2A00A

The solution structure of the amp-pnp bound nucleotide binding domain of kdpb
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
136
structure length
136
Chain Sequence
b'NRQASEFIPAQGVDEKTLADAAQLASLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVDAIRRHVEANGGHFPTDVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium-transporting ATPase B chain
publication title The Holo-form of the Nucleotide Binding Domain of the KdpFABC Complex from Escherichia coli Reveals a New Binding Mode
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 32
structure length 136
sequence length 136
ec nomenclature ec 7.2.2.6: P-type K(+) transporter.
pdb deposition date 2005-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2a00A00
3GWIA 5AW1A 5AW9A 2ZBGA 1T5TA 3KDPA 3AR7A 2DQSA 3FGOA 4XOUA 2OA0A 4UU0A 4NABA 3RFUA 5AW3A 4KYTA 5AVUA 4J2TA 5AVYA 3AR8A 3AR2A 1WPGA 4RESA 1U7QA 3W5CA 4BEVA 5AVRA 3N8GA 4YCLA 5AW4A 2AGVA 1MO7A 2YJ6A 3B9RA 2IYEA 2ZBDA 5AVWA 5AW6A 5AVTA 4BYGA 1XP5A 2ZBFA 3NANA 3BA6A 2ZBEA 5AVVA 3AR5A 5A3QA 3AR3A 5AVSA 2KMVA 1VFPA 2EAUA 1IWOA 3A3YA 1SU4A 3SKYA 2C9MA 3B8EA 3WGUA 4UMVA 2YJ4A 1SVJA 5AW2A 2EARA 3N5KA 4RETA 5AW0A 5AW8A 2KMXA 3W5BA 4YCNA 2YJ3A 5A3RA 3A1CA 3SKXA 3WGVA 5AVQA 2EATA 5AW7A 4YCMA 3AR9A 3FPBA 2ARFA 2YFYA 2O9JA 4HYTA 3AR4A 5AVXA 3AR6A 4Y3UA 2C8LA 3W5DA 4BEWA 3NALA 4XE5A 5AW5A 2YJ5A 2ZXEA 3A1DA 2B8EA 3A1EA 1Q3IA 4BBJA 2C8KA 3FPSA 2A29A 5AVZA 3B9BA 3W5AA 3J7TA 2C88A 1MO8A 3NAMA 5A3SA 2BY4A 1T5SA 3TLMA 2A00A 4H1WA 4UU1A
chains in the Genus database with same CATH superfamily
3GWIA 5AW1A 5AW9A 2ZBGA 1T5TA 3KDPA 3AR7A 2DQSA 3FGOA 4XOUA 2OA0A 4UU0A 4NABA 3RFUA 5AW3A 4KYTA 5AVUA 4J2TA 5AVYA 3AR8A 3AR2A 1WPGA 4RESA 1U7QA 3W5CA 4BEVA 5AVRA 3N8GA 4YCLA 5AW4A 2AGVA 1MO7A 2YJ6A 3B9RA 2IYEA 2ZBDA 5AVWA 5AW6A 5AVTA 4BYGA 1XP5A 2ZBFA 3NANA 3BA6A 2ZBEA 5AVVA 3AR5A 5A3QA 3AR3A 5AVSA 2KMVA 1VFPA 2EAUA 1IWOA 3A3YA 1SU4A 3SKYA 2C9MA 3B8EA 3WGUA 4UMVA 2YJ4A 1SVJA 5AW2A 2EARA 3N5KA 4RETA 5AW0A 5AW8A 2KMXA 3W5BA 4YCNA 2YJ3A 5A3RA 3A1CA 3SKXA 3WGVA 5AVQA 2EATA 5AW7A 4YCMA 3AR9A 3FPBA 2ARFA 2YFYA 2O9JA 4HYTA 3AR4A 5AVXA 3AR6A 4Y3UA 2C8LA 3W5DA 4BEWA 3NALA 4XE5A 5AW5A 2YJ5A 2ZXEA 3A1DA 2B8EA 3A1EA 1Q3IA 4BBJA 2C8KA 3FPSA 2A29A 5AVZA 3B9BA 3W5AA 3J7TA 2C88A 1MO8A 3NAMA 5A3SA 2BY4A 1T5SA 3TLMA 2A00A 4H1WA 4UU1A
chains in the Genus database with same CATH topology
3GWIA 5AW1A 5AW9A 2ZBGA 1T5TA 3KDPA 3AR7A 2DQSA 3FGOA 4XOUA 2OA0A 4UU0A 4NABA 3RFUA 5AW3A 4KYTA 5AVUA 4J2TA 5AVYA 3AR8A 3AR2A 1WPGA 4RESA 1U7QA 3W5CA 4BEVA 5AVRA 3N8GA 4YCLA 5AW4A 2AGVA 1MO7A 2YJ6A 3B9RA 2IYEA 2ZBDA 5AVWA 5AW6A 5AVTA 4BYGA 1XP5A 2ZBFA 3NANA 3BA6A 2ZBEA 5AVVA 3AR5A 5A3QA 3AR3A 5AVSA 2KMVA 1VFPA 2EAUA 1IWOA 3A3YA 1SU4A 3SKYA 2C9MA 3B8EA 3WGUA 4UMVA 2YJ4A 1SVJA 5AW2A 2EARA 3N5KA 4RETA 5AW0A 5AW8A 2KMXA 3W5BA 4YCNA 2YJ3A 5A3RA 3A1CA 3SKXA 3WGVA 5AVQA 2EATA 5AW7A 4YCMA 3AR9A 3FPBA 2ARFA 2YFYA 2O9JA 4HYTA 3AR4A 5AVXA 3AR6A 4Y3UA 2C8LA 3W5DA 4BEWA 3NALA 4XE5A 5AW5A 2YJ5A 2ZXEA 3A1DA 2B8EA 3A1EA 1Q3IA 4BBJA 2C8KA 3FPSA 2A29A 5AVZA 3B9BA 3W5AA 3J7TA 2C88A 1MO8A 3NAMA 5A3SA 2BY4A 1T5SA 3TLMA 2A00A 4H1WA 4UU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWI A;  5AW1 A;  5AW9 A;  2ZBG A;  1T5T A;  3KDP A;  3AR7 A;  2DQS A;  3FGO A;  4XOU A;  2OA0 A;  4UU0 A;  4NAB A;  3RFU A;  5AW3 A;  4KYT A;  5AVU A;  4J2T A;  5AVY A;  3AR8 A;  3AR2 A;  1WPG A;  4RES A;  1U7Q A;  3W5C A;  4BEV A;  5AVR A;  3N8G A;  4YCL A;  5AW4 A;  2AGV A;  1MO7 A;  2YJ6 A;  3B9R A;  2IYE A;  2ZBD A;  5AVW A;  5AW6 A;  5AVT A;  4BYG A;  1XP5 A;  2ZBF A;  3NAN A;  3BA6 A;  2ZBE A;  5AVV A;  3AR5 A;  5A3Q A;  3AR3 A;  5AVS A;  2KMV A;  1VFP A;  2EAU A;  1IWO A;  3A3Y A;  1SU4 A;  3SKY A;  2C9M A;  3B8E A;  3WGU A;  4UMV A;  2YJ4 A;  1SVJ A;  5AW2 A;  2EAR A;  3N5K A;  4RET A;  5AW0 A;  5AW8 A;  2KMX A;  3W5B A;  4YCN A;  2YJ3 A;  5A3R A;  3A1C A;  3SKX A;  3WGV A;  5AVQ A;  2EAT A;  5AW7 A;  4YCM A;  3AR9 A;  3FPB A;  2ARF A;  2YFY A;  2O9J A;  4HYT A;  3AR4 A;  5AVX A;  3AR6 A;  4Y3U A;  2C8L A;  3W5D A;  4BEW A;  3NAL A;  4XE5 A;  5AW5 A;  2YJ5 A;  2ZXE A;  3A1D A;  2B8E A;  3A1E A;  1Q3I A;  4BBJ A;  2C8K A;  3FPS A;  2A29 A;  5AVZ A;  3B9B A;  3W5A A;  3J7T A;  2C88 A;  1MO8 A;  3NAM A;  5A3S A;  2BY4 A;  1T5S A;  3TLM A;  2A00 A;  4H1W A;  4UU1 A; 
#chains in the Genus database with same CATH topology
 3GWI A;  5AW1 A;  5AW9 A;  2ZBG A;  1T5T A;  3KDP A;  3AR7 A;  2DQS A;  3FGO A;  4XOU A;  2OA0 A;  4UU0 A;  4NAB A;  3RFU A;  5AW3 A;  4KYT A;  5AVU A;  4J2T A;  5AVY A;  3AR8 A;  3AR2 A;  1WPG A;  4RES A;  1U7Q A;  3W5C A;  4BEV A;  5AVR A;  3N8G A;  4YCL A;  5AW4 A;  2AGV A;  1MO7 A;  2YJ6 A;  3B9R A;  2IYE A;  2ZBD A;  5AVW A;  5AW6 A;  5AVT A;  4BYG A;  1XP5 A;  2ZBF A;  3NAN A;  3BA6 A;  2ZBE A;  5AVV A;  3AR5 A;  5A3Q A;  3AR3 A;  5AVS A;  2KMV A;  1VFP A;  2EAU A;  1IWO A;  3A3Y A;  1SU4 A;  3SKY A;  2C9M A;  3B8E A;  3WGU A;  4UMV A;  2YJ4 A;  1SVJ A;  5AW2 A;  2EAR A;  3N5K A;  4RET A;  5AW0 A;  5AW8 A;  2KMX A;  3W5B A;  4YCN A;  2YJ3 A;  5A3R A;  3A1C A;  3SKX A;  3WGV A;  5AVQ A;  2EAT A;  5AW7 A;  4YCM A;  3AR9 A;  3FPB A;  2ARF A;  2YFY A;  2O9J A;  4HYT A;  3AR4 A;  5AVX A;  3AR6 A;  4Y3U A;  2C8L A;  3W5D A;  4BEW A;  3NAL A;  4XE5 A;  5AW5 A;  2YJ5 A;  2ZXE A;  3A1D A;  2B8E A;  3A1E A;  1Q3I A;  4BBJ A;  2C8K A;  3FPS A;  2A29 A;  5AVZ A;  3B9B A;  3W5A A;  3J7T A;  2C88 A;  1MO8 A;  3NAM A;  5A3S A;  2BY4 A;  1T5S A;  3TLM A;  2A00 A;  4H1W A;  4UU1 A; 
#chains in the Genus database with same CATH homology
 3GWI A;  5AW1 A;  5AW9 A;  2ZBG A;  1T5T A;  3KDP A;  3AR7 A;  2DQS A;  3FGO A;  4XOU A;  2OA0 A;  4UU0 A;  4NAB A;  3RFU A;  5AW3 A;  4KYT A;  5AVU A;  4J2T A;  5AVY A;  3AR8 A;  3AR2 A;  1WPG A;  4RES A;  1U7Q A;  3W5C A;  4BEV A;  5AVR A;  3N8G A;  4YCL A;  5AW4 A;  2AGV A;  1MO7 A;  2YJ6 A;  3B9R A;  2IYE A;  2ZBD A;  5AVW A;  5AW6 A;  5AVT A;  4BYG A;  1XP5 A;  2ZBF A;  3NAN A;  3BA6 A;  2ZBE A;  5AVV A;  3AR5 A;  5A3Q A;  3AR3 A;  5AVS A;  2KMV A;  1VFP A;  2EAU A;  1IWO A;  3A3Y A;  1SU4 A;  3SKY A;  2C9M A;  3B8E A;  3WGU A;  4UMV A;  2YJ4 A;  1SVJ A;  5AW2 A;  2EAR A;  3N5K A;  4RET A;  5AW0 A;  5AW8 A;  2KMX A;  3W5B A;  4YCN A;  2YJ3 A;  5A3R A;  3A1C A;  3SKX A;  3WGV A;  5AVQ A;  2EAT A;  5AW7 A;  4YCM A;  3AR9 A;  3FPB A;  2ARF A;  2YFY A;  2O9J A;  4HYT A;  3AR4 A;  5AVX A;  3AR6 A;  4Y3U A;  2C8L A;  3W5D A;  4BEW A;  3NAL A;  4XE5 A;  5AW5 A;  2YJ5 A;  2ZXE A;  3A1D A;  2B8E A;  3A1E A;  1Q3I A;  4BBJ A;  2C8K A;  3FPS A;  2A29 A;  5AVZ A;  3B9B A;  3W5A A;  3J7T A;  2C88 A;  1MO8 A;  3NAM A;  5A3S A;  2BY4 A;  1T5S A;  3TLM A;  2A00 A;  4H1W A;  4UU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...