GSWB 3MRQA 2WP3T 4PJHE 5DT1H 3TBWA 3QFJD 1X5AA 3C5ZD 5HHME 5DA4A 3O3BB 4TRPL 4LPXA 1CXLA 4NPYB 5E8OA 5ENWB 4QT5B 2YRPA 3GMLA 2DQHL 1I3RB 3QQ4A 2B0SH 4NM4L 5DRWA 3RL1B 5IHUH 1CK0H 1PD6A 4ZUSA 3V7MA 4GXUN 4K3JH 4NNYB 3TYGH 5KSVA 5DMYA 4G42B 5ITFB 4Z0XB 1NLDH 1KNOA 4XNMA 1BVLA 4LSVL 2ZUTA 3FFDB 1JNHA 1KTKE 1NLBL 5KN5B 1TVBA 1NEZG 2FECI 1MHCA 3O2DL 5GGQL 3F12A 1J0JA 3DUSB 5IBUB 4D0DA 1A21A 1G9NH 3AC0A 2KUTA 4FZ8H 4UU9A 3IGAB 5C0EA 4QGYA 3K8KA 2HT4C 5EU4B 2YPVH 5DJDB 1T1WA 2QEJA 5FUCC 3FCTB 5EC1A 3GI8H 3KPLB 2YSSB 4HK0A 2XWTA 4O58L 3QHFL 3T2NH 1ZS8B 4OZFB 4K7FB 1PGRB 5IB1A 4HS6A 1CFVL 1G9ML 4Y4HA 1MHEB 2BC4B 4YAQB 2HJFA 3RVXD 1TQCB 4LLMA 1HHJB 5GJTH 1KFAL 4L1HA 3MYJA 4NRYA 1EUUA 4RZCA 5F1OB 4YJZL 5C6TL 1E4WH 3KPRE 5HYSG 1UQSA 4PLKD 5MEPA 2BXZA 2AXGA 2G2RA 4ZPTB 3G5VA 3HMXA 1NCCL 5KZCD 5IEKB 3AREC 4MNGE 4TUJA 4M03A 3NH7L 4HIHA 4OZ4B 2B2XH 4XP5H 5HHOE 4TNWF 2E9JA 2NQCA 4U7MA 1OAZH 3VG0H 4RAHA 4PD4K 4NKOA 4ZOEA 2NX5E 2VDLL 4KMLB 3ZDXE 1QKZL 4RGNE 3QDMB 1BJ8A 3O3DB 3T3ME 1G6RB 4XAKE 4D9RE 4P5MA 4Z95L 4JRXD 1NC4B 1NCBH 2CPCA 1INEH 1L7IL 2D31A 4MQTB 4ETYA 3ZTJG 1F4WH 3KYMB 5ADPH 1AO7B 5E03A 3V6OA 3QPXH 1FNGA 3CVHB 1WEJH 5IK3A 4PJ9D 2G60H 2VB5A 3JXAA 1MHHA 2HWZL 2XN9B 3QCTH 4EI6A 4JFOA 5IB5B 4JQXC 3ULUE 4TOYL 3WN5B 1WCBA 2MCPL 3OF6D 3L95B 5EU6B 4DVRH 4APQD 1NC2A 1UZ6E 1Z9OA 4GSDL 1CIUA 1SBBA 1GC1H 3IDIB 4G8FB 1ZMYA 4MD4B 3VGAC 3EO0A 3BSZH 2W65A 3ZO0A 2AGJL 1SYSA 3X11A 4ODUA 1TJIH 5HGGS 3WFCL 1DDHB 4K71C 4MAUL 4XCCL 4Z76B 2K9UA 3NA9H 2WIMA 4NRYB 4RZCB 3I6KB 4CKVX 4QRSB 4RMRA 2E27H 3IFPB 3T2PA 4JZOA 4OM1L 3O2DA 5MEPB 1QSFE 5LGHH 3MTRA 1QSFD 2A9ML 3FQXA 4CW1A 3I02B 1UM6L 4X7DC 3BKJL 4QXUH 3GHBH 3VXSB 3MV7E 1BOGB 5D7IA 4IJ3B 1DBKH 2BSTA 1K8IA 3EUUA 4Y4FB 2IFFL 5F6HI 5BXFB 3L3HA 4PJ5E 4U1NB 5JDSB 3Q2CA 5A2KH 5LAXB 4X98A 3T09A 3DX7A 1QEWB 3NFPB 5FDWA 5KSAC 2FO1A 3BMWA 3LRGA 1P5UA 1I1AB 3MLWH 1ZLSL 3VI3F 4NUGL 1AQDA 2Z4QB 2HLFC 3MGTB 4NQEE 5ICZB 5D1ZC 4QEGA 3P4NB 1J05A 5CBAB 3D0LB 1Y6KR 4MHHG 3X12A 4NQDB 4DJMA 2G2RB 3ZL4L 4BFBD 1UH3A 1MEXL 4FTVB 2YKLH 1BD2A 4CDGC 3NGBB 2YHGA 1NFDA 1RZGA 2E7HA 1B9ZA 4L4VB 3W9EB 1TTFA 2WUCL 5EZIL 5HYQA 1H3TA 4TUOA 1R5VB 1KJ2L 3SO5A 1NFIA 3OGCA 3WNMA 5DD1H 2FSEA 2VLRE 4K7PL 4PRPA 3TFKD 4PUBL 1OM3L 2X09A 5JR1H 4NO3B 4PY7A 5DURB 2BSRB 32C2B 2YSSA 5ACLA 2C5DC 3FL7A 4KJYB 4PJCE 1RIHL 1RZIA 5C92A 2DM3A 1H8SA 1AD0B 5DI8B 2AV1A 4APQA 4KMQA 4Q9RL 3NN8A 5ACZB 5I19H 4ELMF 1WIUA 1MHPL 3NN8B 4ZOCA 4HCRH 5ACZA 1AGCA 1N8ZA 4GBXA 2JB5H 2OLDA 4M5YL 4CMHB 5E2UH 2IWGA 4FXGB 5DK0B 1C08B 4WUUA 3RWEA 3S4SG 1GGCH 4FXKB 1T66C 5IFJA 5SWZE 4QRPE 4GKSB 1OVZA 3TCLA 1MFCL 1FNAA 3N1MC 3S34L 5I8EA 1WBXA 1AQKH 5AZ2L 3RZCA 3C5ZB 4DN4H 5D9SA 5FKPA 4MMXC 4WW1B 1FZKB 2DYPD 3Q1SH 5TE4L 5I6XB 2ZUQC 3U46A 1IQWL 3QG6A 4NJAH 4TN9A 4YBQC 4MAYC 3CD4A 2ZUVA 3SE4C 4P4RA 4F7TA 2V5SA 1A2YB 1YC7A 1YNLL 4P2QB 1NMCB 3T77B 1A6VL 2VZVA 3SEPA 5FO7B 5TQ2H 3FQTA 1YUHB 3SJVE 2XA3A 1PX3A 1XR8B 5C9KA 4HXAL 3FO2B 5FCUL 9CGTA 3KLHD 2J12B 3RUGE 1TZGH 4L9DA 3D39D 4PJXF 4S1DD 2IQ9L 1AY1H 2YN5A 1W0VA 5F21B 4PJFA 5DQ9A 2J8UE 5I0ZA 1PJ9A 2FBOJ 3KYOA 3QRGH 2NW2A 3I75A 3H9SE 1MRFH 4BZ2H 5D2LA 3ULUF 4J3VA 4OD1L 1EHXA 1FYTB 5IVOA 3ZE1E 2EKSB 4LVEA 4RMVA 3WFEH 1U42A 1DQTA 5KW9L 5IROA 1INQB 2IJ0C 2PXYB 5MERA 5KVMC 3ULSA 1AGBB 3WYRA 4JHBA 4KK9D 4GAJH 1Z5LA 1FPTH 2KL6A 4Y2DD 4R97B 4DGIH 3F7RA 5BW7C 3FRUB 2CUIA 4X0KB 2QR0B 3WS6A 1PKOA 1A7BA 3CDGA 3SGKA 4Z7QE 5FKAB 3HZVB 3CFDA 5D7JB 2VLRA 3UTQA 5AD0A 3KJ4B 1LO4L 3GSNA 2MHAB 4HDIA 4HPYL 5JOFA 3T65B 5DJAA 4HGWB 5HI3C 3R8QA 3DV4B 4HJJH 4GLRI 5BO1H 4XBEH 2FX8L 3V6FB 4ORZC 1FNEB 4HGMA 4OCSH 3TJEH 4QTIL 5EZOH 2HWZH 5BS0A 1ZOXA 3OKMB 5I16A 5J1AB 3VWJD 4U0QB 3P40A 2ARJB 1VKXB 2W0KA 5ADPL 4RAUA 4OGXH 5C7XL 1NFDF 4FXKA 5C9JA 5ANMA 2VZTA 1BBDL 5I8KH 1F3RB 2DBJA 4YGVB 1I1CA 2VQ1B 5LKNA 3HUJF 5FK9B 1NANH 2LABA 2R56H 4HIHB 4AK1A 4LASL 2FIKB 2AQ3A 1T7XA 2ESVD 2H9GB 4UAOC 4OCWH 1PZ5A 3RHWF 1YECH 1MJ7L 3HG1B 1AI1H 1T6WA 1KELL 1XZ0B 3VG0L 1MCEA 3DUUB 4NO2A 2P1YA 4X4MA 2CRMA 1J0KA 5KOMC 3BP7A 4XVUD 5ALCL 3E0GA 2NXYC 5BV7B 3U7WH 4X98B 4W70A 3MACH 2VYRE 3QIUC 5GGRB 2P7TA 1U8JB 3EDDA 5KSAA 2DBLH 1CDYA 7FABL 4XMLL 1A4KB 3VE0A 3U7YH 5EBGA 5JUEL 1JHKL 4XP9H 1F4XH 1E4WL 2YS4A 4NC1E 3RRQA 5SWZD 1P9MA 1JYWA 4GRWE 4I0PD 3CAFA 2I07A 2R1WB 5DQJA 3ZT7A 4LCYB 4KK5C 4Q74A 4ODSH 4OI7A 1G9MH 1KLUB 2CMRH 3BP6B 4X99B 4DVBB 3MRFB 4XVTH 5E1AA 4QRRB 1LNUB 4NJ9H 5BZWA 3QHFH 5EO1B 5D9SB 5JW4Q 1Q9OB 3KPQB 2AXJA 4X5WA 2CDFA 2YPVL 4I3RH 2AJXL 4KTEL 3RTQC 5CP7A 1DQMH 1QSVA 2CO6B 1A1NA 1OLZA 5MHSE 3G6JB 4J3XA 2IBZY 4PRHA 1G7QA 5GGQH 4WFFD 5D6CA 2F58H 4Z7OF 5EPMB 4RBPH 3UX9B 4LSVH 1DSFL 4XP6H 3D85B 5E56A 4KGLA 1GC1C 4YBLC 4H88H 4PJBB 5TDOA 2CLZB 2PR4H 1L9NA 3BDYL 1Q9LB 4I77H 4K3JL 1B0GB 4KTDL 1DANT 1YJDL 4JAMB 1ZLVH 1CG9B 3FQWA 4NM4H 5E9DE 5JIIA 2DF3A 5B3JF 1IGIH 4P23D 2B5IC 3QULA 2IG2H 2MPAL 4NQED 3B9KA 2VDKH 3QIWA 1OB1A 5GIRB 3UDWC 3NZHL 3WNOA 4LSRH 1WWWX 3UAJD 4AIZB 2WINA 2OS7A 5DT1L 2NY6B 1G6RL 4M7KH 3MRKA 1EAPA 3MLYL 5E2TH 2B1HH 5JXED 5GJSL 5L2JA 5CFHA 1BQUA 1EBPA 4WHCA 4YXKL 2PCPA 5ADOL 4PG2C 3U0PB 4ELMB 2VZSA 1U9KA 4WGVB 4HKBB 1J05B 1GIGL 1WISA 3QJHA 3RVTD 4DKDC 3BIAX 4GKSA 4UB0H 2BVEA 1I3GL 2GJJA 2D31B 3BW9A 2NY1B 5CSZA 5JMOC 2W0FB 2EEDA 1HINH 1T5XA 3VCLA 1N59B 4LCUA 2EDTA 4TVSa 3I6LE 2D7OA 3MV01 4HMCA 4NC0B 3U46B 3QO1A 2X4QB 3HAEG 4ZO9A 1KN2L 1AIFA 3T3PE 3WJJA 4QRQA 4HT1H 5GRVK 4P23A 1JRHI 3HS0B 4MD4A 5L6YH 3MRRA 4JPVL 1UCTA 5HYJB 4XMPL 5MP6L 4H20H 5I1IH 5D1ZD 4XNUH 3U0WH 1A3RL 4Y4HC 2K7PA 3KG5A 1HSAA 1YYMH 1FCCA 3B2UC 3FB5B 2K7QA 3I85A 4P4KD 4QXGL 5C09B 3WDJA 1NFDB 4M6OL 4UTAH 3KXFA 3C5JB 4XH2B 4XMKH 3D3VD 5L9DH 3NIFE 1DE4A 4NZTL 5C0RL 1EBAA 4LHUG 1D7FA 4KROC 4EBQL 5I75C 2RIKA 2XTLA 3I6GB 4S1QL 3RZWA 1D5XB 4OCYL 4NN7C 3DX8B 3VGGA 1U8NA 3WUZA 2X1XR 5M94B 1XCQA 3OZ9L 4MDJB 4EUPB 1XF4A 4NO3A 4PY7B 3AAZA 3DX9A 5IQ7H 1RUPL 3Q5TA 2HT4D 4N9GB 3HMXL 4EBQH 1FHGA 2L0DA 3HCVB 4N8VB 5T3ZL 1G7LB 2A1WL 1ODAA 1NCAL 3BI9X 5DFVD 4P5TD 2ATKA 1NAMB 4MA8L 1UXSB 1VA9A 2NY7L 3H9HB 1KENL 1U8JA 5T3XH 3HNSH 1OGAE 1E6OH 2J7LA 4AYFA 1CI5A 2A83B 1VESA 5FHBH 1G7MB 5MP6H 4WRLA 1YA5A 3MOAH 3BPLB 1BIHA 4JFEE 4JZOB 2PETA 3QJHB 4Q9CA 4OD2A 5DD5L 4EN3A 3MRMA 4WENB 1JGDB 1KJ2A 1XF1A 1A3QA 4QY8A 5TPWH 1N0XL 1BX2B 1FIEA 4WWKD 4X4YB 5BS0E 4KRNA 3HR6A 1QRNA 4CAGA 3IDJB 1NMAL 1Z9MA 4JKLA 3MOBL 2WAHA 2OZ4H 5J3HC 2Z93B 4XNZB 3ARPA 2AXHA 4K7FA 4WHYH 2FGWH 3QXAB 1U0QA 4OZFA 4B5EA 1AKJD 2DIAA 2FO4B 4H0GA 5EA0H 4HSQA 5DFTA 4WNQB 1JWSA 2C1OA 3EO9H 4LGPB 4BA8A 5C0AE 3QXTA 4E42B 3C6LB 4Y8DC 4G7VL 3MRJB 1IM9D 1D9KC 4L8SA 4PLNC 4P2QD 1J0YA 5D8JH 5DFWH 1S78D 1CU4L 5EDXA 1KXVC 4M8QA 1H5BB 3SE3C 5J06A 3VRIB 3PNWA 1A5FH 4OQTA 2BERA 4NQSB 2EKJA 4KRPC 4ZS6D 2ZJSH 4MD0A 1AFVL 2WK2A 3NIFF 3V7AG 2RFXB 1U36A 3PL6C 2W60A 2IAND 4NWUL 2VLLA 3GMPB 4LPWA 4NNXB 4YDIH 5DVKA 3S3SA 2DWEA 1J0HA 1TETL 3CJJA 4TTDC 1PG7W 1FGVH 5HJ3A 4LQFL 3S4SA 3HC0B 4C54A 5HVWA 4KZEL 2V7HA 3BKYH 4QHUA 3VXRA 4I2XB 3F65A 1GGUA 2AJ3A 5KSBE 1TXKA 2P5EB 3C60D 4LRIC 5FA3B 2A6DA 3S3PA 4Y5YC 2AJXH 1CF8H 5IV2B 1J9CT 4KDWA 2Q8AL 4S2SB 4PP1C 1VGEL 2PXYD 3LQMA 3QEHB 4QYOB 4YHIA 3FAXA 5EOCH 4Z7WF 2NY2B 5E8PB 1U58B 4DGYH 3T1FA 4BQ8A 5F71A 4ODSL 4LCWD 5D70L 3KPQA 3FO2A 5DYOB 1UH4A 2CDGA 1WITA 1X44A 2OK0L 1HQ4B 1OWRM 1AO7D 1U8KB 1Q38A 4D0CA 3UEZA 5E8EA 3P4OB 4CVUA 1G7JB 3L1OH 4JKPL 2ZOLA 3TZVB 2HFGL 3TGXA 3DRTB 3CCHB 4NHCH 1J1PH 5A16B 1CGYA 2GSIB 2D7NA 5D2LF 1J10A 4KAQL 4L4TB 1IFHL 1KELH 3FT2B 1QSZA 1MJ7H 3PP4H 3UTSE 3OG6B 4G8GA 4OCWL 1T20A 3MZTA 2IAMD 4BUGA 3HZVA 1BZ7A 4R7NA 4K7PY 5CSBA 2QTEA 3K4AA 3QUXA 3RIFK 4KU1A 4LSQH 4XWOD 3BEWB 1C5BH 4NCC2 3X3FH 3DSFL 4ZTPH 3K2UH 3ARVA 4U1JA 4KGJA 1E6JL 3ULUD 3IDMB 3BP4B 3KS0J 1J1PL 4CN6A 3G5ZB 1MUJA 5IT2L 4JKPH 2R15A 5HDQL 1KCVH 4OGXL 4NN5C 3GSRA 5GGSY 4OLVH 3W5MA 5KG9A 2DQIL 1TVHB 2V5RA 1S8DB 4M6MH 5EZOL 5KTEH 3O9WB 1QD0A 1SY6L 1QHPA 5GQBA 5ITFA 3MFFA 6FABL 5DMGD 5MERB 2I07B 4R4ND 1LO4H 1YMHB 3V6OE 3KPSD 3W39B 1YN6B 4OFDA 4J8RB 5DLML 1NFIB 5KSUB 1U8HB 3PWVB 4ZNEA 1A7RL 4WCYL 4XPAL 1QSFA 3OX8A 1UKSA 1LO5B 2Q86A 1XF2B 3LN5B 1H0DA 2IH3B 2V5YA 4ZFOB 3C5SA 1CS6A 4EVNA 4BH8A 5E4IA 3MGOA 4D3CH 1Z0MA 5CCKH 4TVPE 1T4KB 4FABH 5IUSA 2VLMD 1PEWA 3WFEL 1MLCA 2G5RA 1KT2B 3D39E 2VR9A 5IB2A 3MLXH 1RZKH 3Q6FB 2V2WA 3VRJA 1E28A 1U8PB 2ZCLL 2OQJB 3TBYA 4XHJD 5DJ6A 3QEUA 5J0BA 1FAIH 2NLJA 2ZJSL 2CLVB 2W9LA 4X4XB 4QYOA 4QHNA 2V9RA 5AAMA 4GRLB 3O0RH 5FKPB 4S1DC 2UYLB 1BVKA 1Z0NA 5D2LE 1MFNA 3QDMD 1DBBH 4RBPK 3FB8A 4HIXH 3LRSA 3T0BA 2ITCA 1NC4D 3DX7B 2R2CA 4FG6D 3BD3A 3M17A 2WWMC 1CD1A 2NY6D 2DN7A 4IRJA 3RDTA 5J6HA 4OZGE 3X3GH 3V6ZB 5CJXA 1IGFL 1T2XA 1FO0B 5C0FB 1C12A 4S1SL 4JPWL 1J11A 4PJ9B 1LE5A 4YLQT 4OCXL 3X14A 3OJDB 2BVOA 2EXYD 4IOIB 4O4YL 1J1XH 4G43B 2ZCHH 3FAWA 3Q1SL 5TE4H 2IBZX 4NRXA 4GG6E 3VWKC 3Q3GB 5GGRY 1MVUB 1QLRB 3IDYB 4EI6B 1SEQL 1UB5B 1L6XA 4MJ5B 5MEOA 3RWJA 1A6WH 2I24N 2IPTH 1X5KA 2CRZA 4U33A 3RWJB 2QHLA 5FF6A 1AXSB 2YA1A 3BP5A 3PXJA 4M5ZH 1IKNA 4RGMC 5ACMA 4EQ2A 2JLLA 1KJMB 1R24B 2NY7H 4FA8A 5SX4H 4P0DA 2NY3D 3B2UD 4IMLB 5IGXL 2X1QA 3IF1B 3OAZH 4FQXC 1RZ7H 1OGTA 4FP8L 4RMSA 3B8SA 3JV5A 1KG0A 1QBLL 3ARDB 5LGJA 3WDIA 2D7QA 5DJZB 2ILLA 4GRMB 4OAWA 3HI6H 3A6CL 2J2ZA 5KANG 3IFLH 5DQDL 5DC4B 4Z5RA 1YNKH 4NKDA 4QCIB 4K07A 1GOHA 3AS3A 3LKRB 2DQDL 5C0RH 5L9DL 1FYTD 4D0BB 5EZIH 1Q0XH 4FFZL 4S0SD 3D3VB 5CWSB 2E3VA 1IC4L 5DHYB 3EAKA 1P7QB 3VXRD 5GGVH 3SO3C 3QUML 2A74A 3DOSA 1JZ8A 2P45B 4XGZB 4PGDB 4Y16B 3IDXH 3LIZL 4I2XA 2J3SA 2DD8L 3RY4A 1UC6A 3ISWA 5E94A 5FGCE 1OAXL 3D18B 3RX5A 5I1IL 1CGWA 4UV4H 3VGBA 3VFSB 3NZ8B 4XMPH 1JHLH 3HNTL 25C8H 1F4HA 1K8DA 1ZHNA 1DUYB 2CXKA 3HE7C 3TJHD 4X6DF 3SHSA 2HJKB 3CFKB 5D96B 4I4WB 1JGDA 3U9UB 4PJ8C 5M95B 4JY4A 5FV1L 1DBAL 4P2RB 1NGYB 3LS5H 2AI0L 2IFFH 4AG4H 4WWKC 4LCWB 1TPXC 4XPGL 1KLGB 2DQGL 2C7UA 1GH7A 5F89A 3ZKND 3F7QA 2LFGA 1JN6A 1NUFA 5JLZB 3JWDH 3VFOB 4WV1C 3MNZB 4HV8B 1UM6H 4K8RD 2X4PB 2XN9A 2AJSH 4UB0L 3O3UN 5B38A 3BO8A 3RGVD 4Y4FA 1B4JH 5MEOB 3RWGA 4L1DA 5I1LB 2WMPA 3WEXB 1VACB 4G6ML 3QUZC 4ERSL 3LQAC 4U49A 4PJEE 5IW1B 1MFEL 5F7MC 5TFSH 5DJYB 2B1HL 1EHNA 3CUPB 3EYQC 1G6RH 4M7KL 4TSCL 3VFWB 1OT1A 3NZHH 1GC1L 4MS8D 4IMKC 5FCSH 3CNKA 1MVFA 4X4YA 3H7LA 4ZS6C 1N6VA 3ZE1F 1KIUA 3FO9A 1MVUA 1QLRA 5T33L 4ZD3H 5I71B 1N2RA 1MRDL 2D0GA 2ZUXA 3BQUD 4LLYB 5E70A 3O8XC 4OF7A 5ESQA 3F58L 3IDMA 1JTPA 2I9LA 3DHMA 4WTXA 3QPXL 3UAJC 1DSFH 1NCUA 3ULVE 2IFGA 5KBNC 2CDFB 1F4WL 1U91B 1LGVA 4IHOA 4BJLA 1J0IA 1ZKAA 1B0WA 2CGRH 2F58L 1N5AB 3GHEL 4PRAA 2APBA 4X6DB 2NY5C 4HS3B 3ALXA 4G80B 4LLDB 1N3NA 2HJFB 2QQLH 2EYSA 4LRIA 5C0IB 4NJ9L 5CIPA 3KPMB 3QJFB 3BZFB 2FJFB 4K3DL 5AUMB 5EB9A 3A0OA 5E6IB 4ZUUA 5CJ8A 5CZVL 1P7KA 3FQUA 4XWGL 1MWAA 2GK0B 1G9EA 1SEBB 4P4KA 4D9QE 4XPGH 3LV3A 4GQ9H 3QDJA 4P99A 1DBAH 3L9RB 2MCG1 3D85D 5JUEH 5C07D 4FFVD 5L2JB 4D9LH 4XMLH 7FABH 3THMH 5F7WC 1RUAH 4OCLC 3W5NA 3WFHB 3V6OC 4IOSD 3MACL 3V52H 2DI7A 4HIJB 1JUFA 3VD4A 3PWJA 4HKBA 2XI9A 5LXGL 1FBIL 4HPOH 3CX5K 2CLVA 5EOTA 3REVA 2OR9L 4U1MA 1I3UA 4ODXB 5BRZA 2A0LD 2EH8H 1Q0XL 5CGTA 5FM5M 3VCLB 3NCBB 1RK1B 3CLEL 3HC3H 5I2IB 3B5HA 4ZXBB 5L0QB 5HVGB 2HG5A 3RNQB 5IB3A 5IW6A 3GO1H 1A22B 5DQDH 1F58H 1KC5H 3VFNA 5H8DA 3O4LD 1N7MH 3P0VL 3MXWL 1NDGA 3HS0A 1NLBH 3HI6L 5KS9A 3DNKA 4LIQE 4MX7B 4M48H 1EEYA 3SDDB 5DJAB 1IZKA 5HHMD 4JRYE 3NCEB 1QBLH 5DD3H 5DEGA 4EVNB 1ACYL 4F7PA 2EC9T 3TYGL 2EDEA 1SVCP 1RZFL 4PJ5D 1JNNL 2XTJC 1BMGA 2Y5EA 3L5XL 4RSVA 4F9PC 4P5TC 5IGXH 1UM5H 3L5HA 2DQHH 1MFDL 2ERJC 3RVUD 5FOBB 5JHDE 3VI4F 3MNVA 3GNMH 4A2LA 5GSVA 4M5ZL 1YEHL 4Y4KD 3LB6D 4YC2B 5HHOA 3QFJB 4DW2H 1TZIB 1NBVH 5INDA 2R0KH 1LO3H 2IMNA 2WIIB 3NAAL 4NM8H 4DGIL 2P8PA 4X6CE 3K2MC 2X4NA 3M8OL 4U6TA 1T7YA 4WY7H 1FPTL 2WQ8A 1Q94A 2OR8A 5T1MA 4JZJB 4HUVB 3ROOB 2BNQA 4OKVB 5ETUA 3TN0B 1P4BH 2R0ZH 4HAFA 5SWQB 2BSED 3BOVA 5KJRL 3G9VA 2P8LA 4S1SH 4POUB 5KW9H 1LO2H 4NO2B 2YK1H 1IGFH 4WFEE 1R3KB 2B7DT 1C8PA 5A43C 2VQUA 4S0TD 3VMPA 1GGIH 4JQIL 4FQJL 2IF7A 1ZT7A 4CNIB 1UZ8A 1TIUA 3FRPG 5GRXG 3KLDA 3P0YL 4BELD 5HVHC 4HIXL 2A77H 4N8CH 1ZGLA 1G6VK 4G6FB 3EOBB 4O9HH 1JNHB 1KULA 1EEZA 1X5GA 3FRUA 4X0KA 4HXAH 1KCLA 5D1XD 5JORA 3DMMC 1QFUH 4MYWB 4JM2B 2OJEB 1Q9KB 5TQ2L 3VFRA 1BPVA 1FL5A 3OR6A 4L3ED 3PGFH 1A6UH 5EBLB 1Q0YL 1OQXA 1A6VH 1S7RA 2X6MA 1BAFH 1F2XK 3MLXL 4NZRL 4U31A 3QEQD 3G6AA 5DK3A 4KKAC 1UXWA 4FABL 3PQYB 5KJRH 3AM8C 1XIWA 4D3CL 5A40E 5I16B 2Q1EA 3TT3L 5IB2B 4N0CD 4GUPB 3NAAH 4NM8L 5DTFA 3VWKD 5ICYB 4LEOA 3B3IB 4WGWB 3S34H 3ARGC 3QIBD 3LHPH 3EFFB 1YEDB 5IVXF 4PREB 3EGSA 4O00A 5C1MB 3GNML 2KQNA 2F5BH 5IBTL 3VD7A 1T80A 3CU7A 4PJ7F 1MFDH 1AJ7H 1D3CA 3KPOA 1CIDA 4P2YA 3TNNA 5SWQA 1UM5L 3UPAA 2ZUUA 4HIIA 1MELA 4WHTA 1ZGLM 3RX7A 4YXLL 5DZNA 2BNRA 5EU3B 2YXMA 5IVXA 1ACYH 3OXSA 1WVZA 3V95A 3S3JA 4N5ED 4YGAB 1I9JH 1UKQA 4N1EA 4MWFA 4UINL 4NO5B 1KCVL 1S9YB 1U3HB 3MXWH 5JR1L 1TCMA 1IC7H 1ZA3B 1I1RA 1RFDH 1A3LL 1G7MA 3OKOA 3SDYL 4HULB 3BQUB 2CLZA 2V2TA 1KJ2H 3X3FL 3GSUB 1OT2A 3DO7B 1C5BL 2JCCE 4QWWC 5HHPA 3LQZA 2AK4E 5DS8A 1RZJH 4WW2F 1U58A 2BVOB 2X7LB 4PB9L 2H26B 2FBJL 5F44A 4GXUM 3RGHA 2DOCA 3PP4L 4OV5B 6CGTA 5HHVL 3QPQC 3QDJB 4KRLB 3QSKB 4L3EA 3NIGE 1RZ8B 3V52L 1PFCA 2MQCA 4NUGH 1V3LA 2X4TB 4P59H 1RUAL 3HE7D 4UDTA 4LLMB 2OSLB 2VTFA 2GY5A 4PTTB 1PVHA 2JJTC 1F3JA 1AGBA 2GSIA 5DK2B 1IEAB 1NGWA 4OZHF 2WUBL 4XWGH 4PJIA 1IC5L 2RB8A 1V3MA 4GAFB 3MBEA 3BKJH 3VXNA 3STZA 4DGYL 1KCSL 1H5BA 2B4CH 4XBPA 3G5XA 3LAFA 4O5LH 4S1RH 5I15H 3PDOB 3RGVC 3P3YA 1S9WB 3EO0B 4MB3A 1INDH 4NSKB 4X8JB 4ZSOA 4RX4A 1B90A 3FT3A 3QRFM 4QTHB 4LK4A 4PRBB 1J7VR 4DN3L 3MLSH 4Y4FC 2AGJH 1F11B 4KHTH 3MSPA 3GMQA 4BQCA 2OX5A 4PJDF 3PWPE 5F1NA 1MCHA 4G7YH 1QSEB 1XT5A 4QGTA 4QO1A 1K5NB 1M7IA 4PRPE 3QP3A 2IPUK 4B50A 1W72B 3VXMD 3DETD 5K9KA 3GGWB 5D1XA 3BZFA 2G9HB 4KKCC 5E5MA 4LOUD 4UIMB 2DQEH 5EZJB 3WS3B 4PY8J 3RJQB 2X44D 3S88H 2QSCL 4BK4A 4ZUTA 2H26A 1BIIB 3E8UH 4NOBA 3LEYL 4OD3L 1EX0A 3TF7C 1OP9A 4PGCA 1U8QA 3SDXF 1NCBL 5EUOB 4R8WH 1A14H 3H3PL 1AD0A 2ADFH 4FG6C 2R4SL 4PRPD 4U0RB 4JN1L 3U4AA 3PWJB 5ALBH 1ORSB 1ND0A 1HXMB 3E2HC 1WQVT 2AJSL 3GBNL 5TDPA 5C9JB 2NPLX 5BRZD 1PLGL 1OAZL 3HAEA 3KPTA 4N90D 3UPRA 1MI5B 2BY1A 4XP5L 2EDBA 5DK2A 3V8OA 4CMHC 4LDOB 1NDMB 3NH7H 2DKUA 3LKPB 3DYMA 4OTXH 2D7MA 2ADJB 1BQLL 3AAZB 3O3BA 5KOVC 2AI0H 3LV3B 1HIML 1N0XH 4M1CC 3QT2A 1QFPA 1NCCH 4L8CA 4EDXA 5C0CD 1HN1A 2HT3D 5TDNB 5C0DA 3KYNB 4EDXB 1S9XB 4Y88A 5DD5H 3GJEA 3V5HB 4JHAL 4KUZH 2CLRA 3TLRA 4GG8A 5E08H 4K55A 5CILL 3S5LG 3KPSE 3MV9A 2E7BA 3Q6GL 4Z7VF 4IS6A 4L3EE 3P73A 4ONOA 5EPMA 1IM3A 3BHBB 1BLNA 1CFVH 4HGKC 5LWYH 3SCMB 1PYWA 2UZYB 3X17A 1U95A 2J6EA 1MWAL 4YHZL 2A1WH 4M7LL 3CXHJ 5KN5A 2KBGA 1IC4H 3ARFC 5IWLA 1ETZB 1AGDA 2DM7A 1C1EL 1CLZL 4YDJA 1AP2A 3AM8A 1FNLA 4FZ8L 1CTOA 3IVKB 2OCFD 3WNNA 5IVZB 1YNKL 2VLKE 1WBYA 5MENE 4Y5YA 3KPMA 2LE9A 5ID0B 4V2CB 3KPNA 1KB5H 4P4RB 3KPNB 1TMCB 1FNFA 3MRPB 2C3WA 2OL3H 3J7HA 5F7YC 1HWHB 3VXUA 5IHBA 1HHJA 4I0PA 4Z77A 5F3BA 3SQOL 1I1FB 3BAEL 2NTFA 3RA7L 5ISZD 2B0SL 4GMTL 3D6GA 3RVXC 3B5TA 2V5MA 5JQHC 1ZS8A 2F53D 1XR8A 3JTTA 5T1KA 3HE6B 2APXA 3D85A 2R2BB 3GSOB 2OTPA 1HKFA 2Q7YB 3NPSC 1MF2L 3QIUA 4HKJA 4MQ7A 3RIAK 4QCIA 1NGWB 1WCQA 4I5BA 4OZIF 2EDOA 1UACL 5EZLA 4MVBC 4O4YH 4IRSC 1JWMB 4KPHL 4KQ3H 3WLBA 1RIUH 3ARTA 1YEGH 2NY3B 5BCAA 4NQXB 3VWJB 4R97C 3FN0L 1X7QB 2BNUB 3R06A 4OZHE 3GSNB 1FZKA 4FQPA 4W4OC 2Q6WB 1HXYA 1C16B 1I3GH 3EZ8A 2E9BA 4R90H 3K7UA 1DFBH 3RQ3A 2HFFA 2LVCA 3O41B 1JGVH 3W2DL 4UTBL 4X7EC 1RIUL 2BMKA 4DOHE 3W0WE 1E0OB 3IXAA 3MV8B 3UTZA 1U8OA 4I0KA 4OZGA 5F9DC 1YEKH 3WJLC 3U0TB 4DEPB 3BGMA 4TQEH 3H9ZA 1AD9B 3ARBD 3DO7A 4UQ3A 3O0RL 5B4MC 1BQSA 2VDKL 2NY0C 2ZSWA 3NFNB 5CS7A 5HPMB 5JPMA 4GMTH 3SDXA 3SGKC 4G8GE 3SQOH 4XTRC 5DWUH 5TH2A 3QUXB 4HS8H 3VFNB 1FO0H 4YHYB 1WZKA 3L5WB 4I77L 1LP9B 3HZYB 3OV6A 1A6ZB 5B38B 4M7JL 4PJFB 1MY5A 2OL3L 1BF8A 3DUHA 3IU3B 1MJ8L 4FQIH 5C08B 1GCFA 1JGUH 4XP6L 4XPHL 2WNGA 3MRCB 3CVIL 3EYUH 3M1BA 4WFGD 4XCNA 3VFUB 4A6YH 4MJ6A 1XGPA 2I27N 3VD3A 4I0PB 1CXKA 1JK8A 3PGCA 1M05B 1FYTA 4KK6D 3LDBC 1VPOH 2Z31B 5K9OB 1IVLA 4NKMB 4L9LA 4YHMH 3WO4B 3CFCH 5A3ID 1OAQH 3MA9H 4NQDA 4PJGB 3RI5K 2X4SA 1M6OB 2GSGB 4WCYH 1NGZA 3CVHH 2HKFH 1A7RH 2R9HC 4MQXD 3OAUL 2H9GA 1DQDL 5C07E 2WLZA 2P49B 4XVTL 4AH2A 1D5XA 1KJVA 2CMRL 2V9QA 3NFPA 5FDWB 5H2BB 1V7NL 2Y7QA 4K3EL 1S9WA 4QXTA 3EOYG 3P11L 5J11B 4CVWA 3Q6FA 5HI5D 5I18H 5FKAA 5ISZE 4KV5F 1KEML 2ZSVA 4KUZL 4PLKC 5HGBA 3EFDL 2W59A 4XP9L 3WJJC 2OI9B 2BY3A 4OCNC 4JGMA 3WNPA 5I76A 2COQA 4N5UA 4OZIE 2OJEA 2DBLL 2NCMA 5T5NG 1HIMH 5B8CA 4F7CA 4IEFB 3RTQB 1K3ZA 4DUWA 3V5KB 4HC1H 5JW3H 4LSQL 1AE6L 1P2CB 4UV7L 3DBXB 4LRNL 4JFFA 1S8DA 2XWJA 2GW5A 3MRDA 3LRSB 3BZDA 3V0VB 2A0LC 4KWUA 2R56L 4QOKD 4ZUWA 3DXAE 4LCCB 1MCFA 3EKCA 2VDML 3LZFH 3P9WB 3L3KA 3BZ4B 3FB7A 4J6RL 1QRKA 1UB6B 5C0BD 3W0WD 4KAQH 1KN4H 2Y6SD 3QDGE 4G6JH 4HIIB 4Z7QF 1FNHA 2BNQE 2IPKB 2E7LA 1KIRB 1CVSC 2C1PA 3QR2A 5LQBH 3S88L 2CQVA 3RWEB 3O41A 5GZND 1UA6L 5C7XH 4NKOB 3U30C 1LK3L 3O8XA 1OCWH 2NY1D 2YUVA 4M7ZC 2DQEL 3TO4B 2OK0H 1E28B 1ZHLB 5DMKB 5KVFL 3DTXB 2CRIA 3UZVB 1SYVB 3C6LA 3CLFL 3C09C 5BO1L 2FATL 5GSRB 4PJIB 4KDTC 1FL3A 1TENA 4R7DA 2NNAB 5ICXB 3CDFA 1Q72L 4DGVH 3BWUC 2VDRL 2LAAA 3VD5A 1QOKA 4JFPA 4HS6B 4LVOB 4DN3H 2RCSH 3VXSD 4PBWD 1KPUA 2M2DA 4M9OA 4MNQE 4IBLT 2UZIL 3OXRA 1P4LA 1J8HE 5JHLL 3UZQA 4RGOL 5E8EB 4NQTA 5EFIB 1P1ZB 4MXQC 3VXRE 4WVRA 4JO2L 1TITA 3RPIA 5FOJA 1TETH 2A6KB 2VL4A 4F7TB 5FOBA 2VIRA 4DCQA 1MRFL 1IC5H 3TPUB 5GZOC 3QRGL 2WUBH 5A1AA 3BGMB 4XRCA 4Z76A 4Y1AE 3P77A 3OKKA 1NAML 3V4UL 3LN4B 1RUQL 1P2CA 3PHQA 1A5FL 2VAAB 3WFBH 4ZFZB 4P2OA 5HGHB 1CU4H 3KLHC 4KH2A 4DQOH 1Q1JH 1SY6A 1YMMB 4L4VD 2VC2H 3L7FB 2J8HA 1UG9A 3M07A 3VXMB 4KROB 5I75B 2VXTH 5FGBA 5C8JB 4XPFL 5CWSA 2Z8WC 5HHVH 3ZYZA 5TH2B 2IBBA 5I30L 4X83A 2FZ3A 4LAQL 4JFDB 1QTYT 1SJVA 4G3YH 2SEBB 1FV1B 3ZDYE 3WSQL 3V4PH 1CDCA 2FJHA 4OV6F 1FG2B 1F6AA 4G5ZL 1MUJB 2FGWL 3B6SA 3GFUA 4CNIA 3SY0B 3STLB 4UIKL 3D9AL 1KV3A 1NBYB 3T0AA 3SDYH 5C86A 4JY6A 3TVMD 4PLJD 4LMQE 1KCUH 4O2EB 4OFPA 3WIFA 4M3KB 1MFAH 1URLA 3U9UA 5J13B 5L8LB 4ZYKB 4UQ3B 1I9JL 2VQ1A 2DQTH 5AZ2H 1AQKL 2YPLA 5A2FA 4LSPL 4QKXB 3KLAB 3JBG7 5FYKH 2LVEA 2Q6WA 5E6YA 3C6LD 5IM7B 4PGDA 2FD6H 1E6OL 1YPZE 5D93B 4LKXA 3ARZA 3DURB 1SBSL 1FFOA 3I2CH 5J1AA 5TGBB 2FO4A 4X5XB 2JB5L 4Z7WA 2AEPL 4UOJA 5L2KB 1E4XH 1J88A 4XNXL 1L7TL 3IDUA 3DX8A 1JPFA 2ATPB 4GS7B 3LPGA 3MRMB 4DKEL 1LVEA 3O11A 2X05A 4JZNA 3SDCB 4F57H 3KXFB 4NQCB 4P3CL 1UKTA 1IT9H 1C7TA 1I1YA 4WO4C 3KPPB 4MQ7B 3MREA 4MAYD 1JN6B 4S1QH 4G8IB 4F7MB 1UJ3B 3MUHL 2XFXA 3B9VA 5FV2A 4X9IA 4AT6B 1KPVB 5A2JH 2J4WL 3FT4B 1IM9B 3KHQA 2WUCH 4Y19A 2RFXA 4LLVA 3QEQB 4JG1H 2FIRT 3I3DA 3U1SH 1U6AH 1UCBH 3CFJA 1I7UA 1A6UL 3PGFL 3O3AB 1J8HA 5JZ7D 1IAIM 2P8LB 4XVUC 5ABDE 3U48A 1P7HL 1A3RH 1NL0L 5EU6D 4B0MM 3HUJE 4JPVH 1ZVHA 3HI1A 4KKLC 1ETZA 2X4SB 2OQJA 1WFTA 3QNXA 3TBYB 1J18A 1YQVL 2A77L 4N8CL 4TVPD 1MIMH 3NCJH 4MD0B 2EYSB 3TCLB 4OLEA 3Q48A 1DQLL 1FO0A 5C0FA 5D7LE 3GBLA 3O4LB 3U0PA 1JV5A 3JTSA 4M43H 4RNRB 5D6DA 3JTSB 4RNRA 3BFOA 2YK1L 4H5SB 4N0UB 5F3BB 4PJGF 2WINB 1NQBA 2VUYA 1DEDA 4MX7A 5F7LB 4CADA 3T3PF 3C6SB 3MRGB 3BKML 4Q2ZA 4YXKH 5KSBA 1TJIL 3PWLB 3VRIA 4NC1C 1DR9A 1T04A 4X5XA 4Z7WB 1WIOA 1F4AA 2Z0BA 1YEJL 4X6FA 1K4DA 2DB8A 1NBVL 4CDHA 3OR7B 1JGLL 5CAYB 3QEGH 1MRCL 3V5DB 3O6FA 1YEHH 4GSDH 2IG2L 2MPAH 1IGIL 5GS0L 3FFCB 1ZANH 5SX5H 4GBXC 1NGXB 2HLAB 5CSZB 4HAGA 2JTDA 4KKBC 4TOYH 3N1FC 2GJ6D 1R5WA 4PRIA 1AGEB 3D69A 5F7FA 1IM9A 2DJ4A 3AVEA 3L7EA 5JW4R 2RBLA 1YN7B 3WIHL 4X8JA 3AY4A 4ZFGH 1DUYA 3FHAA 1OB1B 5GIRA 1EJOH 4GKZB 3GO1L 1A6PA 3KLSA 4ZFFB 2DQFB 1DQML 2RJMA 3TH2T 1BJMA 4I3RL 5SWSD 4XGZA 2NTSP 1D5BA 2EH8L 5EBMB 5I9QC 3CMOH 2OMNA 5HHNB 3GIZL 2EIDA 4QF1A 3CFBA 4HPOL 1NBQA 3H3BC 2E9WA 2X9WA 4O2EA 5E4EB 3O9WC 5K9KB 4NFCA 1P53A 3ES6B 3FO1A 3P77B 1XR9A 1CT8A 4NBZB 3N1PC 4P2OB 5GRJL 3BO8B 2EIZA 1F4XL 3CFDB 4P5KB 4X8XA 3DWTA 3IS0X 5CLTA 4EN3C 1HYSD 3GSRB 1JHKH 3CK0L 1QSED 5E8NA 3CH1A 4QRRD 2HVJB 4H0HB 5TE6H 5CSGA 1U8QB 3S6CA 5C2BH 2UUDH 5GRJH 1EHLH 1BQHG 1G7HB 1KFAH 3ULSB 5ALCH 3IXTB 3KDMA 4R7NB 1CXFA 1TFHA 2PNDA 2Q3AA 1EFXB 2F54B 4K3DH 3B4NA 4DZBA 3IAGC 1MFBL 5F8RC 4C56E 5E6ZA 1DLHA 3QZWA 4P9ML 5LGKA 5HY9A 5ANMB 2QV2A 4BUHA 3AU1B 4RFEB 3MRQB 2QQLL 1CDGA 1A4KA 3VE0B 3BVNB 3V5DA 3UBXB 1LO0H 4KROD 2N7BA 2XZAH 3EOBA 2AXFB 2PW1A 4R7DB 3IAPA 2YD4A 4BSVA 3U4EA 1NCTA 1RURH 2IANE 5F9WB 1I4FB 5I8KL 1FZJB 2Y6SC 3TV3L 3GHEH 5ESVA 2UYLA 2G75A 3BH9A 4ZFGL 3HG1A 4KV5E 2VXSH 1G1YA 3KPOB 5I0DA 5JXEA 2Y07H 3W9DA 3IETB 1NLDL 4GRLD 5H94B 5K59F 2ZUSA 4X6DA 1IC1A 2Q87A 1Q9WB 5C0NC 3PP3H 4DFHA 4ZD3L 5T33H 1U3HD 5K9QG 4JQVA 4HJJL 4NQEA 1IAOB 1ZANL 1UWXK 3DJ9A 3MLTA 3FFCE 5C0CB 4U6YB 5CGYC 1U3HA 3U36B 3B9KB 1MRCH 4OGAC 3HZKB 1C5DB 5C3TA 2MQ3A 2QQKH 5IFHL 1OW0C 5BJTA 1A1OA 2R0LL 1XGUA 5E8OB 4GAJL 5TFSL 2XRAH 2AJ3B 4UBDC 2EDDA 2HVKA 1R3JB 4KK8D 1OTTD 2HT2D 1J1OL 3DYPA 4YFDB 1FLRH 2ZG2A 1LDSA 3QUYD 5T3ZE 5JIPA 4HH9A 4U05A 5BQ7A 2AV7B 2VZUA 1F90L 2H32H 3D48R 2WWKO 1HH9A 3BIKB 4RFNC 4AG4L 4NQSA 5F9OH 3NCJL 3LS5L 4XRCB 5EIQA 4ZXBA 4NQCA 1S7XA 3PL6A 1IQDB 2N56A 2NYYC 3OTTA 3HAEH 5DHVB 4YHOL 1E27A 2ZOKB 3WFZA 3QIWC 3QNZB 2DJUA 3QO0B 3ARDC 3VU2A 3ARRA 5FYJU 3PP3K 4UV4L 4YHKL 3S4SB 3HUJB 1I8LA 1FL3B 3PDDA 4KZDL 3KJ6L 3QDJD 2ZOLB 5L7XH 5CEZD