2A06E

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 52
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 2a06E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2a06E02
2XSOA 1RIEA 4AIVA 3L71E 2NVGA 5AEWA 1PP9E 4AAYB 2FYNC 4HM8A 2XRXA 4H44D 3H1HE 3L75E 2FYUE 1NTZE 1WQLA 3DQYA 4HM7A 3CWBE 4QDFA 3H1KE 1ZRTE 3GOBA 4HM0A 5BOKA 4EMJB 2BMQA 1PPJE 1L0LE 1BE3E 1BCCE 4H0LD 1NDOA 3GB4A 1VF5D 4QDDA 3GKEA 2QJYC 2DE7D 3FOUA 2YIUC 1O7MA 2JZAA 2E76D 3CX5E 4NB8D 4HM5A 2HMJA 1EZVE 4NBHD 5CXMA 3VCAA 1NTKE 3C0DA 1JM1A 2BMRA 1KYOE 1RFSA 3CXHE 2IBZE 1EG9A 1SJGA 3D89A 5KLIC 3GTSA 4HM3A 2D2CD 5KLVE 2HMMA 4NBDD 2A06E 4HKVA 2GBXA 2DE5D 2GBWA 2YFIA 1L0NE 4HM1A 4PD4E 1O7WA 2BCCE 4D6TE 2BMOA 3H1JE 2JO6A 2YFJA 4HJLA 4P1BH 1NYKA 4PV1D 1Q90C 1UUWA 4U3FE 1FQTA 3L74E 2QJPC 3H1LE 2E74D 2Q3WA 1G8KB 3L73E 1BGYE 1SQBE 1O7GA 4HM6A 1O7PA 3VMGD 5KKZC 3L72E 1UUVA 2ZYLA 1ULJA 2YFLA 4H13D 4P1CH 1O7HA 1G8JB 3TGUE 2NVEA 2B24A 4QUQA 2NUMA 3EN1A 2I7FA 1SQVE 4NBFD 5HL4A 3BCCE 2HMOA 4NBCD 2NUKA 2YVJB 2QPZA 2E4PA 3L70E 3GL0A 1NU1E 4NBBD 4QCKA 2ZT9D 3N0QA 3GCEA 2XR8A 1VM9A 4QDCA 1O7NA 4NBED 4QDFB 3EQQA 2DE6D 2CKFA 4NB9D 3AZCA 1P84E 4OGQD 2HMKA 3H1IE 4HM4A 3VMHD 4NBAD 1KB9E 2XSHA 2HMNA 1ULIA 2B1XA 2HMLA 4QURA 3VMID 3GL2A 4HM2A 2QJKC 3VCPA 2E4QA 1SQXE 2E75D 2NVFA 1VCKA 4NBGD 2NWFA 1SQPE 3GZXA 5AEUA 1SQQE 3GTEA 1NTME 3GZYA 4QUPA
chains in the Genus database with same CATH superfamily
1NKNA 3H1IG 3L72G 3GLMA 3M9QA 3L74D 3BRVB 3H1HE 1OXZA 2JEEA 4QDFA 2ZYDA 2H88C 3PP5A 4PJ0H 1MZ9A 1KYOI 3MP7B 2YIUB 2RN0A 1USDA 3CWBG 2JP3A 4OH8B 4NPEA 5KJ7C 3CCEP 1RFSA 1RY3A 3GG2A 2D2CD 1MUUA 5H2FE 3M0DA 2DE5D 5CJ0A 3N4XA 3G9RA 1RF0C 2O1JA 2JO6A 1SQBJ 5M1BA 2G3AA 1NYKA 2A45I 4A7PA 1EZVD 1QLED 1LJ2A 2J58A 2AXTH 2ZXXA 1GDTA 1IFNA 5KLVD 1U7JA 2IFNA 5AW3B 2C0WA 4W7YA 1NJIQ 4BRYB 3M9HA 1LT9A 4LC1A 4PV1C 1S5LX 2E42A 1D7MA 1SQPJ 1IFJA 3L4FA 4ASWA 3GF3A 2WT7A 2B87A 3WUVA 1VQ6P 1KILA 1M1JA 2XSOA 1KMIZ 2W27A 3L70D 1BE3J 4AAYB 2C0XA 2FFDC 1NTZE 3DQYA 4ZNCA 2QEXP 1NH4A 1S9KE 2WSCH 2P1JA 2G8YA 1PP9G 2POHA 2Z5HA 1AFOA 3C1LA 3L37A 1ZMEC 3CX5E 3A0BE 1JOCA 2FFDB 3HRNA 1OW8A 3CXHE 4C46A 1SJGA 4D6TJ 3H1JJ 2OYIC 1L2PA 4H0LB 3BATA 2CPSA 4JYBA 3W68A 3CMAP 2ZFCA 1OWAA 2YMKA 4CPGA 2Q5UA 3RL0C 2E76C 3CCQP 2XNXA 1FOSE 2QIWA 3CCMP 3BCCJ 3C9IA 1KQSO 4AYCA 5E79H 4ZKUA 2NVEA 2B24A 5DJTB 2O01N 4WY4A 2NUMA 4U3FJ 3Q2YA 2H89C 2ZYAA 3KHUA 2QPZA 3MHVA 2E76B 4KJMA 4YTPC 3EFGA 2Q1KA 2KNCA 1N7SC 3TSIA 3VOPA 1FZBA 2YKOA 1XTCC 1Q86Q 1KILE 1ULIA 4IFMA 2N1TA 2NPSC 2IYPA 1EC5A 4NBGD 1Q82Q 3L75J 5AVVB 2B9BA 3JSVC 3H1KJ 3OAKA 2IDBA 1L0LJ 5KJ7D 3WUTA 1LTGC 1FDMA 2FYUE 1K04A 2PP6A 3VMXA 1P84D 4QDDA 2M3EA 2XKMA 3PHLA 1NTKJ 2HPCB 2M5AA 1NTMD 5CXMA 4DT0A 1DD3A 1YQ4C 4LLHA 5KAIE 1HTLC 1KYOE 2FBWC 4GODA 3D6ZA 2OQQA 2R44A 1PPJD 5B5EH 1HGZA 1T3UA 1L4AB 3RK3E 1YBKA 4GT1A 1HJ0A 5KTBA 4PV1D 1YHQP 2IBZG 5CJ4A 2A06G 1VQLP 3L71D 2H8PD 1K9MQ 4W7ZA 3Q3DA 1O7HA 4QUQA 1NU1J 2IZ0A 1EXJA 3IR9A 4R4LA 2JR8A 4N3YB 3L74J 2HMOA 4JQ0D 3F5HA 2E4PA 3RK2B 5AW8B 1H88A 3Q5RA 1VM9A 1LP1B 3U59A 3AE1C 3H1LD 1RE3A 4WWIA 1IJDB 4JYCA 1N73B 2V7QJ 3AE3C 3H1IE 2HMLA 1NTZK 5AW4B 4KT0J 2HG5D 2WPRA 2FYNB 1E5WA 1IO4A 3AEAC 1FOSF 3M9BA 4N6JA 3CWBE 1U57A 2JKVA 1X0TA 3TF5A 1W2EA 1Z56A 1YTZI 2GUSA 2Q3IA 2IBZI 1PZQA 5APXA 4IL6E 3QH9A 3P7KA 2E76D 1SQQD 5KLVJ 4HM5A 1NOHA 5AVWB 3AEFC 4ZKPA 3C0DA 2MJZA 3WUUA 1CI6A 2Z4EA 4N78E 3LW5J 4B86A 3SSUA 2WTYA 2P10A 3HD7C 4AUWA 3BASA 1SQXD 1NTZG 4IFFA 3AEBC 5AW1B 3AE5C 4UB6E 2Q3WA 1X9VA 1IFDA 1BGYE 1N7SD 5AW6B 1K05A 3O6QB 1UUVA 1N2DC 4R4MA 3NFQA 1ZXGA 2NPSD 3TGUE 2OYHB 3L70J 1KQGB 1IK9A 1YTZT 2GUVA 1FS0E 2NUKA 3L73G 1RE4A 1VQOP 1AQTA 2IYOA 1N7LA 2XR8A 4OWFA 4QDFB 1PIXA 3M0DC 2XSHA 2HMNA 1L4AD 3GL2A 2K9JB 4M3LA 1JMMA 2LXCB 1PP9E 1IFIA 2KIKA 1JY3P 1JY3N 1S5LH 1XTGB 4OGQB 4BXLA 2WPVB 3KZIH 1URQA 1JCDA 3RK2D 4PD4H 1GU5A 2QRXA 1K73Q 3BCCD 4HB1A 2AEJA 3CC7P 2P67A 1R5LA 2LKMA 2Y0EA 1MFTA 2WSSH 2W8ZA 1JM1A 2B89A 3H1HD 1A02F 1N73A 1HGVA 2J59M 1VF5C 1KILC 4I2LC 1M1JC 3B4SA 1LT9B 5AVYB 2W6BA 1PGQA 2LR2A 3B5NA 1FDOA 2YXRB 5K5GB 3V4QA 1RQVA 1FAVA 5KKZB 1KORA 2KP8A 1QX8A 2WT7B 4P1CH 3EN1A 4NBCD 3M0AA 1KILB 1M1JB 5APVA 3GL0A 2FKWB 1KN7A 1Q7YQ 3SFDC 3D71A 3VP8A 2E5YA 3CCUP 2K88A 3AZCA 1QL2A 1NWQA 3GHGA 3CL3D 1WMKA 1NTMJ 1YI2P 1M8OB 4HKZH 1GU4A 2YMYA 1N8RQ 3GZXA 2XZRA 2K3RA 2R3CA 2XDJA 3RK3C 1VQ5P 4HM8A 2A45G 2Q7CA 3EFFK 2W90A 4YXWH 5BOKA 2Q9IA 2BMQA 4WY4C 2YNYA 3HD7D 3VMYA 2YIUC 1X8YA 4DOJA 3CPWO 1SQVK 3RK3B 1OVRA 1NU1D 4H44B 5CCGA 2IBZE 2QM8A 4WY4B 2A06E 2HYNA 2N1TC 3D6YA 1S9KD 2E43A 3H1LJ 5AVSB 2BCCE 4P1BH 1ZR2A 2K9JA 5TISE 2ZAEB 2KI7B 2KYVA 2QA4P 4U3FE 1RF1A 3CX5D 2KNCB 1GW3A 2W6AA 2Z5IA 1MKMA 2N1TB 3CXHD 3WMM0 2XNDH 3A0HH 1RQUA 1AVOA 2IX7C 2OTLP 2V7QH 5GTHE 4JPZB 3JC22 3AEGC 3S9OA 5AVXB 3LIEA 3WU2E 1M1KQ 1SQVG 4UB8E 2HMKA 2B88A 4EOTA 1LTJB 4NBAD 1SQQJ 4H13B 3A2AA 4GOFA 1JTHA 2M5AB 1VCKA 1JEKA 1BGYG 3K5BA 1VQNP 4JF7A 1YJNP 2O1KA 3TGUG 2ZYGA 4Y99B 1GK6A 2V4HA 4HM7A 1OFCX 2N9BA 1SQXJ 3M06A 3U1AA 1BCCE 1SQBK 1VDFA 5CBOA 2QJYB 1VF5D 1KILD 5CCHA 3JCUH 3VMZA 5AVZB 2E75B 2KS1B 4EIJA 5B66H 2FY8A 4NBHD 3LW5H 1RE3C 3VTPC 2R3SA 3KDPB 2FYUD 4PJ0E 3I5CA 2GBXA 3VN0A 1R8EA 1L0NE 1LTTC 2FYZA 1KB9D 1K8AQ 1GD2E 4H0LC 3P8MC 4HJLA 3HUSA 3L74E 1SQPK 4EI2A 3L73E 2BEZF 1VQMP 1KB9H 3GW6A 4WVZA 2GM4A 1SQBG 2H7HA 3R2PA 3RK3D 1HH0A 3N0QA 1JY3O 1QVGO 1JUNA 2AXTE 4WY4D 3S1KA 1SVFA 3MGNA 3VCPA 3MZWB 3H1HJ 1HJBA 2OARA 4AIVA 1KC8Q 2N1TD 1CI6B 4HM0A 5AW5B 1SQPG 4GIFA 4DJGA 3H1ID 3L72D 1SS1A 1RE4C 1EDLA 2WQYC 2QE7H 3SWFA 1BE3G 3VCAA 3KPEA 3CD6P 4GDOA 3NMDA 4NBDD 3CWBD 3BRTB 1LTJA 3G3ZA 1O7WA 3CCSP 1JO5A 1NO4A 1L4AC 4Z1MH 2WZ7A 2N9YB 3AE7C 1E79H 1O7GA 3OW2O 4D6TG 1P84H 3H1JG 1NHLA 1JB0J 1PGJA 4N78D 1L0LK 1WRGA 3OJAB 1DIPA 5KAFH 2KS1A 3H32B 3RK2C 1G2CA 1VQPP 3EQQA 1HWTC 5E79E 2R32A 3AE9C 1BGYD 5BU8B 1N73C 3HTKA 4HM4A 2BCCG 1NTKK 4BWNA 3CMEP 1DH3A 1URQB 4HM2A 4U3FG 1SFCA 1FZCB 3CI9A 3TYYA 1NTZJ 1PGPA 4K3AA 3A5TA 2FYNC 3I56P 3V2PA 1IFPA 4ZMDA 4H0LD 3P8CE 1BDCA 3ZDMA 2O3JA 3MD0A 3II6A 2C9NY 3L75G 3B5NB 1L0NK 1QVFO 4TLFA 3H1KG 1L0LG 4PD4I 2WVRA 3PLNA 2ZT9B 1GK4A 1LT1A 3B71A 1PP9D 3PJSK 1EG9A 1OMIA 3GHGC 2Y0DA 1FJKA 3KXDA 3A3YB 5BU5A 3Q5SA 5AW7B 1ZP0C 1NTKG 3OA7A 5GTIE 2K37A 5AW9B 3V4WA 1Q90C 1FQTA 2AEFA 1ZOYC 2I8DA 1BCCG 3GF7A 3GHGB 4XFJA 5B5EE 4O9BA 5APYA 3IF4A 1AVYA 2OYHC 1SQVE 4NBFD 1NYHA 2Q6QA 1FZAA 1IK7A 1LTBC 2YVJB 3UIAA 1J1EC 2IPPA 3AE6C 5C39A 3QWOC 1ZN5A 5CCGC 1L0NG 3CC4P 2KOGA 1AQ5A 1U7MA 2QJKB 3L74G 5KLVK 3FX0A 2JO1A 3FGAD 3PH0A 2FYUJ 1J1EB 1SLQA 3GZYA 3SWYA 3FXDA 4L76A 1RF1C 2O01J 1CSBA 4JBZA 1J2JB 3L71E 2FXPA 2WSEJ 1KV4A 5APWA 3D70A 1HBWA 3MUDA 1ZRTE 4WB4A 4L73A 1N7SA 4K35A 1NDOA 4OGQC 2P7JA 1Q2NA 3H6PA 1OW7A 1KFMA 1KQFB 1LTIC 5EFWB 2H43A 2JZAA 1RF1B 2K9YA 5APSA 1HVVA 2I1KA 4HH2A 1VQ9P 2XU6A 2ZJSE 3H32A 4IFDK 3MTUE 5TJHA 2YO3A 1NKZB 2QM7A 2GBWA 3T97B 5CBNA 2WSFH 4Y28J 2YFJA 4YPCA 1FZCA 5KLVG 1LT9C 2WITA 1SQBE 1QL1A 5KKZC 2P2UA 1ULJA 2IBZD 2D2CB 1JTHB 5CCHC 1AV1A 2A06D 1VQ4P 4C7NA 1M57D 1Y8AA 3W67A 4KHXA 1TU3F 2JWDA 4IL6X 2ZT9D 3H1IJ 3L72J 3GCEA 1A02J 1LGHB 1O7NA 3FWLA 1EDKA 2YKPA 2P58A 3L70G 4GOEA 1GTWA 3CXHI 3Q1MA 1SQXE 2NVFA 1SQPE 5AEUA 3AE2C 1YQ3C 1GL2A 3CWBJ 1RIEA 3GMAA 2PAJA 3TNUA 2PFXA 1FJPA 2YO2A 1KD1Q 2LXBA 2W6JH 3GOBA 1EZVI 1BE3E 1ZV8A 4W80A 5H2FH 1MFZA 3GKEA 3AEDC 2KZIA 2DE7D 3FOUA 1Q90D 3HUSB 4L74A 3S4RA 2OTJP 3ABVC 2HMJA 4WBAA 5KLIB 2NZ2A 1S5LE 1M56D 1X79B 4H44C 1CZQA 3KZIE 3VYIA 2YFIA 3N7NA 2QSIA 4PD4E 2KB7P 5APUA 1M7LA 4D6TE 3H1JE 1BGYJ 3H25A 2L91A 4GKGA 1S2EA 5CCGD 3HE4A 1NTMK 1GZLA 1T2KC 1NTZD 4DCKA 2RKLA 3E1IA 3P32A 3BCCE 3HD7A 1KB9I 3EQ2A 4OVNF 1JM0A 2Y9YA 1AJYA 2KK7A 4I7ZC 1UIXA 4NB9D 3L73D 4OGQD 5AVRB 2I1JA 1LTJC 2B1XA 4H13C 1PP9J 1OIPA 3T97A 4QUPA 4I7ZB 2WPSA 4LGDE 2M3BA 2VRSA 4HJGH 3CX5H 3A0BH 1YJWP 3L75E 4Y99C 3H1KE 3CXHH 1Q81Q 1L0LE 2KLVA 1NTMG 3AECC 2YKQA 2QJYC 2J5UA 1IC2A 3V2NA 2UWJE 1Y47A 2E75C 4YXDC 1PPJG 2HR3A 1EDJA 1NTKE 1JY2P 2BMRA 1JY2N 1KZUB 1M90Q 3D89A 2OGUA 3CLQA 5CCHD 4IOIH 1DX7A 3FXEA 3L36A 2DW3A 1SFCC 2ZVNB 3L71G 1PL5A 3CCJP 1NVOA 1G2CB 1LTSC 1SQQK 1S3JA 1VPCA 4HM6A 3HTKB 3V2QA 2OTKE 2ZXEB 2ITAA 1GW4A 1H89A 1W5CE 1SFCB 2KSEA 1N86A 1LWUA 1P84I 3H1LG 1FZEA 1NU1E 2K1AA 4QCKA 4PV1B 4EYYQ 1YJ9P 1SQXK 3EWKA 1RHZB 3I55P 2WSFJ 2E74C 1MV8A 2ZVOB 1KYOD 3RBZA 2O01H 2WSEH 3A0HE 2PRRA 2NWFA 2Q3EA 4U7JA 3USSA 2GA1A 1FE6A 2Y9ZA 4H44D 2E74B 2KUBA 3B8EB 5KAIH 1KYOH 3VP9A 1SQQG 3V5BA 1VQ8P 2HODB 1T8ZA 2WPQA 3F89A 4NB8D 1EZVE 1OVVA 1T2KD 2OYIB 3GTSA 2WWWA 1SQXG 2BCCJ 5KLVE 2A45H 2SPZA 3JCUE 3P8CD 3O8ZA 5B66E 3HE5B 3RL0B 2QJPC 2L5GB 1J1DC 2QG4A 3MUDC 1KQLA 1QGKB 3KYQA 4H13D 2AEMA 5CMZA 1G8JB 1PV3A 2QVAA 3A7OA 1JNMA 3L70E 2PGDA 2QJPB 3E1RA 1HF9A 3R4YA 3LIDA 4QDCA 1J1DB 1EDIA 2FXOA 1N7SB 1EXIA 5KJ7A 1KB9E 3AE4C 2NPSB 3V2RA 3U1CA 5AVQB 2IFMA 3RL0g 1PFIA 1URQC 3Q5PA 2E75D 1SQVD 5BVZA 2NRGA 5AVUB 1VQKP 1RF0A 3GTEA 4IL6H 2E5TA 5GTIH 1FZCC 4BRYA 1BCCJ 1YYCA 3KQGA 4ASVA 4NPDA 3BCCG 3G6EP 1SFCD 5APTA 3GB4A 4QMAA 3TGUD 1H8AA 2OYOA 3RBXA 3H1HG 3B5NC 5AW2B 2WMMA 4UB6H 2C9LY 1L0NJ 1GMJA 2ZT9C 1FZFA 4HM3A 2HMMA 1OZHA 1YIJP 2JWAA 1ZRTD 1OVUA 3G71P 4C7NB 1OW6A 3L73J 5APQA 1SP4A 2BMOA 4RKUJ 1GL2C 1KTMA 1USEA 1UUWA 5CHXA 2CPBA 1JMBA 5DJUB 3PRJA 2E74D 1AA0A 4EDFA 1Y9BA 4XE5B 3TK1A 1NU1K 2FFDA 2R5BA 3L72E 1DEEG 1T6AA 2YFLA 2I7FA 3AE8C 3E7KA 4NPFX 1GL2B 4L75A 4NBBD 2HODA 3TNUB 4HYTB 5L8RJ 1BSNA 1W2BO 1NAFA 1P84E 1SQBD 2KZJA 2XV5A 2OYIA 3VMID 2QJKC 3RL0D 5KAFE 4C7RA 1NTME 3G4SP 1DD4A 3HE5A 5AEWA 1JY2O 1IFMA 1PGOA 1FZGA 2XRXA 1RH5B 1WQLA 1VL2A 4DZOA 1PPJE 1T3JA 4AQRD 2RH0A 1NU1G 1UIIA 3C8VA 3NTNA 5AVTB 4MN4C 3IN6A 1O7MA 1SQPD 4I1LA 4XA4A 3HE4B 2HLOA 3L35A 2WSCJ 1H0TB 1JCCA 1G1IA 3VMAA 1BDDA 3BVHA 3NXSA 2YXQB 1BE3D 3HD7B 1FDIA 1HUCA 2NPSA 4RJTA 2HPCA 1IZNB 3H1LE 1LTAC 1G8KB 3VMGD 2ZYLA 2Y0CA 1URQD 2FYUK 1BSHA 2D2CC 2HFED 3MIWA 2JJLA 1FC2C 3SWKA 1EZVG 4PD4D 1L4AA 4D6TD 3H1JD 4I6MC 3RGUA 3ITKA 2IZ1A 3IAOA 1FBMA 1YITP 4QURA 1EQ7A 1ZLLA 3CCVP 1ZR4A 3B5ND 1SQQE 2FXMA 4TT3H 1S72P 2BCCD 2M8RA 3V6IA 2NVGA 3AEEC 3M91A 4U3FD 1LP1A 3CC2P 4RO0A 3CX5I 2R5DA 4EMJB 1LWUC 1NGMB 1GL2D 3PTZA 4RESB 2BASA 2FYUG 2M0BA 3HUSC 5TISH 1DEBA 1G1JA 1NAYA 1FU1A 1X22A 2KXPB 5KLIC 3L75D 2AXCA 4HKVA 1LWUB 2B87B 3H1KD 2JDIH 3CCLP 1L0LD 1CW5A 4HM1A 1S1CX 1VF5B 3FWNA 1LNQA 5GTHH 1QEXA 1SQVJ 1O7PA 1NTKD 2KSJA 3WU2H 2KLUA 4UB8H 1ZW0A 2MKVA 2BEQD 2W83C 1BCCD 5HL4A 1WT6A 3IFMA 3SFEC 1KFNA 1S4XA 2CK3H 3TDKA 3TGUJ 4NBED 2DE6D 2CKFA 1H0TA 3VMHD 3O6QA 2RMZA 2OYHA 5AW0B 3L71J 1R5SA 2E4QA 1L0ND 3CCRP 1OX3A 1VQ7P
chains in the Genus database with same CATH topology
2XSOA 1RIEA 4AIVA 3L71E 2NVGA 5AEWA 1PP9E 4AAYB 2FYNC 4HM8A 2XRXA 4H44D 3H1HE 3L75E 2FYUE 1NTZE 1WQLA 3DQYA 4HM7A 3CWBE 4QDFA 3H1KE 1ZRTE 3GOBA 4HM0A 5BOKA 4EMJB 2BMQA 1PPJE 1L0LE 1BE3E 1BCCE 4H0LD 1NDOA 3GB4A 1VF5D 4QDDA 3GKEA 2QJYC 2DE7D 3FOUA 2YIUC 1O7MA 2JZAA 2E76D 3CX5E 4NB8D 4HM5A 2HMJA 1EZVE 4NBHD 5CXMA 3VCAA 1NTKE 3C0DA 1JM1A 2BMRA 1KYOE 1RFSA 3CXHE 2IBZE 1EG9A 1SJGA 3D89A 5KLIC 3GTSA 4HM3A 2D2CD 5KLVE 2HMMA 4NBDD 2A06E 4HKVA 2GBXA 2DE5D 2GBWA 2YFIA 1L0NE 4HM1A 4PD4E 1O7WA 2BCCE 4D6TE 2BMOA 3H1JE 2JO6A 2YFJA 4HJLA 4P1BH 1NYKA 4PV1D 1Q90C 1UUWA 4U3FE 1FQTA 3L74E 2QJPC 3H1LE 2E74D 2Q3WA 1G8KB 3L73E 1BGYE 1SQBE 1O7GA 4HM6A 1O7PA 3VMGD 5KKZC 3L72E 1UUVA 2ZYLA 1ULJA 2YFLA 4H13D 4P1CH 1O7HA 1G8JB 3TGUE 2NVEA 2B24A 4QUQA 2NUMA 3EN1A 2I7FA 1SQVE 4NBFD 5HL4A 3BCCE 2HMOA 4NBCD 2NUKA 2YVJB 2QPZA 2E4PA 3L70E 3GL0A 1NU1E 4NBBD 4QCKA 2ZT9D 3N0QA 3GCEA 2XR8A 1VM9A 4QDCA 1O7NA 4NBED 4QDFB 3EQQA 2DE6D 2CKFA 4NB9D 3AZCA 1P84E 4OGQD 2HMKA 3H1IE 4HM4A 3VMHD 4NBAD 1KB9E 2XSHA 2HMNA 1ULIA 2B1XA 2HMLA 4QURA 3VMID 3GL2A 4HM2A 2QJKC 3VCPA 2E4QA 1SQXE 2E75D 2NVFA 1VCKA 4NBGD 2NWFA 1SQPE 3GZXA 5AEUA 1SQQE 3GTEA 1NTME 3GZYA 4QUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSO A;  1RIE A;  4AIV A;  3L71 E;  2NVG A;  5AEW A;  1PP9 E;  4AAY B;  2FYN C;  4HM8 A;  2XRX A;  4H44 D;  3H1H E;  3L75 E;  2FYU E;  1NTZ E;  1WQL A;  3DQY A;  4HM7 A;  3CWB E;  4QDF A;  3H1K E;  1ZRT E;  3GOB A;  4HM0 A;  5BOK A;  4EMJ B;  2BMQ A;  1PPJ E;  1L0L E;  1BE3 E;  1BCC E;  4H0L D;  1NDO A;  3GB4 A;  1VF5 D;  4QDD A;  3GKE A;  2QJY C;  2DE7 D;  3FOU A;  2YIU C;  1O7M A;  2JZA A;  2E76 D;  3CX5 E;  4NB8 D;  4HM5 A;  2HMJ A;  1EZV E;  4NBH D;  5CXM A;  3VCA A;  1NTK E;  3C0D A;  1JM1 A;  2BMR A;  1KYO E;  1RFS A;  3CXH E;  2IBZ E;  1EG9 A;  1SJG A;  3D89 A;  5KLI C;  3GTS A;  4HM3 A;  2D2C D;  5KLV E;  2HMM A;  4NBD D;  2A06 E;  4HKV A;  2GBX A;  2DE5 D;  2GBW A;  2YFI A;  1L0N E;  4HM1 A;  4PD4 E;  1O7W A;  2BCC E;  4D6T E;  2BMO A;  3H1J E;  2JO6 A;  2YFJ A;  4HJL A;  4P1B H;  1NYK A;  4PV1 D;  1Q90 C;  1UUW A;  4U3F E;  1FQT A;  3L74 E;  2QJP C;  3H1L E;  2E74 D;  2Q3W A;  1G8K B;  3L73 E;  1BGY E;  1SQB E;  1O7G A;  4HM6 A;  1O7P A;  3VMG D;  5KKZ C;  3L72 E;  1UUV A;  2ZYL A;  1ULJ A;  2YFL A;  4H13 D;  4P1C H;  1O7H A;  1G8J B;  3TGU E;  2NVE A;  2B24 A;  4QUQ A;  2NUM A;  3EN1 A;  2I7F A;  1SQV E;  4NBF D;  5HL4 A;  3BCC E;  2HMO A;  4NBC D;  2NUK A;  2YVJ B;  2QPZ A;  2E4P A;  3L70 E;  3GL0 A;  1NU1 E;  4NBB D;  4QCK A;  2ZT9 D;  3N0Q A;  3GCE A;  2XR8 A;  1VM9 A;  4QDC A;  1O7N A;  4NBE D;  4QDF B;  3EQQ A;  2DE6 D;  2CKF A;  4NB9 D;  3AZC A;  1P84 E;  4OGQ D;  2HMK A;  3H1I E;  4HM4 A;  3VMH D;  4NBA D;  1KB9 E;  2XSH A;  2HMN A;  1ULI A;  2B1X A;  2HML A;  4QUR A;  3VMI D;  3GL2 A;  4HM2 A;  2QJK C;  3VCP A;  2E4Q A;  1SQX E;  2E75 D;  2NVF A;  1VCK A;  4NBG D;  2NWF A;  1SQP E;  3GZX A;  5AEU A;  1SQQ E;  3GTE A;  1NTM E;  3GZY A;  4QUP A; 
#chains in the Genus database with same CATH topology
 1NKN A;  3H1I G;  3L72 G;  3GLM A;  3M9Q A;  3L74 D;  3BRV B;  3H1H E;  1OXZ A;  2JEE A;  4QDF A;  2ZYD A;  2H88 C;  3PP5 A;  4PJ0 H;  1MZ9 A;  1KYO I;  3MP7 B;  2YIU B;  2RN0 A;  1USD A;  3CWB G;  2JP3 A;  4OH8 B;  4NPE A;  5KJ7 C;  3CCE P;  1RFS A;  1RY3 A;  3GG2 A;  2D2C D;  1MUU A;  5H2F E;  3M0D A;  2DE5 D;  5CJ0 A;  3N4X A;  3G9R A;  1RF0 C;  2O1J A;  2JO6 A;  1SQB J;  5M1B A;  2G3A A;  1NYK A;  2A45 I;  4A7P A;  1EZV D;  1QLE D;  1LJ2 A;  2J58 A;  2AXT H;  2ZXX A;  1GDT A;  1IFN A;  5KLV D;  1U7J A;  2IFN A;  5AW3 B;  2C0W A;  4W7Y A;  1NJI Q;  4BRY B;  3M9H A;  1LT9 A;  4LC1 A;  4PV1 C;  1S5L X;  2E42 A;  1D7M A;  1SQP J;  1IFJ A;  3L4F A;  4ASW A;  3GF3 A;  2WT7 A;  2B87 A;  3WUV A;  1VQ6 P;  1KIL A;  1M1J A;  2XSO A;  1KMI Z;  2W27 A;  3L70 D;  1BE3 J;  4AAY B;  2C0X A;  2FFD C;  1NTZ E;  3DQY A;  4ZNC A;  2QEX P;  1NH4 A;  1S9K E;  2WSC H;  2P1J A;  2G8Y A;  1PP9 G;  2POH A;  2Z5H A;  1AFO A;  3C1L A;  3L37 A;  1ZME C;  3CX5 E;  3A0B E;  1JOC A;  2FFD B;  3HRN A;  1OW8 A;  3CXH E;  4C46 A;  1SJG A;  4D6T J;  3H1J J;  2OYI C;  1L2P A;  4H0L B;  3BAT A;  2CPS A;  4JYB A;  3W68 A;  3CMA P;  2ZFC A;  1OWA A;  2YMK A;  4CPG A;  2Q5U A;  3RL0 C;  2E76 C;  3CCQ P;  2XNX A;  1FOS E;  2QIW A;  3CCM P;  3BCC J;  3C9I A;  1KQS O;  4AYC A;  5E79 H;  4ZKU A;  2NVE A;  2B24 A;  5DJT B;  2O01 N;  4WY4 A;  2NUM A;  4U3F J;  3Q2Y A;  2H89 C;  2ZYA A;  3KHU A;  2QPZ A;  3MHV A;  2E76 B;  4KJM A;  4YTP C;  3EFG A;  2Q1K A;  2KNC A;  1N7S C;  3TSI A;  3VOP A;  1FZB A;  2YKO A;  1XTC C;  1Q86 Q;  1KIL E;  1ULI A;  4IFM A;  2N1T A;  2NPS C;  2IYP A;  1EC5 A;  4NBG D;  1Q82 Q;  3L75 J;  5AVV B;  2B9B A;  3JSV C;  3H1K J;  3OAK A;  2IDB A;  1L0L J;  5KJ7 D;  3WUT A;  1LTG C;  1FDM A;  2FYU E;  1K04 A;  2PP6 A;  3VMX A;  1P84 D;  4QDD A;  2M3E A;  2XKM A;  3PHL A;  1NTK J;  2HPC B;  2M5A A;  1NTM D;  5CXM A;  4DT0 A;  1DD3 A;  1YQ4 C;  4LLH A;  5KAI E;  1HTL C;  1KYO E;  2FBW C;  4GOD A;  3D6Z A;  2OQQ A;  2R44 A;  1PPJ D;  5B5E H;  1HGZ A;  1T3U A;  1L4A B;  3RK3 E;  1YBK A;  4GT1 A;  1HJ0 A;  5KTB A;  4PV1 D;  1YHQ P;  2IBZ G;  5CJ4 A;  2A06 G;  1VQL P;  3L71 D;  2H8P D;  1K9M Q;  4W7Z A;  3Q3D A;  1O7H A;  4QUQ A;  1NU1 J;  2IZ0 A;  1EXJ A;  3IR9 A;  4R4L A;  2JR8 A;  4N3Y B;  3L74 J;  2HMO A;  4JQ0 D;  3F5H A;  2E4P A;  3RK2 B;  5AW8 B;  1H88 A;  3Q5R A;  1VM9 A;  1LP1 B;  3U59 A;  3AE1 C;  3H1L D;  1RE3 A;  4WWI A;  1IJD B;  4JYC A;  1N73 B;  2V7Q J;  3AE3 C;  3H1I E;  2HML A;  1NTZ K;  5AW4 B;  4KT0 J;  2HG5 D;  2WPR A;  2FYN B;  1E5W A;  1IO4 A;  3AEA C;  1FOS F;  3M9B A;  4N6J A;  3CWB E;  1U57 A;  2JKV A;  1X0T A;  3TF5 A;  1W2E A;  1Z56 A;  1YTZ I;  2GUS A;  2Q3I A;  2IBZ I;  1PZQ A;  5APX A;  4IL6 E;  3QH9 A;  3P7K A;  2E76 D;  1SQQ D;  5KLV J;  4HM5 A;  1NOH A;  5AVW B;  3AEF C;  4ZKP A;  3C0D A;  2MJZ A;  3WUU A;  1CI6 A;  2Z4E A;  4N78 E;  3LW5 J;  4B86 A;  3SSU A;  2WTY A;  2P10 A;  3HD7 C;  4AUW A;  3BAS A;  1SQX D;  1NTZ G;  4IFF A;  3AEB C;  5AW1 B;  3AE5 C;  4UB6 E;  2Q3W A;  1X9V A;  1IFD A;  1BGY E;  1N7S D;  5AW6 B;  1K05 A;  3O6Q B;  1UUV A;  1N2D C;  4R4M A;  3NFQ A;  1ZXG A;  2NPS D;  3TGU E;  2OYH B;  3L70 J;  1KQG B;  1IK9 A;  1YTZ T;  2GUV A;  1FS0 E;  2NUK A;  3L73 G;  1RE4 A;  1VQO P;  1AQT A;  2IYO A;  1N7L A;  2XR8 A;  4OWF A;  4QDF B;  1PIX A;  3M0D C;  2XSH A;  2HMN A;  1L4A D;  3GL2 A;  2K9J B;  4M3L A;  1JMM A;  2LXC B;  1PP9 E;  1IFI A;  2KIK A;  1JY3 P;  1JY3 N;  1S5L H;  1XTG B;  4OGQ B;  4BXL A;  2WPV B;  3KZI H;  1URQ A;  1JCD A;  3RK2 D;  4PD4 H;  1GU5 A;  2QRX A;  1K73 Q;  3BCC D;  4HB1 A;  2AEJ A;  3CC7 P;  2P67 A;  1R5L A;  2LKM A;  2Y0E A;  1MFT A;  2WSS H;  2W8Z A;  1JM1 A;  2B89 A;  3H1H D;  1A02 F;  1N73 A;  1HGV A;  2J59 M;  1VF5 C;  1KIL C;  4I2L C;  1M1J C;  3B4S A;  1LT9 B;  5AVY B;  2W6B A;  1PGQ A;  2LR2 A;  3B5N A;  1FDO A;  2YXR B;  5K5G B;  3V4Q A;  1RQV A;  1FAV A;  5KKZ B;  1KOR A;  2KP8 A;  1QX8 A;  2WT7 B;  4P1C H;  3EN1 A;  4NBC D;  3M0A A;  1KIL B;  1M1J B;  5APV A;  3GL0 A;  2FKW B;  1KN7 A;  1Q7Y Q;  3SFD C;  3D71 A;  3VP8 A;  2E5Y A;  3CCU P;  2K88 A;  3AZC A;  1QL2 A;  1NWQ A;  3GHG A;  3CL3 D;  1WMK A;  1NTM J;  1YI2 P;  1M8O B;  4HKZ H;  1GU4 A;  2YMY A;  1N8R Q;  3GZX A;  2XZR A;  2K3R A;  2R3C A;  2XDJ A;  3RK3 C;  1VQ5 P;  4HM8 A;  2A45 G;  2Q7C A;  3EFF K;  2W90 A;  4YXW H;  5BOK A;  2Q9I A;  2BMQ A;  4WY4 C;  2YNY A;  3HD7 D;  3VMY A;  2YIU C;  1X8Y A;  4DOJ A;  3CPW O;  1SQV K;  3RK3 B;  1OVR A;  1NU1 D;  4H44 B;  5CCG A;  2IBZ E;  2QM8 A;  4WY4 B;  2A06 E;  2HYN A;  2N1T C;  3D6Y A;  1S9K D;  2E43 A;  3H1L J;  5AVS B;  2BCC E;  4P1B H;  1ZR2 A;  2K9J A;  5TIS E;  2ZAE B;  2KI7 B;  2KYV A;  2QA4 P;  4U3F E;  1RF1 A;  3CX5 D;  2KNC B;  1GW3 A;  2W6A A;  2Z5I A;  1MKM A;  2N1T B;  3CXH D;  3WMM 0;  2XND H;  3A0H H;  1RQU A;  1AVO A;  2IX7 C;  2OTL P;  2V7Q H;  5GTH E;  4JPZ B;  3JC2 2;  3AEG C;  3S9O A;  5AVX B;  3LIE A;  3WU2 E;  1M1K Q;  1SQV G;  4UB8 E;  2HMK A;  2B88 A;  4EOT A;  1LTJ B;  4NBA D;  1SQQ J;  4H13 B;  3A2A A;  4GOF A;  1JTH A;  2M5A B;  1VCK A;  1JEK A;  1BGY G;  3K5B A;  1VQN P;  4JF7 A;  1YJN P;  2O1K A;  3TGU G;  2ZYG A;  4Y99 B;  1GK6 A;  2V4H A;  4HM7 A;  1OFC X;  2N9B A;  1SQX J;  3M06 A;  3U1A A;  1BCC E;  1SQB K;  1VDF A;  5CBO A;  2QJY B;  1VF5 D;  1KIL D;  5CCH A;  3JCU H;  3VMZ A;  5AVZ B;  2E75 B;  2KS1 B;  4EIJ A;  5B66 H;  2FY8 A;  4NBH D;  3LW5 H;  1RE3 C;  3VTP C;  2R3S A;  3KDP B;  2FYU D;  4PJ0 E;  3I5C A;  2GBX A;  3VN0 A;  1R8E A;  1L0N E;  1LTT C;  2FYZ A;  1KB9 D;  1K8A Q;  1GD2 E;  4H0L C;  3P8M C;  4HJL A;  3HUS A;  3L74 E;  1SQP K;  4EI2 A;  3L73 E;  2BEZ F;  1VQM P;  1KB9 H;  3GW6 A;  4WVZ A;  2GM4 A;  1SQB G;  2H7H A;  3R2P A;  3RK3 D;  1HH0 A;  3N0Q A;  1JY3 O;  1QVG O;  1JUN A;  2AXT E;  4WY4 D;  3S1K A;  1SVF A;  3MGN A;  3VCP A;  3MZW B;  3H1H J;  1HJB A;  2OAR A;  4AIV A;  1KC8 Q;  2N1T D;  1CI6 B;  4HM0 A;  5AW5 B;  1SQP G;  4GIF A;  4DJG A;  3H1I D;  3L72 D;  1SS1 A;  1RE4 C;  1EDL A;  2WQY C;  2QE7 H;  3SWF A;  1BE3 G;  3VCA A;  3KPE A;  3CD6 P;  4GDO A;  3NMD A;  4NBD D;  3CWB D;  3BRT B;  1LTJ A;  3G3Z A;  1O7W A;  3CCS P;  1JO5 A;  1NO4 A;  1L4A C;  4Z1M H;  2WZ7 A;  2N9Y B;  3AE7 C;  1E79 H;  1O7G A;  3OW2 O;  4D6T G;  1P84 H;  3H1J G;  1NHL A;  1JB0 J;  1PGJ A;  4N78 D;  1L0L K;  1WRG A;  3OJA B;  1DIP A;  5KAF H;  2KS1 A;  3H32 B;  3RK2 C;  1G2C A;  1VQP P;  3EQQ A;  1HWT C;  5E79 E;  2R32 A;  3AE9 C;  1BGY D;  5BU8 B;  1N73 C;  3HTK A;  4HM4 A;  2BCC G;  1NTK K;  4BWN A;  3CME P;  1DH3 A;  1URQ B;  4HM2 A;  4U3F G;  1SFC A;  1FZC B;  3CI9 A;  3TYY A;  1NTZ J;  1PGP A;  4K3A A;  3A5T A;  2FYN C;  3I56 P;  3V2P A;  1IFP A;  4ZMD A;  4H0L D;  3P8C E;  1BDC A;  3ZDM A;  2O3J A;  3MD0 A;  3II6 A;  2C9N Y;  3L75 G;  3B5N B;  1L0N K;  1QVF O;  4TLF A;  3H1K G;  1L0L G;  4PD4 I;  2WVR A;  3PLN A;  2ZT9 B;  1GK4 A;  1LT1 A;  3B71 A;  1PP9 D;  3PJS K;  1EG9 A;  1OMI A;  3GHG C;  2Y0D A;  1FJK A;  3KXD A;  3A3Y B;  5BU5 A;  3Q5S A;  5AW7 B;  1ZP0 C;  1NTK G;  3OA7 A;  5GTI E;  2K37 A;  5AW9 B;  3V4W A;  1Q90 C;  1FQT A;  2AEF A;  1ZOY C;  2I8D A;  1BCC G;  3GF7 A;  3GHG B;  4XFJ A;  5B5E E;  4O9B A;  5APY A;  3IF4 A;  1AVY A;  2OYH C;  1SQV E;  4NBF D;  1NYH A;  2Q6Q A;  1FZA A;  1IK7 A;  1LTB C;  2YVJ B;  3UIA A;  1J1E C;  2IPP A;  3AE6 C;  5C39 A;  3QWO C;  1ZN5 A;  5CCG C;  1L0N G;  3CC4 P;  2KOG A;  1AQ5 A;  1U7M A;  2QJK B;  3L74 G;  5KLV K;  3FX0 A;  2JO1 A;  3FGA D;  3PH0 A;  2FYU J;  1J1E B;  1SLQ A;  3GZY A;  3SWY A;  3FXD A;  4L76 A;  1RF1 C;  2O01 J;  1CSB A;  4JBZ A;  1J2J B;  3L71 E;  2FXP A;  2WSE J;  1KV4 A;  5APW A;  3D70 A;  1HBW A;  3MUD A;  1ZRT E;  4WB4 A;  4L73 A;  1N7S A;  4K35 A;  1NDO A;  4OGQ C;  2P7J A;  1Q2N A;  3H6P A;  1OW7 A;  1KFM A;  1KQF B;  1LTI C;  5EFW B;  2H43 A;  2JZA A;  1RF1 B;  2K9Y A;  5APS A;  1HVV A;  2I1K A;  4HH2 A;  1VQ9 P;  2XU6 A;  2ZJS E;  3H32 A;  4IFD K;  3MTU E;  5TJH A;  2YO3 A;  1NKZ B;  2QM7 A;  2GBW A;  3T97 B;  5CBN A;  2WSF H;  4Y28 J;  2YFJ A;  4YPC A;  1FZC A;  5KLV G;  1LT9 C;  2WIT A;  1SQB E;  1QL1 A;  5KKZ C;  2P2U A;  1ULJ A;  2IBZ D;  2D2C B;  1JTH B;  5CCH C;  1AV1 A;  2A06 D;  1VQ4 P;  4C7N A;  1M57 D;  1Y8A A;  3W67 A;  4KHX A;  1TU3 F;  2JWD A;  4IL6 X;  2ZT9 D;  3H1I J;  3L72 J;  3GCE A;  1A02 J;  1LGH B;  1O7N A;  3FWL A;  1EDK A;  2YKP A;  2P58 A;  3L70 G;  4GOE A;  1GTW A;  3CXH I;  3Q1M A;  1SQX E;  2NVF A;  1SQP E;  5AEU A;  3AE2 C;  1YQ3 C;  1GL2 A;  3CWB J;  1RIE A;  3GMA A;  2PAJ A;  3TNU A;  2PFX A;  1FJP A;  2YO2 A;  1KD1 Q;  2LXB A;  2W6J H;  3GOB A;  1EZV I;  1BE3 E;  1ZV8 A;  4W80 A;  5H2F H;  1MFZ A;  3GKE A;  3AED C;  2KZI A;  2DE7 D;  3FOU A;  1Q90 D;  3HUS B;  4L74 A;  3S4R A;  2OTJ P;  3ABV C;  2HMJ A;  4WBA A;  5KLI B;  2NZ2 A;  1S5L E;  1M56 D;  1X79 B;  4H44 C;  1CZQ A;  3KZI E;  3VYI A;  2YFI A;  3N7N A;  2QSI A;  4PD4 E;  2KB7 P;  5APU A;  1M7L A;  4D6T E;  3H1J E;  1BGY J;  3H25 A;  2L91 A;  4GKG A;  1S2E A;  5CCG D;  3HE4 A;  1NTM K;  1GZL A;  1T2K C;  1NTZ D;  4DCK A;  2RKL A;  3E1I A;  3P32 A;  3BCC E;  3HD7 A;  1KB9 I;  3EQ2 A;  4OVN F;  1JM0 A;  2Y9Y A;  1AJY A;  2KK7 A;  4I7Z C;  1UIX A;  4NB9 D;  3L73 D;  4OGQ D;  5AVR B;  2I1J A;  1LTJ C;  2B1X A;  4H13 C;  1PP9 J;  1OIP A;  3T97 A;  4QUP A;  4I7Z B;  2WPS A;  4LGD E;  2M3B A;  2VRS A;  4HJG H;  3CX5 H;  3A0B H;  1YJW P;  3L75 E;  4Y99 C;  3H1K E;  3CXH H;  1Q81 Q;  1L0L E;  2KLV A;  1NTM G;  3AEC C;  2YKQ A;  2QJY C;  2J5U A;  1IC2 A;  3V2N A;  2UWJ E;  1Y47 A;  2E75 C;  4YXD C;  1PPJ G;  2HR3 A;  1EDJ A;  1NTK E;  1JY2 P;  2BMR A;  1JY2 N;  1KZU B;  1M90 Q;  3D89 A;  2OGU A;  3CLQ A;  5CCH D;  4IOI H;  1DX7 A;  3FXE A;  3L36 A;  2DW3 A;  1SFC C;  2ZVN B;  3L71 G;  1PL5 A;  3CCJ P;  1NVO A;  1G2C B;  1LTS C;  1SQQ K;  1S3J A;  1VPC A;  4HM6 A;  3HTK B;  3V2Q A;  2OTK E;  2ZXE B;  2ITA A;  1GW4 A;  1H89 A;  1W5C E;  1SFC B;  2KSE A;  1N86 A;  1LWU A;  1P84 I;  3H1L G;  1FZE A;  1NU1 E;  2K1A A;  4QCK A;  4PV1 B;  4EYY Q;  1YJ9 P;  1SQX K;  3EWK A;  1RHZ B;  3I55 P;  2WSF J;  2E74 C;  1MV8 A;  2ZVO B;  1KYO D;  3RBZ A;  2O01 H;  2WSE H;  3A0H E;  2PRR A;  2NWF A;  2Q3E A;  4U7J A;  3USS A;  2GA1 A;  1FE6 A;  2Y9Z A;  4H44 D;  2E74 B;  2KUB A;  3B8E B;  5KAI H;  1KYO H;  3VP9 A;  1SQQ G;  3V5B A;  1VQ8 P;  2HOD B;  1T8Z A;  2WPQ A;  3F89 A;  4NB8 D;  1EZV E;  1OVV A;  1T2K D;  2OYI B;  3GTS A;  2WWW A;  1SQX G;  2BCC J;  5KLV E;  2A45 H;  2SPZ A;  3JCU E;  3P8C D;  3O8Z A;  5B66 E;  3HE5 B;  3RL0 B;  2QJP C;  2L5G B;  1J1D C;  2QG4 A;  3MUD C;  1KQL A;  1QGK B;  3KYQ A;  4H13 D;  2AEM A;  5CMZ A;  1G8J B;  1PV3 A;  2QVA A;  3A7O A;  1JNM A;  3L70 E;  2PGD A;  2QJP B;  3E1R A;  1HF9 A;  3R4Y A;  3LID A;  4QDC A;  1J1D B;  1EDI A;  2FXO A;  1N7S B;  1EXI A;  5KJ7 A;  1KB9 E;  3AE4 C;  2NPS B;  3V2R A;  3U1C A;  5AVQ B;  2IFM A;  3RL0 g;  1PFI A;  1URQ C;  3Q5P A;  2E75 D;  1SQV D;  5BVZ A;  2NRG A;  5AVU B;  1VQK P;  1RF0 A;  3GTE A;  4IL6 H;  2E5T A;  5GTI H;  1FZC C;  4BRY A;  1BCC J;  1YYC A;  3KQG A;  4ASV A;  4NPD A;  3BCC G;  3G6E P;  1SFC D;  5APT A;  3GB4 A;  4QMA A;  3TGU D;  1H8A A;  2OYO A;  3RBX A;  3H1H G;  3B5N C;  5AW2 B;  2WMM A;  4UB6 H;  2C9L Y;  1L0N J;  1GMJ A;  2ZT9 C;  1FZF A;  4HM3 A;  2HMM A;  1OZH A;  1YIJ P;  2JWA A;  1ZRT D;  1OVU A;  3G71 P;  4C7N B;  1OW6 A;  3L73 J;  5APQ A;  1SP4 A;  2BMO A;  4RKU J;  1GL2 C;  1KTM A;  1USE A;  1UUW A;  5CHX A;  2CPB A;  1JMB A;  5DJU B;  3PRJ A;  2E74 D;  1AA0 A;  4EDF A;  1Y9B A;  4XE5 B;  3TK1 A;  1NU1 K;  2FFD A;  2R5B A;  3L72 E;  1DEE G;  1T6A A;  2YFL A;  2I7F A;  3AE8 C;  3E7K A;  4NPF X;  1GL2 B;  4L75 A;  4NBB D;  2HOD A;  3TNU B;  4HYT B;  5L8R J;  1BSN A;  1W2B O;  1NAF A;  1P84 E;  1SQB D;  2KZJ A;  2XV5 A;  2OYI A;  3VMI D;  2QJK C;  3RL0 D;  5KAF E;  4C7R A;  1NTM E;  3G4S P;  1DD4 A;  3HE5 A;  5AEW A;  1JY2 O;  1IFM A;  1PGO A;  1FZG A;  2XRX A;  1RH5 B;  1WQL A;  1VL2 A;  4DZO A;  1PPJ E;  1T3J A;  4AQR D;  2RH0 A;  1NU1 G;  1UII A;  3C8V A;  3NTN A;  5AVT B;  4MN4 C;  3IN6 A;  1O7M A;  1SQP D;  4I1L A;  4XA4 A;  3HE4 B;  2HLO A;  3L35 A;  2WSC J;  1H0T B;  1JCC A;  1G1I A;  3VMA A;  1BDD A;  3BVH A;  3NXS A;  2YXQ B;  1BE3 D;  3HD7 B;  1FDI A;  1HUC A;  2NPS A;  4RJT A;  2HPC A;  1IZN B;  3H1L E;  1LTA C;  1G8K B;  3VMG D;  2ZYL A;  2Y0C A;  1URQ D;  2FYU K;  1BSH A;  2D2C C;  2HFE D;  3MIW A;  2JJL A;  1FC2 C;  3SWK A;  1EZV G;  4PD4 D;  1L4A A;  4D6T D;  3H1J D;  4I6M C;  3RGU A;  3ITK A;  2IZ1 A;  3IAO A;  1FBM A;  1YIT P;  4QUR A;  1EQ7 A;  1ZLL A;  3CCV P;  1ZR4 A;  3B5N D;  1SQQ E;  2FXM A;  4TT3 H;  1S72 P;  2BCC D;  2M8R A;  3V6I A;  2NVG A;  3AEE C;  3M91 A;  4U3F D;  1LP1 A;  3CC2 P;  4RO0 A;  3CX5 I;  2R5D A;  4EMJ B;  1LWU C;  1NGM B;  1GL2 D;  3PTZ A;  4RES B;  2BAS A;  2FYU G;  2M0B A;  3HUS C;  5TIS H;  1DEB A;  1G1J A;  1NAY A;  1FU1 A;  1X22 A;  2KXP B;  5KLI C;  3L75 D;  2AXC A;  4HKV A;  1LWU B;  2B87 B;  3H1K D;  2JDI H;  3CCL P;  1L0L D;  1CW5 A;  4HM1 A;  1S1C X;  1VF5 B;  3FWN A;  1LNQ A;  5GTH H;  1QEX A;  1SQV J;  1O7P A;  1NTK D;  2KSJ A;  3WU2 H;  2KLU A;  4UB8 H;  1ZW0 A;  2MKV A;  2BEQ D;  2W83 C;  1BCC D;  5HL4 A;  1WT6 A;  3IFM A;  3SFE C;  1KFN A;  1S4X A;  2CK3 H;  3TDK A;  3TGU J;  4NBE D;  2DE6 D;  2CKF A;  1H0T A;  3VMH D;  3O6Q A;  2RMZ A;  2OYH A;  5AW0 B;  3L71 J;  1R5S A;  2E4Q A;  1L0N D;  3CCR P;  1OX3 A;  1VQ7 P; 
#chains in the Genus database with same CATH homology
 2XSO A;  1RIE A;  4AIV A;  3L71 E;  2NVG A;  5AEW A;  1PP9 E;  4AAY B;  2FYN C;  4HM8 A;  2XRX A;  4H44 D;  3H1H E;  3L75 E;  2FYU E;  1NTZ E;  1WQL A;  3DQY A;  4HM7 A;  3CWB E;  4QDF A;  3H1K E;  1ZRT E;  3GOB A;  4HM0 A;  5BOK A;  4EMJ B;  2BMQ A;  1PPJ E;  1L0L E;  1BE3 E;  1BCC E;  4H0L D;  1NDO A;  3GB4 A;  1VF5 D;  4QDD A;  3GKE A;  2QJY C;  2DE7 D;  3FOU A;  2YIU C;  1O7M A;  2JZA A;  2E76 D;  3CX5 E;  4NB8 D;  4HM5 A;  2HMJ A;  1EZV E;  4NBH D;  5CXM A;  3VCA A;  1NTK E;  3C0D A;  1JM1 A;  2BMR A;  1KYO E;  1RFS A;  3CXH E;  2IBZ E;  1EG9 A;  1SJG A;  3D89 A;  5KLI C;  3GTS A;  4HM3 A;  2D2C D;  5KLV E;  2HMM A;  4NBD D;  2A06 E;  4HKV A;  2GBX A;  2DE5 D;  2GBW A;  2YFI A;  1L0N E;  4HM1 A;  4PD4 E;  1O7W A;  2BCC E;  4D6T E;  2BMO A;  3H1J E;  2JO6 A;  2YFJ A;  4HJL A;  4P1B H;  1NYK A;  4PV1 D;  1Q90 C;  1UUW A;  4U3F E;  1FQT A;  3L74 E;  2QJP C;  3H1L E;  2E74 D;  2Q3W A;  1G8K B;  3L73 E;  1BGY E;  1SQB E;  1O7G A;  4HM6 A;  1O7P A;  3VMG D;  5KKZ C;  3L72 E;  1UUV A;  2ZYL A;  1ULJ A;  2YFL A;  4H13 D;  4P1C H;  1O7H A;  1G8J B;  3TGU E;  2NVE A;  2B24 A;  4QUQ A;  2NUM A;  3EN1 A;  2I7F A;  1SQV E;  4NBF D;  5HL4 A;  3BCC E;  2HMO A;  4NBC D;  2NUK A;  2YVJ B;  2QPZ A;  2E4P A;  3L70 E;  3GL0 A;  1NU1 E;  4NBB D;  4QCK A;  2ZT9 D;  3N0Q A;  3GCE A;  2XR8 A;  1VM9 A;  4QDC A;  1O7N A;  4NBE D;  4QDF B;  3EQQ A;  2DE6 D;  2CKF A;  4NB9 D;  3AZC A;  1P84 E;  4OGQ D;  2HMK A;  3H1I E;  4HM4 A;  3VMH D;  4NBA D;  1KB9 E;  2XSH A;  2HMN A;  1ULI A;  2B1X A;  2HML A;  4QUR A;  3VMI D;  3GL2 A;  4HM2 A;  2QJK C;  3VCP A;  2E4Q A;  1SQX E;  2E75 D;  2NVF A;  1VCK A;  4NBG D;  2NWF A;  1SQP E;  3GZX A;  5AEU A;  1SQQ E;  3GTE A;  1NTM E;  3GZY A;  4QUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...