2A08A

Structure of the yeast yhh6 sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
b'AMATAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVRVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 41.8 kDa protein in SPO13-ARG4 intergenic regio
molecule tags Protein binding
source organism Saccharomyces cerevisiae
publication title 3-D proteome of yeast SH3 domains
rcsb
total genus 10
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a08A00
1SSHA 1WXTA 4OMPA 4ESRA 2KXDA 2CT3A 2K7AA 1TG0A 3RNJA 2ED0A 1S1NA 2JXBA 2OAWA 4RTZA 4CC2A 1QWFA 2JMAA 4OMQA 4OMNA 1WI7A 2V1RA 3THKA 1I07A 2FPEA 3REBB 1G2BA 4JJBA 2CSIA 1YWOA 3RBBB 2SRCA 4AFQC 2ESWA 2O9SA 1AZEA 1QKXA 1QWEA 1XOVA 2RN8A 2JW4A 4J9IA 1Y57A 3EG3A 1WLPB 1AWXA 1TUDA 3VS5A 1FYNA 1Z9ZA 3QWXX 2LJ0A 3IQLA 1SHGA 2E5KA 4JZ4A 1NYGA 1NLOC 1SPKA 3VS1A 1QKWA 1NG2A 1M3AA 1T3SA 2OI3A 1W1FA 2K3BA 1RUWA 4JZ3A 5GJWB 1X69A 2D8JA 2EPDA 4A63B 4AFZC 1E6GA 2W10A 1QLYA 2JS0A 2EGAA 1I1JA 3H0HA 1AOJA 1ARKA 2J6OA 1U06A 2DX1A 1GFCA 2F2VA 2BZ8A 1UUEA 4LUEA 5FWCA 2YUNA 1ZUUA 4K11A 2YSQA 3VRYA 2EYWA 1X27A 3KFVA 1CKAA 2CH4W 1VYUA 1W6XA 5EC7A 2AKLA 2A08A 2L2PA 4LE9A 2DVJA 2ROLA 1J3TA 1K9AA 1OEBA 1ZUYA 2JS2A 2CDTA 1VYTA 3C0CA 3VS7A 1V1CA 4AG2C 1RLPC 1OPLA 2A36A 1X2KA 2LQNA 2KR3A 3TSWA 3SEMA 3H0FA 1VA7A 4IIOA 4J9HA 1NM7A 2V1QA 2RF0A 1KSWA 1SEMA 4J9CA 2DL5A 2EBPA 3LH5A 4OMOA 2DYBA 1OPKA 2LCSA 4CC7A 1AVZC 1I0CA 3EG2A 1UFFA 3UATA 4ORZA 3CQTA 2HCKA 2RQRA 1Y0MA 1SRMA 4Z88A 4J9FA 2K6DA 1YCSB 2LJ1A 1BB9A 1JO8A 1PKSA 4CC4B 2ECZA 1K76A 2YUQA 1RI9A 1WYXA 4E6RA 5IXBA 5IXFA 2FRYA 1WDXA 1A0NB 4RTYA 1EFNA 2EYZA 4HVVA 1VYVA 2W0ZA 1M30A 3M0RA 1K0XA 2KROA 1AEYA 2ROTA 4HVWA 2K79A 2KGTA 2KBTA 2RQTA 2RNAA 2DF6A 2KYBA 2O88A 3M0TA 4RTVA 3REAB 4LNPA 2ABLA 2RQVA 1U5SA 1LCKA 3SHWA 3U23A 2DBKA 2D0NA 3VS4A 2L0AA 1PRMC 2EQIA 1B07A 1JQQA 2PZ1A 1NEBA 2YT6A 1JU5C 2CT4A 5IHKA 4AG1C 4GBQA 4EIKA 4IIMA 4RTWA 1ZSGA 1ZUKA 2JMCA 5HCKA 2O9VA 1GBQA 1AZGB 1OOTA 1H92A 2GTOA 1PKTA 1QCFA 4J9EA 1IO6A 2D1XA 2HBWA 1GRIA 3EHQA 1UJ0A 3NPFA 1BK2A 2DJQA 4GLMA 4F16A 2C0OA 5IHNA 3PVQA 1K4US 1T0JA 2LZ6B 3H41A 2HEQA 4JPBW 2X3WD 1H3HA 2G6FX 2JT4A 1YNZA 3M0UA 1MUZA 5ECAA 2F2WA 2KT8A 2LNHB 1WXBA 3PVLA 2J05A 4ZNXA 3H0IA 2FRWA 4JJCA 4DEYA 2F2XA 4RTXA 4RUGA 1ZLMA 1M8MA 2MIOA 1GFDA 2DILA 2GBQA 2LMJA 4JJDA 4Z8AA 2O31A 2J6FA 1YN8A 2QDLA 5FWBA 2OJ2A 2DL7A 1AWJA 1MV0B 2BZXA 2LQWA 1PRLC 1Z9QA 2J06A 2CUBA 2EW3A 3EGUA 4M4ZA 4X1VA 4F17A 2ED1A 3ZL7C 2DL8A 3JV3A 1ZX6A 2EYXA 4RTUA 1UHCA 2SEMA 4OMLA 3R6NA 2CREA 4D8DA 2EKHA 3I9QA 2C0IA 4OMMA 2PTKA 1UTIA 4DEXA 2CUDA 1ABOA 1MV3A 1M3CA 2GGRA 2L3QA 5IHIA 1YP5A 2DMOA 1M27C 1PHTA 1T3LA 3NHNA 1HJDA 2K2MA 1JEGA 3M0QA 3EHRA 3UA7A 1JXMA 1X43A 1OV3A 2FO0A 4J9DA 2NWMA 1JXOA 2ENMA 1G83A 3NMZC 2DA9A 1X6GA 2AKKA 2KRSA 1W70A 2FPFA 2EYYA 2HSPA 2A37A 1N5ZA 2FPDA 4LUDA 4Z89A 1K1ZA 1KJWA 2K9GA 3I35A 2GQIA 4HCKA 2NUZA 2AZVA 4LN2A 1ABQA 2EGCA 2RMOA 1UG1A 2DRMA 1B3QA 4AFUC 1KFZA 1NYFA 3O5ZA 2AZSA 2L3SA 1GCQA 3I5SA 2FG0A 5FW9A 5IH2A 2DBMA 1K0SA 2DE0X 1PNJA 4CC3A 2LP5A 4WCIA 2DNUA 5I22A 2O2OA 2CH4A 1X6BA 1ZBJA 2GNCA 4AFSC 3VS6A 2BTTA 1WX6A 3FJ5A 4HVUA 3VS3A 1GCPA 1X2QA 2J6KA 1HD3A 3UA6A 1SHFA 1GBRA 5L23A 2LX7A 3TVTA 3VS0A 1CKBA 2KE9A 1E7OA 3ULRB 3NGPA 2LJ3A 2JM8A 3EG1A 3GBQA 1YWPA 2M51A 2EVRA 1PWTA 3QWYA 1UE9A 1KIKA 2FEIA 1T0HA 1GCQC 2P4RA 1WA7A 1UHFA 2JTEA 2I0NA 1FMKA 2D8HA 4FSSA 4D8KA 2RQWA 1CSKA 2EGEA 3M0PA 2YDLA 3A98A 3VRZA 2YUOA 1E6HA 2DRKA 1WIEA 2DLPA 1WXUA 2KT1A 2VKNA 3PE0A 2H8HA 2L3PA 2C0TA 2DM1A 3M0SA 2DL3A 1UECA 1NLPC 1UDLA 4KRTA 4J9GA 3UF4A 2CSQA 1UJYA 4F14A 2JM9A 1M3BA 1RLQC 1SRLA 2AK5A 1BU1A 2IIMA 2KYMA 2KRNA 1U3OA 2BZYA 3VS2A 1NEGA 3TSZA 4QT7A 1AD5A 1TUCA 4HXJA 1AWWA 2KEAA 2J7IA 5GJVB 4RTTA 2KRMA 2VVKA 5I11A 2A28A 2KNBB 2RPNA 1WFWA 3EG0A 2MOXA 1AWOA 4R0KA 4J9BA 1HSQA 2DL4A 2X3XD 4Y92A 2RQUA 1BBZA 2XMFA 1GL5A 1UGVA 2HDAA 2GTJA 2KXCA 2M0YA 2YUPA 2MCNA 2B86A 2VWFA 2PNIA 3I5RA 1H8KA
chains in the Genus database with same CATH superfamily
2BE7D 4TVRA 1N6AA 4FCYA 2CT3A 2M9UA 2JXBA 7AT1B 3CCUA 3OYFA 4PJOF 4C92B 3LYIA 1QVGP 2EJ9A 4CC2A 4C92G 1B34B 1IHWA 5KYYA 3GNGA 2X51A 2V8JA 3OS0A 3REBB 3G6EQ 4PJOB 1G2BA 4F04B 4KULA 2VXEA 2ESWA 3FJPA 1QKXA 2DEQA 3PT9A 4NOYA 4LD9K 2X9HA 2RN8A 2QQAA 4OMFB 1D1BA 3DLLA 1XTDA 3RKYA 3ZFJA 3JB9I 1KC8C 3WVDB 3L2RA 5LJ5f 1NYGA 1SPKA 2PUOB 2RD1A 3P8HA 3S3NA 2QQBA 4M7AB 1NG2A 5D6YA 4F7UE 1H641 2BIVA 1VQ4A 1RUWA 5GJWB 1N8RR 2DO3A 2VGMA 2DAQA 3BY7A 5KYWB 2RK1A 3EGXB 2J6OA 2D9TA 1QVFS 4A54A 2OTLQ 3OMCA 1MMNA 5FWCA 2YUNA 3RUXA 4K11A 5CKHA 2YSQA 4NL3A 1X27A 3OYIA 1Y96B 4BDYA 1I4K1 2QQ9A 8AT1B 1K9MR 3L1AA 2ROLA 2L89A 2P4TA 1VQPQ 3FEOA 1OEBA 1Q7YU 1K9MU 2CDTA 1VYTA 5LJ5j 1RLPC 3EGDB 3HHTB 2PQWA 2CZ7B 1YFNA 4BY6C 3H0FA 2AIRB 4MZPA 2V1QA 2E70A 2DL5A 2XU8A 1RABB 2DYBA 3VU3C 2R5AA 3VYGA 4OB2B 3KXTA 2LCSA 1AVZC 3J7AF 4LDXA 4OP0A 2ATCB 4XQ3A 4C8QF 1QVGS 4E6RA 2YUQA 4HT9A 4M7AF 2RO0A 1PM3A 1IHVA 2FRYA 1VQNQ 4RTYA 3MJXA 1K8AU 2M02A 4LDYA 2XI9A 1VYVA 5GAMj 3E19A 2ROTA 2JJ9A 4Z02A 3Q1JA 3CCRT 4BACA 2E6ZA 4LNPA 3DLMA 2QA4Q 3SHWA 2ZPBB 2AT1B 2D0NA 2DTHA 2PU9B 4KT0E 5LJ3h 4R55A 1C0MA 1JQQA 1M1GA 2PZ1A 1TSFA 5GAMg 4XTUA 3EFOB 4JDSA 2RJFA 2JMCA 2O9VA 5D7UA 1RAEB 1P92A 1H92A 4C92D 2D1XA 5FU6C 2HBWA 1GRIA 3CPWA 3M5AA 3NPFA 5GMKm 1TXQA 3LGLA 3OYMA 5CKFA 3PVQA 3CCEA 2LZ6B 1QCNA 1OQKA 3J81E 1M9SA 3H9NA 4JPBW 1VQ8A 1WHJA 4N4GA 3JCMb 3M0UA 4BE1A 2LNHB 2J05A 3LWHA 2NUTB 2M16A 3CBPA 3CCQT 3CMAA 1YJNA 3SWNB 4C0DB 2XKOC 4PKCC 4HT8A 1QCOA 4PJJA 2RJDA 1N9SA 4XU1A 1EIFA 3OW2P 3O8VA 1BI0A 4JJDA 3OSSC 1BCMA 3SB2A 2O31A 2J6FA 2CYZB 5FWBA 4M7AA 4MMKA 2QASA 3F70A 4R56A 1IXDA 2DL7A 4FT4A 2DVEA 3M59A 5J26A 2ED1A 1Q7YC 2CS7A 3CC4A 2KAFA 1TS9A 1Y07A 3JCMh 2C0IA 2CKKA 3DB3A 1W2BS 1AHJB 3JAME 2WSCE 4WF2A 5KCOA 3UWNA 3MPUB 1M3CA 2L3QA 2XDDA 3AHUA 5IHIA 1M27C 1Y96A 2K2MA 5HK3A 3M0QA 1S72T 1OV3A 5KYNA 3OY9A 2FO0A 2VXFA 4PJMA 1TWBA 2DA9A 4IKFA 1X6GA 4E47A 2E5QA 2KRSA 3WXMB 4C92C 2KK4A 3S6WA 4OGCA 3EG9B 4LUDA 3CC7T 2EQUA 1K1ZA 4M77D 3I35A 2LVMA 1WNLA 1PG5B 4FYXB 4HA8A 2RMOA 3JB9D 1B3QA 3NFCA 4ZN1A 2MPXC 2AZSA 2BKDN 1MMAA 1VQKT 1NJIC 1RAIB 5GAOp 3META 4ELYC 2DBMA 2DE0X 1M1KU 4PFPA 4OVAA 4ME7A 2DNUA 3I55T 4AFSC 1VQLA 4PJOA 1N8RU 3FJ5A 4ZGJB 2KMTA 1SHFA 1GBRA 5L23A 3VS0A 4FU6A 3CMEQ 1Q82U 4EMKA 2HL3A 3OYEA 4B9XA 1E7OA 4JS5A 3ULRB 2H3JA 3HFOA 4DQ2A 3EG1A 3GBQA 4ZN3A 1YWPA 2GFUA 3QUIA 3EG9A 3CCQQ 1HK9A 5IAYA 2EJFA 3LX7A 2VB6A 5A0LA 2V26A 1FWZA 2P0PA 4FSSA 3JCMJ 2RQWA 3CCJA 4JLGA 3M0PA 2CP5A 3A98A 3ASKA 2HKQB 2EQJA 1WZOA 3PE0A 5KYYB 3RIRA 1NE8A 3M0SA 1ZSZB 1PD0A 2EQMA 2HZYA 2JOYA 2RI5A 3CCVQ 5CVIA 3RKXA 4M78B 1IB8A 1VQ7Q 4HCZA 1RAHB 1BIAA 4B6MA 1SRLA 1OX8A 2DXBA 3A1PA 1ZBXA 5IT9E 1LNXA 1U3OA 3EH2A 2BZYA 3QYGB 6AT1B 2HQXA 3VS2A 3JCMf 3C95A 3TSZA 2OX7A 2QEXQ 2EIFA 2L3RA 2E4HA 3VJPA 1WJQA 3E2UA 1RAFB 1S72Q 5I11A 3CXCS 1R0CB 5LL6S 3QPHA 1YCYA 2XD0A 2R58A 4Y28E 2DL4A 3M58A 3FDRA 2WSFE 1QVFA 1IGUA 1YJ9A 5CK9A 1YI2T 3CCUQ 2GTJA 3JRZA 2MCNA 2WSEE 2YLBA 1OZ3A 5CCAA 1K73C 1X75C 4NS5A 1X01A 2X4YA 2O01E 5CO7A 4C8QD 4ESRA 2KXDA 1IGQA 4M75A 3RNJA 4M7DF 3MO8A 4BI4A 4ZGEB 2L5QA 2JMAA 4M78E 2KDSA 1YIJT 2EYQA 3M56A 2D0QB 1YITT 4PJOD 3THKA 1I07A 3OB9A 1D0XA 3TQ7P 3CC2Q 1XJWB 2SRCA 4RKUE 4PJOC 1AZEA 4LXCA 4M7AG 3OQ5A 1MMDA 4J83A 2JW4A 1YHQA 4J9IA 1Y57A 2E41A 1WJRA 3OYGA 4C8QG 3QZ9B 3TCJA 3OYLA 3PTAA 2QXFA 4MDXA 1OX9A 1SHGA 2JUFA 4M75B 4JZ4A 1G3TA 1NLOC 1QKWA 4OB1B 2XG8D 2RM4A 4M75C 1JJ2A 4M7DG 2P84A 4M77A 5KYUA 2OI3A 4N0AC 4X9DA 1MMGA 1W1FA 3CCLT 1O9SA 3GOXA 4AFZC 1VQMT 4XTYA 1YITQ 1QLYA 2K3YA 2DKGA 3HRSA 1I1JA 2RHIA 5GAN2 2DX1A 2CP6A 1UUEA 3X28B 4LUEA 2E3HA 2K5IA 5C6SA 2HAXA 1W6XA 1KQSP 2AKLA 3CCEQ 2L2PA 5AT1B 3MEUA 1B7TA 1QVGA 2X35A 1K9AA 1SSFA 4D6WA 3C0CA 3JCMg 3NTIA 3BFMA 4E7JA 1V1CA 3UPUA 3MCAB 1OPLA 2ZPGB 2DPPB 3TSWA 2LCCA 5LJ3g 3SEMA 1G3SA 2DIQA 2JZ2A 3ER0A 2KY9A 4M7AD 1SEMA 4J9CA 2EBPA 1I8FA 3LH5A 3J80E 3EGDA 1WQWA 3PIOA 2FVUA 1Q81U 1I0CA 3L42A 3EG2A 3QSUA 3UATA 5FRNA 3G71A 4Z88A 4KH0B 4J9FA 3HPWA 1YCSB 3GIBA 2LJ1A 1JO8A 2E65A 1NJIU 1VQ7T 1U1SA 5IXBA 2EFIA 2DJZA 3GNFB 2HMAA 2ZCFB 2DK3A 1WDXA 4KUIA 1A0NB 2NYSA 5LJ3e 1PD1A 1JBMA 2EJGA 1O75A 2EYZA 1R8OB 2GCXA 4HVVA 3ZBDA 2F69A 3BE3A 3M0RA 2KROA 1K0XA 4HVWA 2K79A 2KGTA 1YHQQ 4M7AC 3JCMe 2KBTA 2RQTA 3FLGA 4PJOG 2O88A 3M0TA 2ABLA 4C92E 1U5SA 2O4XB 1K73U 3U23A 1YJWQ 2COWA 2EQIA 2X4JA 1QVFP 3QHSA 2XIDA 1YJ9Q 2RI3A 4C92A 1Q81C 5IHKA 4AG1C 4IIMA 1LOJA 2B8AA 3MEVA 4C8QB 5GANg 1UGPB 1ZSGA 2OTJA 1M5Q1 1ZUKA 2A3LA 2NUPA 4X9CA 1GBQA 4WTOB 2QG9B 2GTOA 3HFNA 2G3RA 1KHCA 3JB9F 4M7DB 5LJ5g 4HCCA 5LJ5d 3GF5A 2CGHA 2V8IA 4OGEA 4F16A 5DY9A 5FLXE 1T0JA 1FX7A 3H41A 5I2MA 4E7HA 1H3HA 2LT4A 4FL6A 4EMHA 1D0YA 2JT4A 3LW5E 4QVZA 2KT8A 3E9GA 1WXBA 2MF2A 1VQ5T 3A8LB 2FRWA 4JJCA 4OF1A 1YITA 4C0ZA 5GANf 3BW1A 3V7RA 3MKDA 1RI0A 1GFDA 2DILA 3CCMA 1H3ZA 4IUTA 2NUPB 3DKMA 3HSBA 4PNOA 1WGSA 3I56Q 5CQXA 5GAOr 5DLOA 1Q81R 1M2OA 4C8QE 1OU9A 3M54A 5DM7R 3V7CA 2BZXA 4M78F 1PRLC 1Z9QA 4F17A 4XK8E 3ZL7C 2E10A 2DL8A 4M7DE 1OU8A 1UHCA 2SEMA 3R6NA 2HD0A 2DZ9A 5GAN3 4MMLA 2VYTA 2Y4YA 2EKHA 3CCJT 4OMMA 3RESA 2YRVA 4BDZA 5FU7B 1OYXA 1VQ7A 4DEXA 2CUDA 3CCET 2GGRA 1UGRB 3G4SA 1YP5A 2DMOA 1PSEA 1PHTA 3NHNA 4FT2A 3KBGA 1K8AC 1VQ8Q 1JEGA 3UA7A 4RCBA 2K5FA 4L59A 2QAZA 4Q5WA 1VQKA 3CBMA 4BI8B 1G83A 4DBQA 2E6NA 3KUFA 3SDZA 1KQ1A 2VGNA 1N5ZA 3I55A 1KQ2A 2ZPIB 3OYNA 3CCLQ 2GQIA 4HCKA 2NUZA 3L2ZA 2COYA 4C8QC 5GMKi 1UG1A 5GMKj 1KD1R 3X24B 4AFUC 4P5NA 1KFZA 3CCRA 1NYFA 2OAUA 4QVDA 1ACMB 4UC4A 1ZHIA 5I21A 5FW9A 1K0SA 4BI3A 4E2FB 1KD1U 2LP5A 1PCXA 1M90R 3PNWC 2O2OA 2DXCA 3OW2S 3CC2T 3VS6A 2BTTA 1WX6A 4HVUA 3VS3A 1X2QA 2J6KA 1HD3A 3CCQA 4J7IA 1YHQT 2LX7A 3RR6A 1CKBA 4J8OA 3CCLA 2KE9A 4BE0A 3UDCA 3L2WA 4FYVB 3MP8A 2M51A 3CCMT 1PWTA 3CCSA 3QWYA 2DTOA 1NZ9A 2E64A 2FEIA 1WA7A 1UHFA 2JTEA 1K9MC 3JCMQ 3QDRB 1G8XA 1M2VA 2EGEA 2YDLA 5HKCA 1OZ2A 3OYBA 2KT1A 4A53A 1Q82C 2L3PA 2DM1A 2DL3A 1UECA 1NLPC 1TU0B 3JCMd 5GAOl 2HKNA 1MNDA 4EPCA 3HRUA 1KD1C 1UJYA 3E1SA 1YI2A 1M3BA 2QTVA 1QQJA 1VQ6Q 2KYMA 5GANd 2KRNA 3FRNA 1VQNT 4E7KA 3SWNA 3PMTA 1NEGA 3PIPA 4XU3A 2CP2A 2LQ8A 4RTTA 3MP6A 2A28A 4M77B 1IRXA 2MAMA 1WFWA 1AWOA 4R0KA 3JSCA 4F7UA 3V7SA 3M53A 4J6XA 4PJLA 4Y92A 4FW1A 2RQUA 3RMQA 2HDAA 1VQ9T 3S3OA 2KXCA 2M0YA 2RB6A 1I5OB 4RMOA 4ANJA 2FHDA 4IUPA 2VWFA 2RH2A 1D3BB 2K3XA 4OMPA 4ZTJA 4A4GA 2K7AA 5FROA 3EH1A 4M77C 2OAWA 1VQPT 1LJOA 2OTLT 5J39A 2FL7A 4PL6A 1QWFA 2QK0A 3MHXA 5KYXA 2GQVA 4OMNA 1WI7A 2YLCA 2FPEA 3OW2A 4JJBA 3I55Q 2Y4XA 2ZPEB 4IUQA 1XOVA 4J6YA 1AWXA 2E12A 1TUDA 2ZPFB 1FYNA 1VQ8T 4DOVA 3QWXX 4CRIA 2E5KA 1BIBA 4C92F 2KSSA 4AMCA 2K2VA 3CD6T 3VS1A 1MGQA 3FIFA 4KGVB 1M3AA 1S72A 4XTWA 4E7SA 3MEWA 3CC7Q 4A63B 1K8AR 4CI0C 2W10A 2EGAA 4OB0B 1AOJA 4BE2A 1U06A 4IUUA 5HY6A 1GFCA 2X4XA 3OYCA 2BZ8A 1Q86U 4JJNK 4IUVA 3OS5A 5GAMe 4GLKA 2EYWA 3KFVA 8ATCB 1TUGB 2CH4W 2BUDA 2VUBA 4MZTA 5EC7A 3CCSQ 3M57A 3CCVA 1M4ZA 3BDLA 1J3TA 3L2VA 2F1LA 1ZUYA 1HYOA 2JS2A 1VQOA 1RACB 2EQKA 3VS7A 4AG2C 3CC7A 1X2KA 2DXUA 3RERA 2KR3A 4C5EA 1PSFA 2DETA 5FU7C 3EFSA 1VA7A 1VIFA 4IIOA 3PGGA 4J9HA 2YRCA 3HP9A 2RF0A 1YJNT 3RDVA 1RL2A 2JN0A 3CCVT 1KC8U 2FZCB 3CQTA 5FU6B 3TEEA 1Q86C 1SRMA 2DD4A 4QQGA 4XTVA 1PKSA 1RI9A 1WYXA 4MDWA 4EMGA 5IXFA 4LDWA 4XU0A 2OTJT 2FYKA 5CKDA 3AT1B 2BE9B 9ATCB 1AEYA 3EFOA 1YJWT 4J6WA 2RNAA 2KYBA 2CP7A 4RTVA 3REAB 3LH0A 2RHUA 4M78G 1LCKA 4PJNA 2DBKA 4QQ6A 3G4SQ 3VS4A 1PRMC 4JRQA 1WHHA 1TH7A 3D7SB 3OSVA 3L2QA 4DA4A 1NEBA 1WQ7A 1KQSA 3OS1A 1JRIA 4GBQA 1VQKQ 4EIKA 4M7AE 4A4HA 2XHCA 5D6WA 2KVQG 3SFMA 1AZGB 1OOTA 4OB3B 4J9EA 1KQSS 2QGFB 2PVGB 3EHQA 1UJ0A 4M75G 4M7DC 2RI2A 1WHKA 2LC4A 4GLMA 1I81A 5IHNA 2RHZA 2H3EB 2R57A 2X3WD 3DB4A 3INZA 3CBOA 4E7LA 4DBHA 2G6FX 1MUZA 1N27A 4FIBA 2F2WA 4KGXB 3PVLA 4M75D 4ZNXA 3H0IA 4C8QA 1JB0E 2IVWA 1D0ZA 2K4YA 3A5ZB 1N9RA 2F2XA 2LQKA 3JB9G 4RTXA 1AT1B 3RKWA 4BUGA 4ATOA 1VIEA 4RUGA 2LNVA 4BB7A 1RADB 4JRPA 3S3MA 4M7DA 1EZZB 2VASA 5A2QE 2MIOA 2GBQA 2LMJA 2GFAA 3CPWP 2FZGB 5EG2A 1YN8A 2QDLA 2FZKB 1VQPA 4DBFA 2OJ2A 4XTXA 1G3WA 1X6OA 1F1BB 2GF7A 3OYJA 3JB9H 2J06A 2LT1A 2CUBA 4M4ZA 4X1VA 3WVEB 1W2BA 3V8KA 1U8RA 3JV3A 2E1HA 2EYXA 5HK0A 4OMLA 4C0DC 2F5KA 2RHXA 1RAGB 2CREA 4D8DA 2HNIA 4RG8A 1VOMA 3JCMW 2C06A 3G71Q 2PTKA 1UTIA 1B34A 3CC4Q 1D1AA 5KE2A 3OMGA 2P0QA 1T3LA 1KC8R 5GAN7 3HTRA 1X43A 3G1JA 5GAOn 2MWPA 4J9DA 1DJ7B 2NWMA 2ENMA 3C94A 1KK7A 3NMZC 5I2SA 1ZQ1A 1VQNA 2AKKA 2KI7A 2FPFA 4DOWA 2CZ1B 2HSPA 1EX4A 2XDPA 4A4FA 1QMCA 4C0GA 2AZVA 4JLIA 5GAN5 4LN2A 1WHMA 1ABQA 2EGCA 4N0AA 1M1KR 1G5VA 5CR2A 1QVPA 3QYHB 3O5ZA 2QQRA 1GCQA 1SF9A 1OI1A 3I5SA 2XDBA 2ZPHB 3OYKA 5IH2A 1PNJA 4KUDK 4FSXA 3CMEA 5I22A 3EFRA 1X6BA 2LDMA 3G6EA 1GCPA 1V29B 3UA6A 5GMKl 1VQ4T 1VQLQ 1BI1A 3NGPA 4QQDA 3JCMc 2LJ3A 2M0OA 2KQWA 4VUBA 3QG1A 2RHYA 2COZA 1UE9A 5DLQE 5C0MA 4ZTFA 3M4YA 1NPRA 1GCQC 3OBWA 2P4RA 4II1A 1VQOT 1FMKA 1IZ6A 4LD6A 3TREA 4FM4B 1C1AA 3VUZA 1CSKA 2LCLA 1WIEA 2CP0A 2DLPA 2R5MA 2VKNA 1YIJA 2H8HA 3CCMQ 4KBMB 1BI2A 4KRTA 4J9GA 5GAOq 3CXCA 3UF4A 3L2UA 1QP3A 1M1KC 1BCOA 4L5GA 4F14A 4A4EA 3PFSA 1RLQC 3R6OA 1BU1A 2CP3A 4N4HA 2A7YA 3P8BB 2FB7A 4XTZA 3CEYA 5L8RE 2DZCA 2HQEA 1BKBA 3NTKA 1AD5A 4HXJA 3JCMV 2EKOA 2KEAA 1UB4A 1SKUB 2J7IA 2KRMA 2KNBB 5GANe 3G4ST 4C0FA 1BI3A 4J9BA 2X3XD 1GL5A 2XMFA 1UGVA 1LPLA 2DERA 4PFOA 2EWNA 2AHJB 2RA2A 2YUPA 3OBYA 2PNIA 1Y71A 3I5RA 1H8KA 2Z0WA 4M78C 1KG1A 1SSHA 1R0BG 4JRKA 2OTJQ 1WXTA 4B9WA 4EMKC 3V8LA 5KE3A 1TG0A 1D1CA 2ED0A 4JRIA 1S1NA 4RTZA 1VQ6A 2DIGA 4OMQA 1WJSA 4RG2A 4RCCA 2V1RA 3URGA 2CSIA 5GAMd 1YWOA 1HXDA 3RBBB 4AFQC 2O9SA 3CPFA 1QWEA 1YI2Q 5GAN4 1W2BP 4PK4A 3EG3A 2NUTA 1WLPB 3JCMP 3VS5A 4FYYB 1Z9ZA 1ZA1B 2LJ0A 3OYYA 2VV5A 3IQLA 1UEBA 1ZSZC 3QIIA 3JB9J 4BD3A 3QJ6A 2WACA 5KYWA 1T3SA 2QEXT 3H6ZA 5GAN8 2K3BA 3OA6A 4JZ3A 1X69A 5LJ3f 4IURA 2D8JA 2EPDA 3TU4K 3CCST 3P8DA 1E6GA 2DYIA 3X26B 2JS0A 4HCBA 2MI6A 3H0HA 1M90U 1ARKA 3LGFA 1NPPA 2F2VA 1Y7XA 5GMKe 4Y91A 1ZUUA 3CMAQ 1V76A 3VRYA 4ELZC 1CKAA 5KH6A 1VYUA 4E7IA 1ZSZA 2RK2A 2M1HA 3VV0A 3H8ZA 2A08A 4LE9A 2DVJA 3CMET 2ZAEA 2OTLA 1M90C 3VUBA 2QDYB 5CIUA 1IREB 3A8MB 2A36A 5GAN6 2LQNA 2CZ6B 2JVVA 3FB9A 4LDUA 1YBYA 2X4WA 2QA4A 1NM7A 2XICA 1KSWA 2LRQA 3RMSA 1R77A 4OMOA 1Q7YR 1OPKA 4CC7A 4M77E 1UFFA 4ORZA 4QW2A 2HCKA 2RQRA 1Y0MA 4M7DD 1FMVA 3T9NA 2DTIA 2K6DA 1BB9A 4CC4B 3QDFA 2ECZA 1K76A 3X25B 1XNIA 2RJEA 4J7FA 5AYFA 1YJNQ 5GAOm 1EFNA 2PUKB 1WHLA 2HQHA 3QXEB 2W0ZA 3GPLA 1M30A 1NJIR 4X34A 5LJ5h 3GLXA 4QVCA 2DF6A 5CKBA 2DEUA 1NBEB 2RQVA 3CCRQ 2L0AA 3HL8A 4C5HA 1B07A 5GANh 1VQ4Q 3OYAA 2YT6A 1JU5C 2CT4A 1VQOQ 3C12A 2VC8A 4RTWA 4NL2A 2QA4T 5HCKA 3SD4A 1PKTA 3QZ5B 4PLLA 1QCFA 1IO6A 4KGZB 4M77F 5CQYA 1BK2A 2DJQA 2QTXA 4F7UG 3CD6Q 1C6VX 1MHNA 2C0OA 3UT1A 1VQMA 1K4US 4PFZA 2HEQA 3CC2A 1KHIA 2MMPA 2V8KA 1YNZA 1PC0A 5ECAA 4V2SA 1TTHB 5J3BA 3OYDA 5CAIA 5LJ3j 3PMIA 5GANj 4C5IA 2E3IA 1Q82R 4DEYA 1RAAB 3N5BB 1GXIE 4A4KA 2JTFA 2F5TX 2MK5A 2QGGA 1MNEA 1ZLMA 1M8MA 3QJYA 5M9OA 2RJCA 2YHTA 5GAMh 1K73R 3ME9A 4Z8AA 1FMWA 2DXTA 1VQMQ 3A8HB 2IPOB 3E9FA 2DFUA 1QW1A 1VQ9Q 3G71T 4JUVA 3QKJA 1AWJA 1MV0B 2LQWA 2EW3A 3EGUA 3LLRA 3MEAA 3I56A 4GY5A 1M8VA 1ZX6A 4RTUA 4C5GA 1YIJQ 1SG5A 3I9QA 3NTHA 2LTOA 2HBPA 2ZGWA 2PVDB 2CZ0B 1ABOA 1MV3A 4O5VA 3X20B 1HJDA 1G3YA 1VQ6T 3EHRA 1N8RC 1JXMA 2IG0A 2QEXA 3A8GB 4XU2A 1JXOA 2JTMA 2MWOA 4N4IA 3LWIA 2YRDA 3CCJQ 3GP8A 2JNGA 3M55A 2QQSA 2EAYA 1I5LA 1D3BA 3JCMX 2XK0A 1ZA2B 1W70A 1Q86R 2EYYA 4DBRA 2A37A 1VQLT 2FPDA 5CKEA 1QP2A 4Z89A 1KJWA 2K9GA 4M75F 5D6XA 4EMKB 3SWNC 1JJ2S 5KYUB 3CXCP 3CCUT 4BY6B 5KYXB 1XQHA 2DRMA 1UGSB 4M78D 1U1TA 1YJWA 4HKEA 2L3SA 3QBYA 2O4XA 2ZZDA 4F7UF 2QYZA 2FG0A 3EGXA 4PLIA 4CC3A 4M77G 4M75E 4WCIA 3MP1A 3I56T 2CH4A 1ZBJA 2GNCA 4J5YA 1WPYA 3CPWS 2QI2A 3VYHB 3V8JA 4M78A 4AT1B 4YTLA 2HL5C 1VUBA 4XAXB 1Q95G 2PVOB 3TVTA 4E7ZA 3OYHA 2JM8A 3A8OB 2EVRA 2YXYA 3G7ZA 1KIKA 1M1FA 5A0GA 1T0HA 1VQ5Q 4QKUA 3HKSA 5IN1A 3FC3A 5FRMA 2I0NA 4PJOE 1OULA 2D8HA 5A0DA 4D8KA 3VRZA 2A0FB 2YUOA 1E6HA 2DRKA 1WXUA 4KH1B 3OS2A 2C0TA 5LJ5e 3CD6A 3VKIA 3M4GA 1UDLA 3CC4T 2P0KA 3EAEA 2MYSA 3M9QA 2CSQA 1YJ9T 2Y90A 2JM9A 1TOVA 2LX9A 2AK5A 1M2VB 5LJ3d 4EDUA 2IIMA 4MZMA 3BDUA 1WHGA 4L6V5 5GMKh 2I2LA 1BYMA 4QT7A 1LVKA 2L8DA 2DD5A 3HRTA 1TUCA 1AWWA 2NLUA 1VQ5A 1FXXA 5GJVB 3C4SA 2VVKA 5KCHA 2RPNA 4FYWB 1D09B 1W4SA 3EG0A 2MOXA 4F7UB 2YWWA 2K5LA 2K57A 1HSQA 3QO3A 2D6FA 1BBZA 4O6JA 2HSEB 3CMAT 3ZEHA 1JJ2P 5GAMf 4LDVA 2B86A 1UGQB 4ZGDB 4JS4A 4FW2A 1VQ9A 3G6ET
chains in the Genus database with same CATH topology
1SSHA 1WXTA 4OMPA 4ESRA 2KXDA 2CT3A 2K7AA 1TG0A 3RNJA 2ED0A 1S1NA 2JXBA 2OAWA 4RTZA 4CC2A 1QWFA 2JMAA 4OMQA 4OMNA 1WI7A 2V1RA 3THKA 1I07A 2FPEA 3REBB 1G2BA 4JJBA 2CSIA 1YWOA 3RBBB 2SRCA 4AFQC 2ESWA 2O9SA 1AZEA 1QKXA 1QWEA 1XOVA 2RN8A 2JW4A 4J9IA 1Y57A 3EG3A 1WLPB 1AWXA 1TUDA 3VS5A 1FYNA 1Z9ZA 3QWXX 2LJ0A 3IQLA 1SHGA 2E5KA 4JZ4A 1NYGA 1NLOC 1SPKA 3VS1A 1QKWA 1NG2A 1M3AA 1T3SA 2OI3A 1W1FA 2K3BA 1RUWA 4JZ3A 5GJWB 1X69A 2D8JA 2EPDA 4A63B 4AFZC 1E6GA 2W10A 1QLYA 2JS0A 2EGAA 1I1JA 3H0HA 1AOJA 1ARKA 2J6OA 1U06A 2DX1A 1GFCA 2F2VA 2BZ8A 1UUEA 4LUEA 5FWCA 2YUNA 1ZUUA 4K11A 2YSQA 3VRYA 2EYWA 1X27A 3KFVA 1CKAA 2CH4W 1VYUA 1W6XA 5EC7A 2AKLA 2A08A 2L2PA 4LE9A 2DVJA 2ROLA 1J3TA 1K9AA 1OEBA 1ZUYA 2JS2A 2CDTA 1VYTA 3C0CA 3VS7A 1V1CA 4AG2C 1RLPC 1OPLA 2A36A 1X2KA 2LQNA 2KR3A 3TSWA 3SEMA 3H0FA 1VA7A 4IIOA 4J9HA 1NM7A 2V1QA 2RF0A 1KSWA 1SEMA 4J9CA 2DL5A 2EBPA 3LH5A 4OMOA 2DYBA 1OPKA 2LCSA 4CC7A 1AVZC 1I0CA 3EG2A 1UFFA 3UATA 4ORZA 3CQTA 2HCKA 2RQRA 1Y0MA 1SRMA 4Z88A 4J9FA 2K6DA 1YCSB 2LJ1A 1BB9A 1JO8A 1PKSA 4CC4B 2ECZA 1K76A 2YUQA 1RI9A 1WYXA 4E6RA 5IXBA 5IXFA 2FRYA 1WDXA 1A0NB 4RTYA 1EFNA 2EYZA 4HVVA 1VYVA 2W0ZA 1M30A 3M0RA 1K0XA 2KROA 1AEYA 2ROTA 4HVWA 2K79A 2KGTA 2KBTA 2RQTA 2RNAA 2DF6A 2KYBA 2O88A 3M0TA 4RTVA 3REAB 4LNPA 2ABLA 2RQVA 1U5SA 1LCKA 3SHWA 3U23A 2DBKA 2D0NA 3VS4A 2L0AA 1PRMC 2EQIA 1B07A 1JQQA 2PZ1A 1NEBA 2YT6A 1JU5C 2CT4A 5IHKA 4AG1C 4GBQA 4EIKA 4IIMA 4RTWA 1ZSGA 1ZUKA 2JMCA 5HCKA 2O9VA 1GBQA 1AZGB 1OOTA 1H92A 2GTOA 1PKTA 1QCFA 4J9EA 1IO6A 2D1XA 2HBWA 1GRIA 3EHQA 1UJ0A 3NPFA 1BK2A 2DJQA 4GLMA 4F16A 2C0OA 5IHNA 3PVQA 1K4US 1T0JA 2LZ6B 3H41A 2HEQA 4JPBW 2X3WD 1H3HA 2G6FX 2JT4A 1YNZA 3M0UA 1MUZA 5ECAA 2F2WA 2KT8A 2LNHB 1WXBA 3PVLA 2J05A 4ZNXA 3H0IA 2FRWA 4JJCA 4DEYA 2F2XA 4RTXA 4RUGA 1ZLMA 1M8MA 2MIOA 1GFDA 2DILA 2GBQA 2LMJA 4JJDA 4Z8AA 2O31A 2J6FA 1YN8A 2QDLA 5FWBA 2OJ2A 2DL7A 1AWJA 1MV0B 2BZXA 2LQWA 1PRLC 1Z9QA 2J06A 2CUBA 2EW3A 3EGUA 4M4ZA 4X1VA 4F17A 2ED1A 3ZL7C 2DL8A 3JV3A 1ZX6A 2EYXA 4RTUA 1UHCA 2SEMA 4OMLA 3R6NA 2CREA 4D8DA 2EKHA 3I9QA 2C0IA 4OMMA 2PTKA 1UTIA 4DEXA 2CUDA 1ABOA 1MV3A 1M3CA 2GGRA 2L3QA 5IHIA 1YP5A 2DMOA 1M27C 1PHTA 1T3LA 3NHNA 1HJDA 2K2MA 1JEGA 3M0QA 3EHRA 3UA7A 1JXMA 1X43A 1OV3A 2FO0A 4J9DA 2NWMA 1JXOA 2ENMA 1G83A 3NMZC 2DA9A 1X6GA 2AKKA 2KRSA 1W70A 2FPFA 2EYYA 2HSPA 2A37A 1N5ZA 2FPDA 4LUDA 4Z89A 1K1ZA 1KJWA 2K9GA 3I35A 2GQIA 4HCKA 2NUZA 2AZVA 4LN2A 1ABQA 2EGCA 2RMOA 1UG1A 2DRMA 1B3QA 4AFUC 1KFZA 1NYFA 3O5ZA 2AZSA 2L3SA 1GCQA 3I5SA 2FG0A 5FW9A 5IH2A 2DBMA 1K0SA 2DE0X 1PNJA 4CC3A 2LP5A 4WCIA 2DNUA 5I22A 2O2OA 2CH4A 1X6BA 1ZBJA 2GNCA 4AFSC 3VS6A 2BTTA 1WX6A 3FJ5A 4HVUA 3VS3A 1GCPA 1X2QA 2J6KA 1HD3A 3UA6A 1SHFA 1GBRA 5L23A 2LX7A 3TVTA 3VS0A 1CKBA 2KE9A 1E7OA 3ULRB 3NGPA 2LJ3A 2JM8A 3EG1A 3GBQA 1YWPA 2M51A 2EVRA 1PWTA 3QWYA 1UE9A 1KIKA 2FEIA 1T0HA 1GCQC 2P4RA 1WA7A 1UHFA 2JTEA 2I0NA 1FMKA 2D8HA 4FSSA 4D8KA 2RQWA 1CSKA 2EGEA 3M0PA 2YDLA 3A98A 3VRZA 2YUOA 1E6HA 2DRKA 1WIEA 2DLPA 1WXUA 2KT1A 2VKNA 3PE0A 2H8HA 2L3PA 2C0TA 2DM1A 3M0SA 2DL3A 1UECA 1NLPC 1UDLA 4KRTA 4J9GA 3UF4A 2CSQA 1UJYA 4F14A 2JM9A 1M3BA 1RLQC 1SRLA 2AK5A 1BU1A 2IIMA 2KYMA 2KRNA 1U3OA 2BZYA 3VS2A 1NEGA 3TSZA 4QT7A 1AD5A 1TUCA 4HXJA 1AWWA 2KEAA 2J7IA 5GJVB 4RTTA 2KRMA 2VVKA 5I11A 2A28A 2KNBB 2RPNA 1WFWA 3EG0A 2MOXA 1AWOA 4R0KA 4J9BA 1HSQA 2DL4A 2X3XD 4Y92A 2RQUA 1BBZA 2XMFA 1GL5A 1UGVA 2HDAA 2GTJA 2KXCA 2M0YA 2YUPA 2MCNA 2B86A 2VWFA 2PNIA 3I5RA 1H8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSH A;  1WXT A;  4OMP A;  4ESR A;  2KXD A;  2CT3 A;  2K7A A;  1TG0 A;  3RNJ A;  2ED0 A;  1S1N A;  2JXB A;  2OAW A;  4RTZ A;  4CC2 A;  1QWF A;  2JMA A;  4OMQ A;  4OMN A;  1WI7 A;  2V1R A;  3THK A;  1I07 A;  2FPE A;  3REB B;  1G2B A;  4JJB A;  2CSI A;  1YWO A;  3RBB B;  2SRC A;  4AFQ C;  2ESW A;  2O9S A;  1AZE A;  1QKX A;  1QWE A;  1XOV A;  2RN8 A;  2JW4 A;  4J9I A;  1Y57 A;  3EG3 A;  1WLP B;  1AWX A;  1TUD A;  3VS5 A;  1FYN A;  1Z9Z A;  3QWX X;  2LJ0 A;  3IQL A;  1SHG A;  2E5K A;  4JZ4 A;  1NYG A;  1NLO C;  1SPK A;  3VS1 A;  1QKW A;  1NG2 A;  1M3A A;  1T3S A;  2OI3 A;  1W1F A;  2K3B A;  1RUW A;  4JZ3 A;  5GJW B;  1X69 A;  2D8J A;  2EPD A;  4A63 B;  4AFZ C;  1E6G A;  2W10 A;  1QLY A;  2JS0 A;  2EGA A;  1I1J A;  3H0H A;  1AOJ A;  1ARK A;  2J6O A;  1U06 A;  2DX1 A;  1GFC A;  2F2V A;  2BZ8 A;  1UUE A;  4LUE A;  5FWC A;  2YUN A;  1ZUU A;  4K11 A;  2YSQ A;  3VRY A;  2EYW A;  1X27 A;  3KFV A;  1CKA A;  2CH4 W;  1VYU A;  1W6X A;  5EC7 A;  2AKL A;  2A08 A;  2L2P A;  4LE9 A;  2DVJ A;  2ROL A;  1J3T A;  1K9A A;  1OEB A;  1ZUY A;  2JS2 A;  2CDT A;  1VYT A;  3C0C A;  3VS7 A;  1V1C A;  4AG2 C;  1RLP C;  1OPL A;  2A36 A;  1X2K A;  2LQN A;  2KR3 A;  3TSW A;  3SEM A;  3H0F A;  1VA7 A;  4IIO A;  4J9H A;  1NM7 A;  2V1Q A;  2RF0 A;  1KSW A;  1SEM A;  4J9C A;  2DL5 A;  2EBP A;  3LH5 A;  4OMO A;  2DYB A;  1OPK A;  2LCS A;  4CC7 A;  1AVZ C;  1I0C A;  3EG2 A;  1UFF A;  3UAT A;  4ORZ A;  3CQT A;  2HCK A;  2RQR A;  1Y0M A;  1SRM A;  4Z88 A;  4J9F A;  2K6D A;  1YCS B;  2LJ1 A;  1BB9 A;  1JO8 A;  1PKS A;  4CC4 B;  2ECZ A;  1K76 A;  2YUQ A;  1RI9 A;  1WYX A;  4E6R A;  5IXB A;  5IXF A;  2FRY A;  1WDX A;  1A0N B;  4RTY A;  1EFN A;  2EYZ A;  4HVV A;  1VYV A;  2W0Z A;  1M30 A;  3M0R A;  1K0X A;  2KRO A;  1AEY A;  2ROT A;  4HVW A;  2K79 A;  2KGT A;  2KBT A;  2RQT A;  2RNA A;  2DF6 A;  2KYB A;  2O88 A;  3M0T A;  4RTV A;  3REA B;  4LNP A;  2ABL A;  2RQV A;  1U5S A;  1LCK A;  3SHW A;  3U23 A;  2DBK A;  2D0N A;  3VS4 A;  2L0A A;  1PRM C;  2EQI A;  1B07 A;  1JQQ A;  2PZ1 A;  1NEB A;  2YT6 A;  1JU5 C;  2CT4 A;  5IHK A;  4AG1 C;  4GBQ A;  4EIK A;  4IIM A;  4RTW A;  1ZSG A;  1ZUK A;  2JMC A;  5HCK A;  2O9V A;  1GBQ A;  1AZG B;  1OOT A;  1H92 A;  2GTO A;  1PKT A;  1QCF A;  4J9E A;  1IO6 A;  2D1X A;  2HBW A;  1GRI A;  3EHQ A;  1UJ0 A;  3NPF A;  1BK2 A;  2DJQ A;  4GLM A;  4F16 A;  2C0O A;  5IHN A;  3PVQ A;  1K4U S;  1T0J A;  2LZ6 B;  3H41 A;  2HEQ A;  4JPB W;  2X3W D;  1H3H A;  2G6F X;  2JT4 A;  1YNZ A;  3M0U A;  1MUZ A;  5ECA A;  2F2W A;  2KT8 A;  2LNH B;  1WXB A;  3PVL A;  2J05 A;  4ZNX A;  3H0I A;  2FRW A;  4JJC A;  4DEY A;  2F2X A;  4RTX A;  4RUG A;  1ZLM A;  1M8M A;  2MIO A;  1GFD A;  2DIL A;  2GBQ A;  2LMJ A;  4JJD A;  4Z8A A;  2O31 A;  2J6F A;  1YN8 A;  2QDL A;  5FWB A;  2OJ2 A;  2DL7 A;  1AWJ A;  1MV0 B;  2BZX A;  2LQW A;  1PRL C;  1Z9Q A;  2J06 A;  2CUB A;  2EW3 A;  3EGU A;  4M4Z A;  4X1V A;  4F17 A;  2ED1 A;  3ZL7 C;  2DL8 A;  3JV3 A;  1ZX6 A;  2EYX A;  4RTU A;  1UHC A;  2SEM A;  4OML A;  3R6N A;  2CRE A;  4D8D A;  2EKH A;  3I9Q A;  2C0I A;  4OMM A;  2PTK A;  1UTI A;  4DEX A;  2CUD A;  1ABO A;  1MV3 A;  1M3C A;  2GGR A;  2L3Q A;  5IHI A;  1YP5 A;  2DMO A;  1M27 C;  1PHT A;  1T3L A;  3NHN A;  1HJD A;  2K2M A;  1JEG A;  3M0Q A;  3EHR A;  3UA7 A;  1JXM A;  1X43 A;  1OV3 A;  2FO0 A;  4J9D A;  2NWM A;  1JXO A;  2ENM A;  1G83 A;  3NMZ C;  2DA9 A;  1X6G A;  2AKK A;  2KRS A;  1W70 A;  2FPF A;  2EYY A;  2HSP A;  2A37 A;  1N5Z A;  2FPD A;  4LUD A;  4Z89 A;  1K1Z A;  1KJW A;  2K9G A;  3I35 A;  2GQI A;  4HCK A;  2NUZ A;  2AZV A;  4LN2 A;  1ABQ A;  2EGC A;  2RMO A;  1UG1 A;  2DRM A;  1B3Q A;  4AFU C;  1KFZ A;  1NYF A;  3O5Z A;  2AZS A;  2L3S A;  1GCQ A;  3I5S A;  2FG0 A;  5FW9 A;  5IH2 A;  2DBM A;  1K0S A;  2DE0 X;  1PNJ A;  4CC3 A;  2LP5 A;  4WCI A;  2DNU A;  5I22 A;  2O2O A;  2CH4 A;  1X6B A;  1ZBJ A;  2GNC A;  4AFS C;  3VS6 A;  2BTT A;  1WX6 A;  3FJ5 A;  4HVU A;  3VS3 A;  1GCP A;  1X2Q A;  2J6K A;  1HD3 A;  3UA6 A;  1SHF A;  1GBR A;  5L23 A;  2LX7 A;  3TVT A;  3VS0 A;  1CKB A;  2KE9 A;  1E7O A;  3ULR B;  3NGP A;  2LJ3 A;  2JM8 A;  3EG1 A;  3GBQ A;  1YWP A;  2M51 A;  2EVR A;  1PWT A;  3QWY A;  1UE9 A;  1KIK A;  2FEI A;  1T0H A;  1GCQ C;  2P4R A;  1WA7 A;  1UHF A;  2JTE A;  2I0N A;  1FMK A;  2D8H A;  4FSS A;  4D8K A;  2RQW A;  1CSK A;  2EGE A;  3M0P A;  2YDL A;  3A98 A;  3VRZ A;  2YUO A;  1E6H A;  2DRK A;  1WIE A;  2DLP A;  1WXU A;  2KT1 A;  2VKN A;  3PE0 A;  2H8H A;  2L3P A;  2C0T A;  2DM1 A;  3M0S A;  2DL3 A;  1UEC A;  1NLP C;  1UDL A;  4KRT A;  4J9G A;  3UF4 A;  2CSQ A;  1UJY A;  4F14 A;  2JM9 A;  1M3B A;  1RLQ C;  1SRL A;  2AK5 A;  1BU1 A;  2IIM A;  2KYM A;  2KRN A;  1U3O A;  2BZY A;  3VS2 A;  1NEG A;  3TSZ A;  4QT7 A;  1AD5 A;  1TUC A;  4HXJ A;  1AWW A;  2KEA A;  2J7I A;  5GJV B;  4RTT A;  2KRM A;  2VVK A;  5I11 A;  2A28 A;  2KNB B;  2RPN A;  1WFW A;  3EG0 A;  2MOX A;  1AWO A;  4R0K A;  4J9B A;  1HSQ A;  2DL4 A;  2X3X D;  4Y92 A;  2RQU A;  1BBZ A;  2XMF A;  1GL5 A;  1UGV A;  2HDA A;  2GTJ A;  2KXC A;  2M0Y A;  2YUP A;  2MCN A;  2B86 A;  2VWF A;  2PNI A;  3I5R A;  1H8K A; 
#chains in the Genus database with same CATH topology
 2BE7 D;  4TVR A;  1N6A A;  4FCY A;  2CT3 A;  2M9U A;  2JXB A;  7AT1 B;  3CCU A;  3OYF A;  4PJO F;  4C92 B;  3LYI A;  1QVG P;  2EJ9 A;  4CC2 A;  4C92 G;  1B34 B;  1IHW A;  5KYY A;  3GNG A;  2X51 A;  2V8J A;  3OS0 A;  3REB B;  3G6E Q;  4PJO B;  1G2B A;  4F04 B;  4KUL A;  2VXE A;  2ESW A;  3FJP A;  1QKX A;  2DEQ A;  3PT9 A;  4NOY A;  4LD9 K;  2X9H A;  2RN8 A;  2QQA A;  4OMF B;  1D1B A;  3DLL A;  1XTD A;  3RKY A;  3ZFJ A;  3JB9 I;  1KC8 C;  3WVD B;  3L2R A;  5LJ5 f;  1NYG A;  1SPK A;  2PUO B;  2RD1 A;  3P8H A;  3S3N A;  2QQB A;  4M7A B;  1NG2 A;  5D6Y A;  4F7U E;  1H64 1;  2BIV A;  1VQ4 A;  1RUW A;  5GJW B;  1N8R R;  2DO3 A;  2VGM A;  2DAQ A;  3BY7 A;  5KYW B;  2RK1 A;  3EGX B;  2J6O A;  2D9T A;  1QVF S;  4A54 A;  2OTL Q;  3OMC A;  1MMN A;  5FWC A;  2YUN A;  3RUX A;  4K11 A;  5CKH A;  2YSQ A;  4NL3 A;  1X27 A;  3OYI A;  1Y96 B;  4BDY A;  1I4K 1;  2QQ9 A;  8AT1 B;  1K9M R;  3L1A A;  2ROL A;  2L89 A;  2P4T A;  1VQP Q;  3FEO A;  1OEB A;  1Q7Y U;  1K9M U;  2CDT A;  1VYT A;  5LJ5 j;  1RLP C;  3EGD B;  3HHT B;  2PQW A;  2CZ7 B;  1YFN A;  4BY6 C;  3H0F A;  2AIR B;  4MZP A;  2V1Q A;  2E70 A;  2DL5 A;  2XU8 A;  1RAB B;  2DYB A;  3VU3 C;  2R5A A;  3VYG A;  4OB2 B;  3KXT A;  2LCS A;  1AVZ C;  3J7A F;  4LDX A;  4OP0 A;  2ATC B;  4XQ3 A;  4C8Q F;  1QVG S;  4E6R A;  2YUQ A;  4HT9 A;  4M7A F;  2RO0 A;  1PM3 A;  1IHV A;  2FRY A;  1VQN Q;  4RTY A;  3MJX A;  1K8A U;  2M02 A;  4LDY A;  2XI9 A;  1VYV A;  5GAM j;  3E19 A;  2ROT A;  2JJ9 A;  4Z02 A;  3Q1J A;  3CCR T;  4BAC A;  2E6Z A;  4LNP A;  3DLM A;  2QA4 Q;  3SHW A;  2ZPB B;  2AT1 B;  2D0N A;  2DTH A;  2PU9 B;  4KT0 E;  5LJ3 h;  4R55 A;  1C0M A;  1JQQ A;  1M1G A;  2PZ1 A;  1TSF A;  5GAM g;  4XTU A;  3EFO B;  4JDS A;  2RJF A;  2JMC A;  2O9V A;  5D7U A;  1RAE B;  1P92 A;  1H92 A;  4C92 D;  2D1X A;  5FU6 C;  2HBW A;  1GRI A;  3CPW A;  3M5A A;  3NPF A;  5GMK m;  1TXQ A;  3LGL A;  3OYM A;  5CKF A;  3PVQ A;  3CCE A;  2LZ6 B;  1QCN A;  1OQK A;  3J81 E;  1M9S A;  3H9N A;  4JPB W;  1VQ8 A;  1WHJ A;  4N4G A;  3JCM b;  3M0U A;  4BE1 A;  2LNH B;  2J05 A;  3LWH A;  2NUT B;  2M16 A;  3CBP A;  3CCQ T;  3CMA A;  1YJN A;  3SWN B;  4C0D B;  2XKO C;  4PKC C;  4HT8 A;  1QCO A;  4PJJ A;  2RJD A;  1N9S A;  4XU1 A;  1EIF A;  3OW2 P;  3O8V A;  1BI0 A;  4JJD A;  3OSS C;  1BCM A;  3SB2 A;  2O31 A;  2J6F A;  2CYZ B;  5FWB A;  4M7A A;  4MMK A;  2QAS A;  3F70 A;  4R56 A;  1IXD A;  2DL7 A;  4FT4 A;  2DVE A;  3M59 A;  5J26 A;  2ED1 A;  1Q7Y C;  2CS7 A;  3CC4 A;  2KAF A;  1TS9 A;  1Y07 A;  3JCM h;  2C0I A;  2CKK A;  3DB3 A;  1W2B S;  1AHJ B;  3JAM E;  2WSC E;  4WF2 A;  5KCO A;  3UWN A;  3MPU B;  1M3C A;  2L3Q A;  2XDD A;  3AHU A;  5IHI A;  1M27 C;  1Y96 A;  2K2M A;  5HK3 A;  3M0Q A;  1S72 T;  1OV3 A;  5KYN A;  3OY9 A;  2FO0 A;  2VXF A;  4PJM A;  1TWB A;  2DA9 A;  4IKF A;  1X6G A;  4E47 A;  2E5Q A;  2KRS A;  3WXM B;  4C92 C;  2KK4 A;  3S6W A;  4OGC A;  3EG9 B;  4LUD A;  3CC7 T;  2EQU A;  1K1Z A;  4M77 D;  3I35 A;  2LVM A;  1WNL A;  1PG5 B;  4FYX B;  4HA8 A;  2RMO A;  3JB9 D;  1B3Q A;  3NFC A;  4ZN1 A;  2MPX C;  2AZS A;  2BKD N;  1MMA A;  1VQK T;  1NJI C;  1RAI B;  5GAO p;  3MET A;  4ELY C;  2DBM A;  2DE0 X;  1M1K U;  4PFP A;  4OVA A;  4ME7 A;  2DNU A;  3I55 T;  4AFS C;  1VQL A;  4PJO A;  1N8R U;  3FJ5 A;  4ZGJ B;  2KMT A;  1SHF A;  1GBR A;  5L23 A;  3VS0 A;  4FU6 A;  3CME Q;  1Q82 U;  4EMK A;  2HL3 A;  3OYE A;  4B9X A;  1E7O A;  4JS5 A;  3ULR B;  2H3J A;  3HFO A;  4DQ2 A;  3EG1 A;  3GBQ A;  4ZN3 A;  1YWP A;  2GFU A;  3QUI A;  3EG9 A;  3CCQ Q;  1HK9 A;  5IAY A;  2EJF A;  3LX7 A;  2VB6 A;  5A0L A;  2V26 A;  1FWZ A;  2P0P A;  4FSS A;  3JCM J;  2RQW A;  3CCJ A;  4JLG A;  3M0P A;  2CP5 A;  3A98 A;  3ASK A;  2HKQ B;  2EQJ A;  1WZO A;  3PE0 A;  5KYY B;  3RIR A;  1NE8 A;  3M0S A;  1ZSZ B;  1PD0 A;  2EQM A;  2HZY A;  2JOY A;  2RI5 A;  3CCV Q;  5CVI A;  3RKX A;  4M78 B;  1IB8 A;  1VQ7 Q;  4HCZ A;  1RAH B;  1BIA A;  4B6M A;  1SRL A;  1OX8 A;  2DXB A;  3A1P A;  1ZBX A;  5IT9 E;  1LNX A;  1U3O A;  3EH2 A;  2BZY A;  3QYG B;  6AT1 B;  2HQX A;  3VS2 A;  3JCM f;  3C95 A;  3TSZ A;  2OX7 A;  2QEX Q;  2EIF A;  2L3R A;  2E4H A;  3VJP A;  1WJQ A;  3E2U A;  1RAF B;  1S72 Q;  5I11 A;  3CXC S;  1R0C B;  5LL6 S;  3QPH A;  1YCY A;  2XD0 A;  2R58 A;  4Y28 E;  2DL4 A;  3M58 A;  3FDR A;  2WSF E;  1QVF A;  1IGU A;  1YJ9 A;  5CK9 A;  1YI2 T;  3CCU Q;  2GTJ A;  3JRZ A;  2MCN A;  2WSE E;  2YLB A;  1OZ3 A;  5CCA A;  1K73 C;  1X75 C;  4NS5 A;  1X01 A;  2X4Y A;  2O01 E;  5CO7 A;  4C8Q D;  4ESR A;  2KXD A;  1IGQ A;  4M75 A;  3RNJ A;  4M7D F;  3MO8 A;  4BI4 A;  4ZGE B;  2L5Q A;  2JMA A;  4M78 E;  2KDS A;  1YIJ T;  2EYQ A;  3M56 A;  2D0Q B;  1YIT T;  4PJO D;  3THK A;  1I07 A;  3OB9 A;  1D0X A;  3TQ7 P;  3CC2 Q;  1XJW B;  2SRC A;  4RKU E;  4PJO C;  1AZE A;  4LXC A;  4M7A G;  3OQ5 A;  1MMD A;  4J83 A;  2JW4 A;  1YHQ A;  4J9I A;  1Y57 A;  2E41 A;  1WJR A;  3OYG A;  4C8Q G;  3QZ9 B;  3TCJ A;  3OYL A;  3PTA A;  2QXF A;  4MDX A;  1OX9 A;  1SHG A;  2JUF A;  4M75 B;  4JZ4 A;  1G3T A;  1NLO C;  1QKW A;  4OB1 B;  2XG8 D;  2RM4 A;  4M75 C;  1JJ2 A;  4M7D G;  2P84 A;  4M77 A;  5KYU A;  2OI3 A;  4N0A C;  4X9D A;  1MMG A;  1W1F A;  3CCL T;  1O9S A;  3GOX A;  4AFZ C;  1VQM T;  4XTY A;  1YIT Q;  1QLY A;  2K3Y A;  2DKG A;  3HRS A;  1I1J A;  2RHI A;  5GAN 2;  2DX1 A;  2CP6 A;  1UUE A;  3X28 B;  4LUE A;  2E3H A;  2K5I A;  5C6S A;  2HAX A;  1W6X A;  1KQS P;  2AKL A;  3CCE Q;  2L2P A;  5AT1 B;  3MEU A;  1B7T A;  1QVG A;  2X35 A;  1K9A A;  1SSF A;  4D6W A;  3C0C A;  3JCM g;  3NTI A;  3BFM A;  4E7J A;  1V1C A;  3UPU A;  3MCA B;  1OPL A;  2ZPG B;  2DPP B;  3TSW A;  2LCC A;  5LJ3 g;  3SEM A;  1G3S A;  2DIQ A;  2JZ2 A;  3ER0 A;  2KY9 A;  4M7A D;  1SEM A;  4J9C A;  2EBP A;  1I8F A;  3LH5 A;  3J80 E;  3EGD A;  1WQW A;  3PIO A;  2FVU A;  1Q81 U;  1I0C A;  3L42 A;  3EG2 A;  3QSU A;  3UAT A;  5FRN A;  3G71 A;  4Z88 A;  4KH0 B;  4J9F A;  3HPW A;  1YCS B;  3GIB A;  2LJ1 A;  1JO8 A;  2E65 A;  1NJI U;  1VQ7 T;  1U1S A;  5IXB A;  2EFI A;  2DJZ A;  3GNF B;  2HMA A;  2ZCF B;  2DK3 A;  1WDX A;  4KUI A;  1A0N B;  2NYS A;  5LJ3 e;  1PD1 A;  1JBM A;  2EJG A;  1O75 A;  2EYZ A;  1R8O B;  2GCX A;  4HVV A;  3ZBD A;  2F69 A;  3BE3 A;  3M0R A;  2KRO A;  1K0X A;  4HVW A;  2K79 A;  2KGT A;  1YHQ Q;  4M7A C;  3JCM e;  2KBT A;  2RQT A;  3FLG A;  4PJO G;  2O88 A;  3M0T A;  2ABL A;  4C92 E;  1U5S A;  2O4X B;  1K73 U;  3U23 A;  1YJW Q;  2COW A;  2EQI A;  2X4J A;  1QVF P;  3QHS A;  2XID A;  1YJ9 Q;  2RI3 A;  4C92 A;  1Q81 C;  5IHK A;  4AG1 C;  4IIM A;  1LOJ A;  2B8A A;  3MEV A;  4C8Q B;  5GAN g;  1UGP B;  1ZSG A;  2OTJ A;  1M5Q 1;  1ZUK A;  2A3L A;  2NUP A;  4X9C A;  1GBQ A;  4WTO B;  2QG9 B;  2GTO A;  3HFN A;  2G3R A;  1KHC A;  3JB9 F;  4M7D B;  5LJ5 g;  4HCC A;  5LJ5 d;  3GF5 A;  2CGH A;  2V8I A;  4OGE A;  4F16 A;  5DY9 A;  5FLX E;  1T0J A;  1FX7 A;  3H41 A;  5I2M A;  4E7H A;  1H3H A;  2LT4 A;  4FL6 A;  4EMH A;  1D0Y A;  2JT4 A;  3LW5 E;  4QVZ A;  2KT8 A;  3E9G A;  1WXB A;  2MF2 A;  1VQ5 T;  3A8L B;  2FRW A;  4JJC A;  4OF1 A;  1YIT A;  4C0Z A;  5GAN f;  3BW1 A;  3V7R A;  3MKD A;  1RI0 A;  1GFD A;  2DIL A;  3CCM A;  1H3Z A;  4IUT A;  2NUP B;  3DKM A;  3HSB A;  4PNO A;  1WGS A;  3I56 Q;  5CQX A;  5GAO r;  5DLO A;  1Q81 R;  1M2O A;  4C8Q E;  1OU9 A;  3M54 A;  5DM7 R;  3V7C A;  2BZX A;  4M78 F;  1PRL C;  1Z9Q A;  4F17 A;  4XK8 E;  3ZL7 C;  2E10 A;  2DL8 A;  4M7D E;  1OU8 A;  1UHC A;  2SEM A;  3R6N A;  2HD0 A;  2DZ9 A;  5GAN 3;  4MML A;  2VYT A;  2Y4Y A;  2EKH A;  3CCJ T;  4OMM A;  3RES A;  2YRV A;  4BDZ A;  5FU7 B;  1OYX A;  1VQ7 A;  4DEX A;  2CUD A;  3CCE T;  2GGR A;  1UGR B;  3G4S A;  1YP5 A;  2DMO A;  1PSE A;  1PHT A;  3NHN A;  4FT2 A;  3KBG A;  1K8A C;  1VQ8 Q;  1JEG A;  3UA7 A;  4RCB A;  2K5F A;  4L59 A;  2QAZ A;  4Q5W A;  1VQK A;  3CBM A;  4BI8 B;  1G83 A;  4DBQ A;  2E6N A;  3KUF A;  3SDZ A;  1KQ1 A;  2VGN A;  1N5Z A;  3I55 A;  1KQ2 A;  2ZPI B;  3OYN A;  3CCL Q;  2GQI A;  4HCK A;  2NUZ A;  3L2Z A;  2COY A;  4C8Q C;  5GMK i;  1UG1 A;  5GMK j;  1KD1 R;  3X24 B;  4AFU C;  4P5N A;  1KFZ A;  3CCR A;  1NYF A;  2OAU A;  4QVD A;  1ACM B;  4UC4 A;  1ZHI A;  5I21 A;  5FW9 A;  1K0S A;  4BI3 A;  4E2F B;  1KD1 U;  2LP5 A;  1PCX A;  1M90 R;  3PNW C;  2O2O A;  2DXC A;  3OW2 S;  3CC2 T;  3VS6 A;  2BTT A;  1WX6 A;  4HVU A;  3VS3 A;  1X2Q A;  2J6K A;  1HD3 A;  3CCQ A;  4J7I A;  1YHQ T;  2LX7 A;  3RR6 A;  1CKB A;  4J8O A;  3CCL A;  2KE9 A;  4BE0 A;  3UDC A;  3L2W A;  4FYV B;  3MP8 A;  2M51 A;  3CCM T;  1PWT A;  3CCS A;  3QWY A;  2DTO A;  1NZ9 A;  2E64 A;  2FEI A;  1WA7 A;  1UHF A;  2JTE A;  1K9M C;  3JCM Q;  3QDR B;  1G8X A;  1M2V A;  2EGE A;  2YDL A;  5HKC A;  1OZ2 A;  3OYB A;  2KT1 A;  4A53 A;  1Q82 C;  2L3P A;  2DM1 A;  2DL3 A;  1UEC A;  1NLP C;  1TU0 B;  3JCM d;  5GAO l;  2HKN A;  1MND A;  4EPC A;  3HRU A;  1KD1 C;  1UJY A;  3E1S A;  1YI2 A;  1M3B A;  2QTV A;  1QQJ A;  1VQ6 Q;  2KYM A;  5GAN d;  2KRN A;  3FRN A;  1VQN T;  4E7K A;  3SWN A;  3PMT A;  1NEG A;  3PIP A;  4XU3 A;  2CP2 A;  2LQ8 A;  4RTT A;  3MP6 A;  2A28 A;  4M77 B;  1IRX A;  2MAM A;  1WFW A;  1AWO A;  4R0K A;  3JSC A;  4F7U A;  3V7S A;  3M53 A;  4J6X A;  4PJL A;  4Y92 A;  4FW1 A;  2RQU A;  3RMQ A;  2HDA A;  1VQ9 T;  3S3O A;  2KXC A;  2M0Y A;  2RB6 A;  1I5O B;  4RMO A;  4ANJ A;  2FHD A;  4IUP A;  2VWF A;  2RH2 A;  1D3B B;  2K3X A;  4OMP A;  4ZTJ A;  4A4G A;  2K7A A;  5FRO A;  3EH1 A;  4M77 C;  2OAW A;  1VQP T;  1LJO A;  2OTL T;  5J39 A;  2FL7 A;  4PL6 A;  1QWF A;  2QK0 A;  3MHX A;  5KYX A;  2GQV A;  4OMN A;  1WI7 A;  2YLC A;  2FPE A;  3OW2 A;  4JJB A;  3I55 Q;  2Y4X A;  2ZPE B;  4IUQ A;  1XOV A;  4J6Y A;  1AWX A;  2E12 A;  1TUD A;  2ZPF B;  1FYN A;  1VQ8 T;  4DOV A;  3QWX X;  4CRI A;  2E5K A;  1BIB A;  4C92 F;  2KSS A;  4AMC A;  2K2V A;  3CD6 T;  3VS1 A;  1MGQ A;  3FIF A;  4KGV B;  1M3A A;  1S72 A;  4XTW A;  4E7S A;  3MEW A;  3CC7 Q;  4A63 B;  1K8A R;  4CI0 C;  2W10 A;  2EGA A;  4OB0 B;  1AOJ A;  4BE2 A;  1U06 A;  4IUU A;  5HY6 A;  1GFC A;  2X4X A;  3OYC A;  2BZ8 A;  1Q86 U;  4JJN K;  4IUV A;  3OS5 A;  5GAM e;  4GLK A;  2EYW A;  3KFV A;  8ATC B;  1TUG B;  2CH4 W;  2BUD A;  2VUB A;  4MZT A;  5EC7 A;  3CCS Q;  3M57 A;  3CCV A;  1M4Z A;  3BDL A;  1J3T A;  3L2V A;  2F1L A;  1ZUY A;  1HYO A;  2JS2 A;  1VQO A;  1RAC B;  2EQK A;  3VS7 A;  4AG2 C;  3CC7 A;  1X2K A;  2DXU A;  3RER A;  2KR3 A;  4C5E A;  1PSF A;  2DET A;  5FU7 C;  3EFS A;  1VA7 A;  1VIF A;  4IIO A;  3PGG A;  4J9H A;  2YRC A;  3HP9 A;  2RF0 A;  1YJN T;  3RDV A;  1RL2 A;  2JN0 A;  3CCV T;  1KC8 U;  2FZC B;  3CQT A;  5FU6 B;  3TEE A;  1Q86 C;  1SRM A;  2DD4 A;  4QQG A;  4XTV A;  1PKS A;  1RI9 A;  1WYX A;  4MDW A;  4EMG A;  5IXF A;  4LDW A;  4XU0 A;  2OTJ T;  2FYK A;  5CKD A;  3AT1 B;  2BE9 B;  9ATC B;  1AEY A;  3EFO A;  1YJW T;  4J6W A;  2RNA A;  2KYB A;  2CP7 A;  4RTV A;  3REA B;  3LH0 A;  2RHU A;  4M78 G;  1LCK A;  4PJN A;  2DBK A;  4QQ6 A;  3G4S Q;  3VS4 A;  1PRM C;  4JRQ A;  1WHH A;  1TH7 A;  3D7S B;  3OSV A;  3L2Q A;  4DA4 A;  1NEB A;  1WQ7 A;  1KQS A;  3OS1 A;  1JRI A;  4GBQ A;  1VQK Q;  4EIK A;  4M7A E;  4A4H A;  2XHC A;  5D6W A;  2KVQ G;  3SFM A;  1AZG B;  1OOT A;  4OB3 B;  4J9E A;  1KQS S;  2QGF B;  2PVG B;  3EHQ A;  1UJ0 A;  4M75 G;  4M7D C;  2RI2 A;  1WHK A;  2LC4 A;  4GLM A;  1I81 A;  5IHN A;  2RHZ A;  2H3E B;  2R57 A;  2X3W D;  3DB4 A;  3INZ A;  3CBO A;  4E7L A;  4DBH A;  2G6F X;  1MUZ A;  1N27 A;  4FIB A;  2F2W A;  4KGX B;  3PVL A;  4M75 D;  4ZNX A;  3H0I A;  4C8Q A;  1JB0 E;  2IVW A;  1D0Z A;  2K4Y A;  3A5Z B;  1N9R A;  2F2X A;  2LQK A;  3JB9 G;  4RTX A;  1AT1 B;  3RKW A;  4BUG A;  4ATO A;  1VIE A;  4RUG A;  2LNV A;  4BB7 A;  1RAD B;  4JRP A;  3S3M A;  4M7D A;  1EZZ B;  2VAS A;  5A2Q E;  2MIO A;  2GBQ A;  2LMJ A;  2GFA A;  3CPW P;  2FZG B;  5EG2 A;  1YN8 A;  2QDL A;  2FZK B;  1VQP A;  4DBF A;  2OJ2 A;  4XTX A;  1G3W A;  1X6O A;  1F1B B;  2GF7 A;  3OYJ A;  3JB9 H;  2J06 A;  2LT1 A;  2CUB A;  4M4Z A;  4X1V A;  3WVE B;  1W2B A;  3V8K A;  1U8R A;  3JV3 A;  2E1H A;  2EYX A;  5HK0 A;  4OML A;  4C0D C;  2F5K A;  2RHX A;  1RAG B;  2CRE A;  4D8D A;  2HNI A;  4RG8 A;  1VOM A;  3JCM W;  2C06 A;  3G71 Q;  2PTK A;  1UTI A;  1B34 A;  3CC4 Q;  1D1A A;  5KE2 A;  3OMG A;  2P0Q A;  1T3L A;  1KC8 R;  5GAN 7;  3HTR A;  1X43 A;  3G1J A;  5GAO n;  2MWP A;  4J9D A;  1DJ7 B;  2NWM A;  2ENM A;  3C94 A;  1KK7 A;  3NMZ C;  5I2S A;  1ZQ1 A;  1VQN A;  2AKK A;  2KI7 A;  2FPF A;  4DOW A;  2CZ1 B;  2HSP A;  1EX4 A;  2XDP A;  4A4F A;  1QMC A;  4C0G A;  2AZV A;  4JLI A;  5GAN 5;  4LN2 A;  1WHM A;  1ABQ A;  2EGC A;  4N0A A;  1M1K R;  1G5V A;  5CR2 A;  1QVP A;  3QYH B;  3O5Z A;  2QQR A;  1GCQ A;  1SF9 A;  1OI1 A;  3I5S A;  2XDB A;  2ZPH B;  3OYK A;  5IH2 A;  1PNJ A;  4KUD K;  4FSX A;  3CME A;  5I22 A;  3EFR A;  1X6B A;  2LDM A;  3G6E A;  1GCP A;  1V29 B;  3UA6 A;  5GMK l;  1VQ4 T;  1VQL Q;  1BI1 A;  3NGP A;  4QQD A;  3JCM c;  2LJ3 A;  2M0O A;  2KQW A;  4VUB A;  3QG1 A;  2RHY A;  2COZ A;  1UE9 A;  5DLQ E;  5C0M A;  4ZTF A;  3M4Y A;  1NPR A;  1GCQ C;  3OBW A;  2P4R A;  4II1 A;  1VQO T;  1FMK A;  1IZ6 A;  4LD6 A;  3TRE A;  4FM4 B;  1C1A A;  3VUZ A;  1CSK A;  2LCL A;  1WIE A;  2CP0 A;  2DLP A;  2R5M A;  2VKN A;  1YIJ A;  2H8H A;  3CCM Q;  4KBM B;  1BI2 A;  4KRT A;  4J9G A;  5GAO q;  3CXC A;  3UF4 A;  3L2U A;  1QP3 A;  1M1K C;  1BCO A;  4L5G A;  4F14 A;  4A4E A;  3PFS A;  1RLQ C;  3R6O A;  1BU1 A;  2CP3 A;  4N4H A;  2A7Y A;  3P8B B;  2FB7 A;  4XTZ A;  3CEY A;  5L8R E;  2DZC A;  2HQE A;  1BKB A;  3NTK A;  1AD5 A;  4HXJ A;  3JCM V;  2EKO A;  2KEA A;  1UB4 A;  1SKU B;  2J7I A;  2KRM A;  2KNB B;  5GAN e;  3G4S T;  4C0F A;  1BI3 A;  4J9B A;  2X3X D;  1GL5 A;  2XMF A;  1UGV A;  1LPL A;  2DER A;  4PFO A;  2EWN A;  2AHJ B;  2RA2 A;  2YUP A;  3OBY A;  2PNI A;  1Y71 A;  3I5R A;  1H8K A;  2Z0W A;  4M78 C;  1KG1 A;  1SSH A;  1R0B G;  4JRK A;  2OTJ Q;  1WXT A;  4B9W A;  4EMK C;  3V8L A;  5KE3 A;  1TG0 A;  1D1C A;  2ED0 A;  4JRI A;  1S1N A;  4RTZ A;  1VQ6 A;  2DIG A;  4OMQ A;  1WJS A;  4RG2 A;  4RCC A;  2V1R A;  3URG A;  2CSI A;  5GAM d;  1YWO A;  1HXD A;  3RBB B;  4AFQ C;  2O9S A;  3CPF A;  1QWE A;  1YI2 Q;  5GAN 4;  1W2B P;  4PK4 A;  3EG3 A;  2NUT A;  1WLP B;  3JCM P;  3VS5 A;  4FYY B;  1Z9Z A;  1ZA1 B;  2LJ0 A;  3OYY A;  2VV5 A;  3IQL A;  1UEB A;  1ZSZ C;  3QII A;  3JB9 J;  4BD3 A;  3QJ6 A;  2WAC A;  5KYW A;  1T3S A;  2QEX T;  3H6Z A;  5GAN 8;  2K3B A;  3OA6 A;  4JZ3 A;  1X69 A;  5LJ3 f;  4IUR A;  2D8J A;  2EPD A;  3TU4 K;  3CCS T;  3P8D A;  1E6G A;  2DYI A;  3X26 B;  2JS0 A;  4HCB A;  2MI6 A;  3H0H A;  1M90 U;  1ARK A;  3LGF A;  1NPP A;  2F2V A;  1Y7X A;  5GMK e;  4Y91 A;  1ZUU A;  3CMA Q;  1V76 A;  3VRY A;  4ELZ C;  1CKA A;  5KH6 A;  1VYU A;  4E7I A;  1ZSZ A;  2RK2 A;  2M1H A;  3VV0 A;  3H8Z A;  2A08 A;  4LE9 A;  2DVJ A;  3CME T;  2ZAE A;  2OTL A;  1M90 C;  3VUB A;  2QDY B;  5CIU A;  1IRE B;  3A8M B;  2A36 A;  5GAN 6;  2LQN A;  2CZ6 B;  2JVV A;  3FB9 A;  4LDU A;  1YBY A;  2X4W A;  2QA4 A;  1NM7 A;  2XIC A;  1KSW A;  2LRQ A;  3RMS A;  1R77 A;  4OMO A;  1Q7Y R;  1OPK A;  4CC7 A;  4M77 E;  1UFF A;  4ORZ A;  4QW2 A;  2HCK A;  2RQR A;  1Y0M A;  4M7D D;  1FMV A;  3T9N A;  2DTI A;  2K6D A;  1BB9 A;  4CC4 B;  3QDF A;  2ECZ A;  1K76 A;  3X25 B;  1XNI A;  2RJE A;  4J7F A;  5AYF A;  1YJN Q;  5GAO m;  1EFN A;  2PUK B;  1WHL A;  2HQH A;  3QXE B;  2W0Z A;  3GPL A;  1M30 A;  1NJI R;  4X34 A;  5LJ5 h;  3GLX A;  4QVC A;  2DF6 A;  5CKB A;  2DEU A;  1NBE B;  2RQV A;  3CCR Q;  2L0A A;  3HL8 A;  4C5H A;  1B07 A;  5GAN h;  1VQ4 Q;  3OYA A;  2YT6 A;  1JU5 C;  2CT4 A;  1VQO Q;  3C12 A;  2VC8 A;  4RTW A;  4NL2 A;  2QA4 T;  5HCK A;  3SD4 A;  1PKT A;  3QZ5 B;  4PLL A;  1QCF A;  1IO6 A;  4KGZ B;  4M77 F;  5CQY A;  1BK2 A;  2DJQ A;  2QTX A;  4F7U G;  3CD6 Q;  1C6V X;  1MHN A;  2C0O A;  3UT1 A;  1VQM A;  1K4U S;  4PFZ A;  2HEQ A;  3CC2 A;  1KHI A;  2MMP A;  2V8K A;  1YNZ A;  1PC0 A;  5ECA A;  4V2S A;  1TTH B;  5J3B A;  3OYD A;  5CAI A;  5LJ3 j;  3PMI A;  5GAN j;  4C5I A;  2E3I A;  1Q82 R;  4DEY A;  1RAA B;  3N5B B;  1GXI E;  4A4K A;  2JTF A;  2F5T X;  2MK5 A;  2QGG A;  1MNE A;  1ZLM A;  1M8M A;  3QJY A;  5M9O A;  2RJC A;  2YHT A;  5GAM h;  1K73 R;  3ME9 A;  4Z8A A;  1FMW A;  2DXT A;  1VQM Q;  3A8H B;  2IPO B;  3E9F A;  2DFU A;  1QW1 A;  1VQ9 Q;  3G71 T;  4JUV A;  3QKJ A;  1AWJ A;  1MV0 B;  2LQW A;  2EW3 A;  3EGU A;  3LLR A;  3MEA A;  3I56 A;  4GY5 A;  1M8V A;  1ZX6 A;  4RTU A;  4C5G A;  1YIJ Q;  1SG5 A;  3I9Q A;  3NTH A;  2LTO A;  2HBP A;  2ZGW A;  2PVD B;  2CZ0 B;  1ABO A;  1MV3 A;  4O5V A;  3X20 B;  1HJD A;  1G3Y A;  1VQ6 T;  3EHR A;  1N8R C;  1JXM A;  2IG0 A;  2QEX A;  3A8G B;  4XU2 A;  1JXO A;  2JTM A;  2MWO A;  4N4I A;  3LWI A;  2YRD A;  3CCJ Q;  3GP8 A;  2JNG A;  3M55 A;  2QQS A;  2EAY A;  1I5L A;  1D3B A;  3JCM X;  2XK0 A;  1ZA2 B;  1W70 A;  1Q86 R;  2EYY A;  4DBR A;  2A37 A;  1VQL T;  2FPD A;  5CKE A;  1QP2 A;  4Z89 A;  1KJW A;  2K9G A;  4M75 F;  5D6X A;  4EMK B;  3SWN C;  1JJ2 S;  5KYU B;  3CXC P;  3CCU T;  4BY6 B;  5KYX B;  1XQH A;  2DRM A;  1UGS B;  4M78 D;  1U1T A;  1YJW A;  4HKE A;  2L3S A;  3QBY A;  2O4X A;  2ZZD A;  4F7U F;  2QYZ A;  2FG0 A;  3EGX A;  4PLI A;  4CC3 A;  4M77 G;  4M75 E;  4WCI A;  3MP1 A;  3I56 T;  2CH4 A;  1ZBJ A;  2GNC A;  4J5Y A;  1WPY A;  3CPW S;  2QI2 A;  3VYH B;  3V8J A;  4M78 A;  4AT1 B;  4YTL A;  2HL5 C;  1VUB A;  4XAX B;  1Q95 G;  2PVO B;  3TVT A;  4E7Z A;  3OYH A;  2JM8 A;  3A8O B;  2EVR A;  2YXY A;  3G7Z A;  1KIK A;  1M1F A;  5A0G A;  1T0H A;  1VQ5 Q;  4QKU A;  3HKS A;  5IN1 A;  3FC3 A;  5FRM A;  2I0N A;  4PJO E;  1OUL A;  2D8H A;  5A0D A;  4D8K A;  3VRZ A;  2A0F B;  2YUO A;  1E6H A;  2DRK A;  1WXU A;  4KH1 B;  3OS2 A;  2C0T A;  5LJ5 e;  3CD6 A;  3VKI A;  3M4G A;  1UDL A;  3CC4 T;  2P0K A;  3EAE A;  2MYS A;  3M9Q A;  2CSQ A;  1YJ9 T;  2Y90 A;  2JM9 A;  1TOV A;  2LX9 A;  2AK5 A;  1M2V B;  5LJ3 d;  4EDU A;  2IIM A;  4MZM A;  3BDU A;  1WHG A;  4L6V 5;  5GMK h;  2I2L A;  1BYM A;  4QT7 A;  1LVK A;  2L8D A;  2DD5 A;  3HRT A;  1TUC A;  1AWW A;  2NLU A;  1VQ5 A;  1FXX A;  5GJV B;  3C4S A;  2VVK A;  5KCH A;  2RPN A;  4FYW B;  1D09 B;  1W4S A;  3EG0 A;  2MOX A;  4F7U B;  2YWW A;  2K5L A;  2K57 A;  1HSQ A;  3QO3 A;  2D6F A;  1BBZ A;  4O6J A;  2HSE B;  3CMA T;  3ZEH A;  1JJ2 P;  5GAM f;  4LDV A;  2B86 A;  1UGQ B;  4ZGD B;  4JS4 A;  4FW2 A;  1VQ9 A;  3G6E T; 
#chains in the Genus database with same CATH homology
 1SSH A;  1WXT A;  4OMP A;  4ESR A;  2KXD A;  2CT3 A;  2K7A A;  1TG0 A;  3RNJ A;  2ED0 A;  1S1N A;  2JXB A;  2OAW A;  4RTZ A;  4CC2 A;  1QWF A;  2JMA A;  4OMQ A;  4OMN A;  1WI7 A;  2V1R A;  3THK A;  1I07 A;  2FPE A;  3REB B;  1G2B A;  4JJB A;  2CSI A;  1YWO A;  3RBB B;  2SRC A;  4AFQ C;  2ESW A;  2O9S A;  1AZE A;  1QKX A;  1QWE A;  1XOV A;  2RN8 A;  2JW4 A;  4J9I A;  1Y57 A;  3EG3 A;  1WLP B;  1AWX A;  1TUD A;  3VS5 A;  1FYN A;  1Z9Z A;  3QWX X;  2LJ0 A;  3IQL A;  1SHG A;  2E5K A;  4JZ4 A;  1NYG A;  1NLO C;  1SPK A;  3VS1 A;  1QKW A;  1NG2 A;  1M3A A;  1T3S A;  2OI3 A;  1W1F A;  2K3B A;  1RUW A;  4JZ3 A;  5GJW B;  1X69 A;  2D8J A;  2EPD A;  4A63 B;  4AFZ C;  1E6G A;  2W10 A;  1QLY A;  2JS0 A;  2EGA A;  1I1J A;  3H0H A;  1AOJ A;  1ARK A;  2J6O A;  1U06 A;  2DX1 A;  1GFC A;  2F2V A;  2BZ8 A;  1UUE A;  4LUE A;  5FWC A;  2YUN A;  1ZUU A;  4K11 A;  2YSQ A;  3VRY A;  2EYW A;  1X27 A;  3KFV A;  1CKA A;  2CH4 W;  1VYU A;  1W6X A;  5EC7 A;  2AKL A;  2A08 A;  2L2P A;  4LE9 A;  2DVJ A;  2ROL A;  1J3T A;  1K9A A;  1OEB A;  1ZUY A;  2JS2 A;  2CDT A;  1VYT A;  3C0C A;  3VS7 A;  1V1C A;  4AG2 C;  1RLP C;  1OPL A;  2A36 A;  1X2K A;  2LQN A;  2KR3 A;  3TSW A;  3SEM A;  3H0F A;  1VA7 A;  4IIO A;  4J9H A;  1NM7 A;  2V1Q A;  2RF0 A;  1KSW A;  1SEM A;  4J9C A;  2DL5 A;  2EBP A;  3LH5 A;  4OMO A;  2DYB A;  1OPK A;  2LCS A;  4CC7 A;  1AVZ C;  1I0C A;  3EG2 A;  1UFF A;  3UAT A;  4ORZ A;  3CQT A;  2HCK A;  2RQR A;  1Y0M A;  1SRM A;  4Z88 A;  4J9F A;  2K6D A;  1YCS B;  2LJ1 A;  1BB9 A;  1JO8 A;  1PKS A;  4CC4 B;  2ECZ A;  1K76 A;  2YUQ A;  1RI9 A;  1WYX A;  4E6R A;  5IXB A;  5IXF A;  2FRY A;  1WDX A;  1A0N B;  4RTY A;  1EFN A;  2EYZ A;  4HVV A;  1VYV A;  2W0Z A;  1M30 A;  3M0R A;  1K0X A;  2KRO A;  1AEY A;  2ROT A;  4HVW A;  2K79 A;  2KGT A;  2KBT A;  2RQT A;  2RNA A;  2DF6 A;  2KYB A;  2O88 A;  3M0T A;  4RTV A;  3REA B;  4LNP A;  2ABL A;  2RQV A;  1U5S A;  1LCK A;  3SHW A;  3U23 A;  2DBK A;  2D0N A;  3VS4 A;  2L0A A;  1PRM C;  2EQI A;  1B07 A;  1JQQ A;  2PZ1 A;  1NEB A;  2YT6 A;  1JU5 C;  2CT4 A;  5IHK A;  4AG1 C;  4GBQ A;  4EIK A;  4IIM A;  4RTW A;  1ZSG A;  1ZUK A;  2JMC A;  5HCK A;  2O9V A;  1GBQ A;  1AZG B;  1OOT A;  1H92 A;  2GTO A;  1PKT A;  1QCF A;  4J9E A;  1IO6 A;  2D1X A;  2HBW A;  1GRI A;  3EHQ A;  1UJ0 A;  3NPF A;  1BK2 A;  2DJQ A;  4GLM A;  4F16 A;  2C0O A;  5IHN A;  3PVQ A;  1K4U S;  1T0J A;  2LZ6 B;  3H41 A;  2HEQ A;  4JPB W;  2X3W D;  1H3H A;  2G6F X;  2JT4 A;  1YNZ A;  3M0U A;  1MUZ A;  5ECA A;  2F2W A;  2KT8 A;  2LNH B;  1WXB A;  3PVL A;  2J05 A;  4ZNX A;  3H0I A;  2FRW A;  4JJC A;  4DEY A;  2F2X A;  4RTX A;  4RUG A;  1ZLM A;  1M8M A;  2MIO A;  1GFD A;  2DIL A;  2GBQ A;  2LMJ A;  4JJD A;  4Z8A A;  2O31 A;  2J6F A;  1YN8 A;  2QDL A;  5FWB A;  2OJ2 A;  2DL7 A;  1AWJ A;  1MV0 B;  2BZX A;  2LQW A;  1PRL C;  1Z9Q A;  2J06 A;  2CUB A;  2EW3 A;  3EGU A;  4M4Z A;  4X1V A;  4F17 A;  2ED1 A;  3ZL7 C;  2DL8 A;  3JV3 A;  1ZX6 A;  2EYX A;  4RTU A;  1UHC A;  2SEM A;  4OML A;  3R6N A;  2CRE A;  4D8D A;  2EKH A;  3I9Q A;  2C0I A;  4OMM A;  2PTK A;  1UTI A;  4DEX A;  2CUD A;  1ABO A;  1MV3 A;  1M3C A;  2GGR A;  2L3Q A;  5IHI A;  1YP5 A;  2DMO A;  1M27 C;  1PHT A;  1T3L A;  3NHN A;  1HJD A;  2K2M A;  1JEG A;  3M0Q A;  3EHR A;  3UA7 A;  1JXM A;  1X43 A;  1OV3 A;  2FO0 A;  4J9D A;  2NWM A;  1JXO A;  2ENM A;  1G83 A;  3NMZ C;  2DA9 A;  1X6G A;  2AKK A;  2KRS A;  1W70 A;  2FPF A;  2EYY A;  2HSP A;  2A37 A;  1N5Z A;  2FPD A;  4LUD A;  4Z89 A;  1K1Z A;  1KJW A;  2K9G A;  3I35 A;  2GQI A;  4HCK A;  2NUZ A;  2AZV A;  4LN2 A;  1ABQ A;  2EGC A;  2RMO A;  1UG1 A;  2DRM A;  1B3Q A;  4AFU C;  1KFZ A;  1NYF A;  3O5Z A;  2AZS A;  2L3S A;  1GCQ A;  3I5S A;  2FG0 A;  5FW9 A;  5IH2 A;  2DBM A;  1K0S A;  2DE0 X;  1PNJ A;  4CC3 A;  2LP5 A;  4WCI A;  2DNU A;  5I22 A;  2O2O A;  2CH4 A;  1X6B A;  1ZBJ A;  2GNC A;  4AFS C;  3VS6 A;  2BTT A;  1WX6 A;  3FJ5 A;  4HVU A;  3VS3 A;  1GCP A;  1X2Q A;  2J6K A;  1HD3 A;  3UA6 A;  1SHF A;  1GBR A;  5L23 A;  2LX7 A;  3TVT A;  3VS0 A;  1CKB A;  2KE9 A;  1E7O A;  3ULR B;  3NGP A;  2LJ3 A;  2JM8 A;  3EG1 A;  3GBQ A;  1YWP A;  2M51 A;  2EVR A;  1PWT A;  3QWY A;  1UE9 A;  1KIK A;  2FEI A;  1T0H A;  1GCQ C;  2P4R A;  1WA7 A;  1UHF A;  2JTE A;  2I0N A;  1FMK A;  2D8H A;  4FSS A;  4D8K A;  2RQW A;  1CSK A;  2EGE A;  3M0P A;  2YDL A;  3A98 A;  3VRZ A;  2YUO A;  1E6H A;  2DRK A;  1WIE A;  2DLP A;  1WXU A;  2KT1 A;  2VKN A;  3PE0 A;  2H8H A;  2L3P A;  2C0T A;  2DM1 A;  3M0S A;  2DL3 A;  1UEC A;  1NLP C;  1UDL A;  4KRT A;  4J9G A;  3UF4 A;  2CSQ A;  1UJY A;  4F14 A;  2JM9 A;  1M3B A;  1RLQ C;  1SRL A;  2AK5 A;  1BU1 A;  2IIM A;  2KYM A;  2KRN A;  1U3O A;  2BZY A;  3VS2 A;  1NEG A;  3TSZ A;  4QT7 A;  1AD5 A;  1TUC A;  4HXJ A;  1AWW A;  2KEA A;  2J7I A;  5GJV B;  4RTT A;  2KRM A;  2VVK A;  5I11 A;  2A28 A;  2KNB B;  2RPN A;  1WFW A;  3EG0 A;  2MOX A;  1AWO A;  4R0K A;  4J9B A;  1HSQ A;  2DL4 A;  2X3X D;  4Y92 A;  2RQU A;  1BBZ A;  2XMF A;  1GL5 A;  1UGV A;  2HDA A;  2GTJ A;  2KXC A;  2M0Y A;  2YUP A;  2MCN A;  2B86 A;  2VWF A;  2PNI A;  3I5R A;  1H8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...