2A08A

Structure of the yeast yhh6 sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
b'AMATAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVRVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 41.8 kDa protein in SPO13-ARG4 intergenic regio
publication title 3-D proteome of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 10
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a08A00
2JM8A 4F14A 2FPFA 3NMZC 4E6RA 1A0NB 1YWPA 1E7OA 2KT1A 4ORZA 4GBQA 1OOTA 4LE9A 1UHCA 1U3OA 2LJ0A 1WXTA 4A63B 2ESWA 1SHGA 2VVKA 1WI7A 2DILA 2HCKA 2CUBA 1NYGA 4QT7A 2F2XA 3VS7A 2EYXA 2K7AA 5IXFA 4J9BA 1WXUA 2MOXA 4Y92A 4JZ4A 2J7IA 2MCNA 3QWYA 1J3TA 3EG0A 1TUCA 3VS5A 1GCQC 2A36A 2V1QA 4IIOA 2F2WA 2K79A 3GBQA 5GJWB 4AFQC 4RTVA 2DNUA 2ROLA 3M0RA 2X3WD 1RLQC 1SPKA 3EHRA 2FEIA 3UA7A 3M0SA 2LX7A 2L3SA 3EG1A 2RNAA 1T0HA 2KBTA 1BU1A 2ECZA 1NEGA 1ABOA 2DL7A 2CT4A 1MUZA 3SHWA 2VWFA 1K76A 4HVUA 3I5SA 1UG1A 3H0HA 2GTOA 5FWCA 4OMQA 3VS0A 2QDLA 2DX1A 2DM1A 2M51A 4ZNXA 2LQWA 1UUEA 1BB9A 4HXJA 2DRMA 2IIMA 4WCIA 2HSPA 2RPNA 1UFFA 2LZ6B 4J9IA 3UF4A 1JQQA 1ABQA 1U5SA 1V1CA 4LUEA 2YUNA 4RTTA 2GNCA 3NHNA 1WXBA 1M8MA 2BZ8A 2NUZA 1WFWA 1PKTA 2KYBA 1VYVA 1H3HA 2W0ZA 5GJVB 1T0JA 3VS4A 2AZSA 2JT4A 2O31A 1LCKA 4OMNA 2A28A 4RTZA 4OMMA 2ROTA 3PE0A 1OPKA 1JEGA 2ED1A 1YN8A 1H92A 5I22A 3RNJA 1X27A 1X69A 2DBKA 2DLPA 2M0YA 3EG2A 1OPLA 4RTWA 1UDLA 2EGEA 2A08A 1MV3A 2KYMA 2HDAA 2E5KA 4AFZC 3A98A 1W70A 1N5ZA 1U06A 1BK2A 3JV3A 4OMLA 3H0IA 4LN2A 5HCKA 4F17A 2CH4A 4R0KA 1AWWA 2DJQA 2D8HA 2FPEA 2K6DA 4F16A 5IHKA 2GQIA 2HEQA 1GCPA 4Z89A 2K2MA 2K3BA 2HBWA 5FW9A 3IQLA 3M0PA 2OI3A 1I07A 1Y0MA 2O9SA 1HSQA 3PVQA 1B07A 1G2BA 1T3SA 1FMKA 5IHNA 1M27C 3NGPA 2L3QA 1QKXA 4JPBW 1AVZC 3FJ5A 2KR3A 2EPDA 2H8HA 1ZX6A 4M4ZA 1B3QA 2C0IA 2DL8A 3H41A 2J6FA 1GRIA 2F2VA 1ZUUA 1PKSA 2AZVA 3M0UA 1S1NA 1AWJA 2FRWA 1QWFA 1Y57A 2AKKA 2EQIA 2K9GA 1NYFA 1WX6A 2RQUA 1UGVA 1WA7A 1Z9ZA 1ZUYA 4AFSC 1MV0B 2RQRA 3O5ZA 2DMOA 1VA7A 3M0QA 5L23A 2RQWA 2FPDA 1X2QA 2AKLA 2KE9A 1NM7A 2D1XA 4HVWA 4JZ3A 2EKHA 2JM9A 2OAWA 2CSQA 2BTTA 1PWTA 1PNJA 1ZUKA 2EVRA 2JS0A 1JXOA 1YWOA 1UECA 2J6KA 4HVVA 1WDXA 5FWBA 1K0XA 3THKA 2VKNA 4RTUA 1HJDA 3RBBB 3EHQA 1EFNA 1UJYA 1QWEA 2YSQA 1RLPC 2CH4W 3VS1A 3CQTA 4J9FA 1AOJA 2GTJA 3ULRB 2ED0A 2CUDA 3TSZA 4LNPA 4CC7A 2J6OA 4CC4B 4JJDA 1NG2A 1X6GA 1I0CA 1H8KA 4J9CA 1Z9QA 2LCSA 2LQNA 3REBB 2YUQA 1NLOC 1IO6A 2BZYA 1KJWA 2DL4A 2JS2A 2RQVA 1M3AA 3LH5A 1SHFA 3UA6A 1AD5A 2CDTA 2W10A 1SSHA 1T3LA 4J9DA 4D8KA 5ECAA 4IIMA 2I0NA 5I11A 1SRLA 2KNBB 1NLPC 5IH2A 2OJ2A 2YDLA 4DEYA 2CSIA 1UTIA 1UHFA 1GCQA 2KRMA 4CC3A 1NEBA 2EGCA 2O88A 1GFCA 1YCSB 2DRKA 1GFDA 2KROA 1VYTA 2ABLA 2CT3A 2LJ3A 1CSKA 1M3CA 1RI9A 3EGUA 2LMJA 1YP5A 2L2PA 1HD3A 2EBPA 4KRTA 2KGTA 2EW3A 2KXDA 2V1RA 1PRMC 2JW4A 1K0SA 3QWXX 2P4RA 3M0TA 2GGRA 1SRMA 4Z88A 2EGAA 2KEAA 2C0TA 2ENMA 1X43A 4D8DA 2LJ1A 2SRCA 1ZLMA 3U23A 4GLMA 2AK5A 1G83A 2GBQA 4JJCA 5EC7A 1UJ0A 2JMCA 5IXBA 1QKWA 2DBMA 4EIKA 3I35A 4JJBA 2A37A 4J9EA 1AWOA 1WIEA 1YNZA 4K11A 3REAB 4RTXA 1ARKA 3SEMA 1W1FA 1QLYA 2D0NA 1K9AA 3KFVA 2EYWA 2JTEA 1RUWA 2G6FX 1X6BA 1GBRA 4AG1C 2MIOA 2FO0A 1GBQA 1K4US 1AWXA 1AEYA 1UE9A 2KRSA 3I9QA 3I5RA 2L0AA 1VYUA 2DYBA 2EYZA 2YUPA 1SEMA 3VS6A 2BZXA 2D8JA 1CKBA 2NWMA 2DL3A 2SEMA 2XMFA 1KSWA 1OV3A 2C0OA 1OEBA 2RMOA 2LNHB 3VRZA 1W6XA 4AG2C 1AZEA 2O9VA 1JO8A 3VRYA 2JXBA 2X3XD 1E6GA 1KIKA 2KT8A 1CKAA 4AFUC 1ZBJA 4OMPA 2DL5A 1BBZA 1JU5C 5IHIA 4X1VA 2FRYA 2O2OA 2J06A 2CREA 1I1JA 2RQTA 4J9GA 2L3PA 3EG3A 2KXCA 3H0FA 1ZSGA 1WYXA 4J9HA 1WLPB 4RUGA 1K1ZA 2B86A 4RTYA 2RF0A 3R6NA 1AZGB 3PVLA 4FSSA 1X2KA 3UATA 4ESRA 2KRNA 1M30A 4LUDA 3NPFA 4OMOA 2J05A 1XOVA 3ZL7C 3C0CA 4CC2A 1PRLC 2DF6A 2LP5A 2PNIA 2FG0A 1KFZA 1QCFA 2DE0X 1E6HA 4DEXA 3TVTA 2EYYA 2PZ1A 2PTKA 2YUOA 4Z8AA 2DA9A 2RN8A 3VS3A 1GL5A 1M3BA 1FYNA 1TG0A 3VS2A 2DVJA 1TUDA 1PHTA 2YT6A 2JMAA 1JXMA 4HCKA 3TSWA
chains in the Genus database with same CATH superfamily
2FPFA 3A8HB 4PJOC 4E6RA 1E7OA 2KT1A 3C4SA 2ESWA 1SHGA 3VV0A 2NUPA 2VVKA 2DILA 3VJPA 2CUBA 2X35A 1NYGA 1ZA1B 3CCVQ 3CCEQ 4FSXA 2EYXA 5GANf 5IXFA 1WXUA 3M4GA 2HAXA 2HKQB 4OB3B 4Y92A 3OYDA 4XTYA 3QWYA 1J3TA 4ZN1A 1VQLA 1FWZA 2VYTA 1HYOA 4M75B 1VQOQ 3SWNC 1JB0E 1RLQC 1SPKA 5LJ3f 3X20B 2L3SA 3EG1A 5D6YA 1T0HA 3GF5A 1Q86C 4NL3A 3CMET 2PVOB 4LXCA 4OGCA 2CT4A 1VQPA 1WHLA 3SHWA 3PFSA 5A2QE 1WHGA 1LJOA 4MDXA 5CVIA 1M2VB 1MMNA 3G6ET 3CCLT 1M90C 2DM1A 1JJ2A 4ZNXA 3O8VA 3EAEA 4RG8A 4HXJA 2NYSA 1WHKA 1UFFA 2QQSA 4JUVA 2K3XA 2YUNA 2X51A 2GNCA 4GY5A 1WXBA 4XTUA 2BZ8A 1N9SA 2EYQA 1B34B 5GJVB 4C8QE 1K9MC 3UWNA 4FL6A 3OW2P 4N4GA 3OQ5A 2A28A 4RTZA 2EFIA 5CKBA 4OMMA 4M7DC 2R57A 3I55T 1M90R 1OPKA 1JEGA 1PD1A 1YN8A 3TU4K 3R6OA 2F5KA 1MGQA 2F69A 1X27A 3MP6A 4ZGJB 4LDUA 3OYEA 3RMSA 3I56A 1OPLA 2AHJB 5DY9A 4RTWA 4N0AC 2A08A 3M54A 5KYWA 4A4FA 4M7DG 5GAMh 2ZPEB 1KK7A 3CPWS 1KC8U 4LDXA 5HCKA 2DJQA 1OX8A 2D0QB 3H9NA 5GAN4 4HKEA 2B8AA 3OMGA 2YXYA 4Z89A 3I55Q 2RHXA 3X25B 4BY6C 2HBWA 5IN1A 3JB9D 1YBYA 2ZGWA 1WJRA 6AT1B 2NLUA 2RJDA 3IQLA 1VQKT 3BW1A 3L1AA 4A4HA 1YI2A 5KE2A 2QEXA 1HSQA 2HNIA 5IHNA 2QI2A 2L3QA 3UPUA 4PJMA 4LD9K 1ZX6A 1B3QA 5HK0A 2DL8A 3CC2A 3H41A 3BE3A 2KK4A 3G1JA 4C8QF 1YHQA 3T9NA 1VQNT 3M5AA 2OTLT 1PKSA 1S1NA 4FU6A 4OMFB 1BI2A 4F7UE 1NYFA 2PUOB 5GAOn 1NE8A 1UGVA 1Z9ZA 1NJIC 3OYIA 1MV0B 1K8AR 5L23A 2ZPIB 2AKLA 4PJOD 3S3MA 1PD0A 2E4HA 4X9DA 1C6VX 3E9GA 1YWOA 5J39A 4E7ZA 4R56A 5KYUA 1SKUB 2HBPA 2KAFA 1K0XA 2HKNA 4MMLA 2I2LA 3HHTB 1HJDA 3RBBB 3EH1A 3GP8A 1EFNA 1VQNQ 1UJYA 2OTLQ 1QWEA 2M02A 3CD6T 2CH4W 5J3BA 3CC7A 2CUDA 1VQ5A 5EG2A 5M9OA 2XKOC 4CC7A 3NTKA 1VQ8T 2WSFE 1H8KA 2NUTA 2X4WA 5D7UA 3JCMe 3QDRB 2YUQA 1I8FA 3JCMQ 2JS2A 2RQVA 1OU8A 2CP3A 4QVZA 1YIJT 4HCCA 1M5Q1 3M9QA 3UA6A 1AD5A 1YFNA 3X24B 3QHSA 1SSHA 3DB3A 2Z0WA 4AMCA 3RKWA 2KNBB 3SDZA 4EPCA 4E7KA 2OJ2A 4FM4B 1VQ6A 2KRMA 4F7UF 2RB6A 1NEBA 4DBFA 3WXMB 2O88A 3CD6Q 4FT2A 1QVFS 1RI0A 1GFDA 5IT9E 3QZ9B 4XU3A 2F5TX 3QYHB 1Q81U 1M3CA 4BI3A 2YLCA 3EGXB 1RACB 3JRZA 5A0GA 3EGUA 2LMJA 2E1HA 1K9MU 2JVVA 1Y96B 3CCST 2KXDA 4XTZA 2MK5A 4M7DD 1K0SA 3GLXA 4JS5A 2KEAA 1RAEB 2ENMA 1X43A 1ZLMA 1VQMQ 4Z02A 2C06A 5CKEA 3DKMA 3QDFA 3TSWA 2DBMA 2OTJQ 4JJBA 2BUDA 2DERA 1YNZA 2KI7A 1U8RA 1ARKA 3SEMA 3JAME 4L6V5 3JB9I 4M77A 1QLYA 1ACMB 1K9AA 3KFVA 2QA4T 2EYWA 3TCJA 3QSUA 3UT1A 1M2VA 2FO0A 1TOVA 2HQXA 3EFOB 1K4US 2JOYA 1WNLA 1QVGS 1AEYA 4M77F 3M56A 3CMAT 4PJLA 1VYUA 2DYBA 2YRCA 2DVEA 2YUPA 1OZ3A 5DLQE 2NWMA 2FZKB 2XMFA 5IAYA 4DBQA 2E12A 1H3ZA 1VQ4Q 1OEBA 4RCBA 2LNHB 3VRZA 3D7SB 2VV5A 2CZ0B 4KGXB 1JO8A 3CCRT 2KT8A 1XNIA 2E5QA 1ZBJA 2DXTA 2DL5A 3QXEB 1BBZA 1YJNT 3OYNA 3RIRA 4II1A 1LNXA 3CCEA 3CCVA 1I1JA 3M58A 2L3PA 3EG3A 4EMKB 2KXCA 2QTVA 5LJ3d 8AT1B 1N8RU 1NJIU 3CMAQ 4J9HA 4Y28E 1S72T 1K1ZA 3CBPA 1AZGB 5LJ5d 4IUVA 4C92B 1VQ9T 3NPFA 1VQOA 5KCOA 3TREA 5L8RE 1XJWB 3E1SA 4M7DE 4DEXA 3TVTA 2PZ1A 3RKXA 3OS2A 3JCMW 1GL5A 1FYNA 3VS2A 2DVJA 1G3SA 1TUDA 1PHTA 2G3RA 2PQWA 2O2OA 1JXMA 3J81E 4JRIA 2JM8A 1MNDA 1C0MA 3P8BB 1SG5A 2LT4A 2VGNA 1S72Q 4GBQA 1U3OA 2LJ0A 1WXTA 3CPFA 3CCMQ 2CP2A 2M0OA 4QT7A 4J8OA 3VS7A 1VQ9Q 1ZHIA 4C0GA 2MOXA 1PSFA 1XTDA 4JZ4A 3MCAB 1R8OB 2P4TA 2A36A 5C6SA 1UGSB 4IIOA 3OYBA 2K79A 4XU2A 5AT1B 2MI6A 4AFQC 3M0RA 2MWPA 5AYFA 2XG8D 2HMAA 3RR6A 4FW2A 3M0SA 5GAN5 4JRKA 1IGUA 3META 1QP3A 1K73U 3M53A 4IUPA 1BU1A 4LDWA 2ECZA 2EQUA 1TWBA 1WZOA 2MWOA 1BI0A 3JCMX 1UG1A 2WACA 2XHCA 3H0HA 3OMCA 3HRSA 5GAMg 3CCQT 5GAMj 5GAOm 3HFNA 1KC8C 2M51A 1VQ7T 2LQWA 1TSFA 1UUEA 1IREB 3CPWP 4J9IA 2RPNA 3TQ7P 1EZZB 3AHUA 1V1CA 4M77C 5D6WA 4RKUE 4RTTA 2RHYA 3I55A 5LL6S 2JTFA 2QDYB 2NUZA 1WFWA 2L3RA 1H3HA 3GPLA 3VS4A 2O31A 4O5VA 2XICA 4OMNA 4PFOA 2PVDB 1KC8R 2DD4A 2WSCE 4C5GA 4DOWA 3RNJA 4M77G 2BE7D 3JCMd 3OYKA 2CP0A 1D0YA 3EGXA 3LYIA 2DLPA 2M0YA 4HCBA 3JB9H 1UDLA 2EIFA 1Y96A 4MZPA 2FHDA 1W70A 5KYXB 1VIEA 3CPWA 5GMKj 3OSSC 3X28B 4F17A 1AWWA 2K6DA 2GQIA 3HP9A 1M8VA 1YJ9T 2K2MA 5J26A 2K3BA 2E70A 1JJ2P 2OI3A 3BFMA 2O9SA 1PC0A 2MF2A 1G2BA 1VQNA 1FMKA 3OB9A 2OTLA 4E2FB 3NGPA 5FU6B 1FMWA 2DD5A 3PMTA 4JPBW 2JJ9A 3PTAA 3A8GB 2QQAA 3EFOA 2FL7A 2H8HA 2QASA 4M4ZA 1PCXA 1LVKA 4DBRA 2GFUA 1W2BS 2J6FA 3EGDB 1ZUUA 1V29B 2AZVA 1RAGB 1QWFA 3G71T 2A0FB 2YHTA 2AKKA 2K9GA 1OQKA 2P0KA 5LJ5f 1ZUYA 3M4YA 4AFSC 1YJ9Q 3O5ZA 2DMOA 2K4YA 4EDUA 3OYFA 2JZ2A 4F04B 1UGPB 2KY9A 2QQRA 1X2QA 2OAUA 3ZFJA 4JZ3A 2CSQA 3LW5E 1PWTA 3CXCS 4KUDK 3HRUA 2JS0A 1JXOA 5HKCA 3CD6A 1UECA 3EFSA 3MP1A 3L2VA 1Q86R 4HVVA 1WDXA 2JTMA 4EMKA 4D6WA 3THKA 1Q81C 3URGA 4C5HA 2CP6A 1MMDA 1QVFP 3EHQA 5CKFA 3WVEB 2RI5A 3OS1A 4FIBA 1YCYA 3CC4T 2KQWA 3G71Q 2RH2A 3CQTA 3CMEQ 4MZMA 1RL2A 4C92A 5KH6A 4LNPA 2X9HA 3JCMb 3M59A 3CCUT 4JJDA 2EWNA 2DZCA 1KQSS 1I0CA 2CGHA 4BE0A 3FJPA 3V8KA 1KHCA 2E64A 2VXFA 1VQMA 1Z9QA 2LCSA 2LQNA 3REBB 2XDDA 1NLOC 1Q81R 4L59A 3G6EQ 3CCLQ 3OBWA 2OTJA 3PIOA 1SHFA 3PIPA 1K9MR 4A53A 1PM3A 1T3LA 4D8KA 2VGMA 4C5IA 5IH2A 2YDLA 4DEYA 1UTIA 1QQJA 1GCQA 4CC3A 3EH2A 3CC4Q 1PG5B 2DRKA 1QVFA 4PJOB 2KROA 4M77D 2XD0A 1IZ6A 4XK8E 1MMAA 3CCUQ 1RI9A 1YP5A 3FDRA 2E41A 2L2PA 1HD3A 2EKOA 1VQ4A 3ZBDA 2KGTA 2HL3A 3OBYA 2V1RA 1PRMC 2VASA 3QG1A 2P4RA 3QJ6A 5FRNA 4QVDA 5GMKl 2JNGA 4D8DA 1SSFA 1G83A 4JJCA 5EC7A 1QKWA 2V8JA 4EIKA 1BI1A 2L89A 1X01A 4J9EA 1WIEA 2H3JA 1RABB 1M4ZA 1N8RC 2ZCFB 3CMAA 3MJXA 2JTEA 4NL2A 5GMKh 5GAOr 5GAN7 2MIOA 2KVQG 3JCMf 5GAN8 1VQKQ 2FYKA 4JRPA 2CZ7B 2Y4XA 2KSSA 1QVGA 4KUIA 1VQLT 1G5VA 1HK9A 1UE9A 4PNOA 1Q7YU 3DLLA 1WJSA 1NPRA 2L0AA 4IURA 1SEMA 3VS6A 2BZXA 2LQKA 1TH7A 2R5MA 4M7AB 1QCNA 1BYMA 5GAOq 1M9SA 1N8RR 1MHNA 1NJIR 1OI1A 1QMCA 3GNGA 4ZGEB 2L5QA 3H8ZA 1IB8A 1W6XA 3SFMA 3QBYA 1E6GA 1YITT 4HT8A 3VYGA 1VQPT 5CR2A 1S72A 4M7DB 3L2UA 2J06A 5FROA 3CCMA 2P0QA 1UGQB 2HD0A 2DIQA 3OYGA 1VQ9A 3H0FA 1ZSGA 3BDLA 4PL6A 4M77E 2YRDA 4KT0E 3RKYA 3L2WA 3NFCA 2XI9A 1NBEB 3R6NA 2MYSA 3UATA 4ESRA 3MO8A 4JLGA 4OMOA 1UEBA 2J05A 1XOVA 3C0CA 5GANg 4EMKC 2FVUA 3ZEHA 5GANj 2RHUA 2CKKA 2FG0A 5FLXE 2RM4A 3J7AF 4KBMB 2PTKA 3V8LA 4Z8AA 4OGEA 2BIVA 1YITQ 1K73C 2RN8A 4IUQA 3UDCA 1TG0A 2LRQA 1UB4A 2E3IA 3RERA 4C92C 4CRIA 2MMPA 2XDPA 1VQ8Q 3G4ST 1BCOA 1DJ7B 5LJ3g 1MV3A 4HCKA 5LJ3j 2V26A 2K2VA 3A5ZB 3JCMc 4DA4A 1YWPA 3I56T 3BDUA 2EJ9A 1YIJQ 2LX9A 4M75A 4PK4A 4ORZA 3MEWA 4LE9A 3QUIA 1VOMA 4A63B 3OW2S 3EGDA 3ASKA 2X4XA 1IXDA 1O9SA 1K73R 2DJZA 2K7AA 2CS7A 5CO7A 4M75F 1Q82C 2RI3A 4C92G 2J7IA 5I2SA 1D3BB 2MPXC 2VXEA 5GAMe 2PVGB 4QQGA 1I5LA 1TUCA 5HY6A 1GCQC 3VS5A 4ZN3A 3JCMJ 2F2WA 2Y90A 2QGGA 3GBQA 1RAFB 5GJWB 5CQYA 2DYIA 2X3WD 4XU1A 2P0PA 2QEXT 3G4SQ 3OY9A 1I5OB 1TS9A 2NUPB 2FEIA 3CCSQ 2RNAA 1OX9A 3FC3A 1H641 4ATOA 2KBTA 2ZPBB 2RJFA 1M1GA 1NEGA 1ABOA 2DL7A 3CC2T 1B34A 1YHQT 2VWFA 5DM7R 1WHHA 2CP5A 2RK1A 1Y07A 5FWCA 4OMQA 3ER0A 3VS0A 2IVWA 5KCHA 2GFAA 5D6XA 2QDLA 4ZTFA 1PSEA 3QKJA 1BB9A 1FXXA 2DRMA 4J6YA 2IIMA 3V7SA 2QA4Q 4QQDA 3UF4A 3INZA 1U5SA 3NHNA 4M78B 2RJCA 3GIBA 2E3HA 5GMKe 1PKTA 3PNWC 2W0ZA 3A8MB 2AZSA 4N4IA 2JT4A 2JN0A 3L2RA 4A4EA 2ED1A 3NTIA 3A8OB 3VU3C 4RMOA 2LDMA 4KH1B 4OVAA 2QGFB 1X69A 2DBKA 2F1LA 4PJNA 2RJEA 3CCRQ 3EG2A 1YJNQ 4ELYC 2KDSA 4WTOB 2HDAA 2E5KA 4EMGA 1YJ9A 1N5ZA 1BK2A 2CZ6B 3MEAA 4OMLA 1WJQA 3H0IA 4LN2A 2K5LA 2CH4A 4R0KA 4J83A 2FPEA 2LT1A 2KMTA 5IHKA 2D9TA 3QJYA 2HEQA 1EIFA 1BKBA 3JSCA 3DB4A 5HK3A 1VQ6T 3H6ZA 3LWHA 4ZGDB 1T3SA 4ZTJA 4PFZA 4Y91A 4J6WA 2RA2A 3OS0A 1QKXA 4OB1B 2PUKB 4LDVA 1AVZC 2QYZA 5CQXA 3G71A 2IPOB 2KR3A 3CMEA 2EPDA 5GANh 1O75A 2C0IA 4FYXB 2VC8A 2A7YA 2FZCB 2DTIA 3OA6A 3V7CA 1W2BA 3QPHA 1M1KU 3OYHA 1AWJA 3LH0A 2FRWA 3AT1B 5FU6C 4M7AA 4R55A 3G6EA 3CCLA 5I21A 1EX4A 4C92D 4C8QB 1Y7XA 4M75C 5LJ3h 2RQRA 1VA7A 1BI3A 2FPDA 4LD6A 2KE9A 3E19A 4HVWA 2PU9B 4J7FA 2LCLA 2EKHA 5GAN2 3CXCA 1PNJA 4MDWA 5LJ5h 2CP7A 3S3NA 1IGQA 3G7ZA 1ZUKA 2ATCB 3CC4A 1M2OA 2J6KA 2HQEA 2VKNA 4RTUA 5FRMA 1Q82U 3SD4A 3CCUA 4M75G 4BB7A 1RLPC 3ME9A 3OYLA 4AT1B 4J9FA 3GNFB 5A0LA 2DEQA 2J6OA 4JLIA 1KQSA 1NG2A 4L5GA 2RHZA 1WGSA 1OYXA 1IO6A 2BZYA 4XTXA 3CCQQ 2M9UA 3FLGA 2HSEB 2WSEE 1VQ7Q 2VUBA 4J6XA 2CDTA 4C0ZA 4NOYA 2W10A 4PLIA 3CCVT 2LNVA 3PGGA 3DLMA 4BDZA 3CCET 4B9WA 1ZSZB 2I0NA 4C0DB 3JCMP 1VQKA 3RMQA 2CSIA 3NTHA 1UHFA 1WHJA 2X4JA 3L2QA 2LQ8A 1YCSB 2NUTB 1Q7YC 1B7TA 4KULA 2CT3A 2LJ3A 5CKDA 1CSKA 2CYZB 3P8HA 1VQOT 4F7UB 4IUUA 1D3BA 2DXCA 4KGVB 4KRTA 2BKDN 4BI8B 4C92E 3QWXX 4OB2B 3M0TA 1QVPA 2EGAA 5CAIA 2LJ1A 1X6OA 2SRCA 3U23A 1Q7YR 4GLMA 2AK5A 2GBQA 2DTHA 4NS5A 5IXBA 2A37A 1AWOA 4MZTA 4K11A 3OYJA 1D09B 5GAMd 1SF9A 1R0BG 1YJWT 4PJOG 1RUWA 1NPPA 5CK9A 3JB9J 2XDBA 1D1CA 3HSBA 1AWXA 4QW2A 2KRSA 5KYNA 3I5RA 3OYAA 4ANJA 2EYZA 2L8DA 2D8JA 4M78A 2DL3A 2SEMA 3JCMh 2BE9B 1KSWA 1YITA 1OV3A 2C0OA 1BCMA 4J5YA 2QQ9A 4M77B 3LGLA 2K3YA 1VQ8A 3RUXA 4FYYB 5GANe 4M78F 1AZEA 1KD1U 3CEYA 1CKAA 1YIJA 4AFUC 1YJWQ 3CCJT 4M7AC 3OYYA 1GXIE 4OMPA 2EJGA 5FU7B 3EG9B 2EQMA 5IHIA 1LOJA 2FRYA 3LGFA 2CREA 3PMIA 2QQBA 2RQTA 2ZAEA 5LJ3e 4C92F 2H3EB 5DLOA 4RG2A 1LPLA 4RUGA 4M75D 2HL5C 4UC4A 4RTYA 1X75C 3HTRA 4BD3A 3M55A 5LJ5e 4A54A 3PVLA 4FSSA 3RESA 1D0ZA 2KRNA 4M7AG 1RAAB 1PRLC 3VUZA 2DF6A 2LP5A 3G4SA 1KFZA 1QCFA 2DE0X 1E6HA 3GOXA 3HRTA 3MP8A 1UGRB 3CCSA 2K5IA 2V8KA 2YUOA 2P84A 2DA9A 3QYGB 2EQJA 4JJNK 3CCJQ 1ZA2B 2X4YA 1QVGP 4C0FA 1FMVA 3QIIA 2E6ZA 4KGZB 3OS5A 2DZ9A 2JMAA 2AT1B 4TVRA 1D0XA 1TTHB 4F14A 4ELZC 4VUBA 4PFPA 2YLBA 3NMZC 1A0NB 2DFUA 2RHIA 3OSVA 4HA8A 1OOTA 1UHCA 3OW2A 4FYVB 1MNEA 5KYYB 1WI7A 4BI4A 2HCKA 5GAOp 2QA4A 4PKCC 2F2XA 1IRXA 3L42A 2DO3A 2O4XB 3SWNB 4J9BA 2MCNA 1NZ9A 4C8QA 4EMHA 1K8AC 3EG0A 3LWIA 4XTWA 2V1QA 2EJFA 2GF7A 2E65A 2MAMA 4RTVA 2DNUA 2ROLA 1N9RA 2O01E 3MEVA 4PJJA 3KUFA 1QW1A 3A1PA 3EHRA 3UA7A 4FW1A 2LX7A 2QK0A 4OF1A 4BE2A 4N4HA 3CCRA 4CI0C 1MUZA 2DIGA 1RAHB 4JRQA 1YJNA 2OX7A 1K76A 4HVUA 3I5SA 2GTOA 1AT1B 2DX1A 4M75E 1JJ2S 1WQWA 1G3YA 4C5EA 2D6FA 2QXFA 3CBOA 4WCIA 2HSPA 3OYMA 2HQHA 2LZ6B 3QO3A 1JQQA 1ABQA 5CKHA 4LUEA 1TXQA 4XU0A 1M8MA 1TU0B 1WPYA 1U1SA 4X34A 1TUGB 2KYBA 1VYVA 4XQ3A 4OB0B 1T0JA 3HPWA 1VQLQ 2LCCA 4OP0A 5C0MA 1C1AA 3MEUA 1LCKA 2EAYA 5KYXA 1ZSZA 2ROTA 2ZPHB 2DXBA 3PE0A 2XU8A 4M78C 1H92A 7AT1B 5I22A 1Q86U 4RCCA 5A0DA 2EQKA 5GAMf 1BIAA 1M1KC 5GMKi 4F7UA 1WQ7A 3HFOA 4BE1A 1VQPQ 4JS4A 2EGEA 2KYMA 4B9XA 1VQMT 4AFZC 3A98A 4BY6B 1U06A 4Q5WA 1G3WA 3JV3A 3S6WA 1KHIA 1M90U 2OTJT 4M78G 1MMGA 2D8HA 4M7AD 2ZZDA 4BDYA 4F16A 5KE3A 1D1BA 5LJ5g 5LJ5j 1GCPA 1M1KR 1QCOA 5FW9A 3VUBA 5GMKm 3M0PA 3WVDB 9ATCB 4BACA 2DAQA 2COWA 1I07A 3FEOA 1Y0MA 3PVQA 1B07A 3MPUB 4JDSA 4HCZA 1M27C 3RDVA 2DPPB 2FZGB 2COYA 3QZ5B 4X9CA 3FJ5A 3FIFA 3E9FA 1KQ2A 1YI2T 1VQ4T 4XTVA 4PJOE 1OZ2A 1GRIA 2F2VA 2DKGA 3M0UA 1HXDA 4LDYA 3TEEA 2RK2A 3FRNA 3I56Q 1Y57A 3CCQA 2EQIA 1Q82R 1WX6A 3Q1JA 2RQUA 1W4SA 1WA7A 1VQ7A 3JCMV 3M0QA 4XAXB 2XK0A 2RQWA 3PT9A 3M57A 1NM7A 2D1XA 4GLKA 2Y4YA 2OAWA 2JM9A 2BTTA 3VKIA 4A4KA 2DK3A 2EVRA 3EG9A 3JB9F 2K5FA 2YRVA 3BY7A 4C8QC 1RAIB 1BIBA 2V8IA 5FWBA 3KBGA 1F1BB 1YI2Q 2QEXQ 2ZPFB 1G8XA 1WHMA 4QQ6A 5GAOl 1JRIA 1IHWA 1K8AU 2YSQA 5I2MA 5GANd 4QVCA 1JBMA 3VS1A 3S3OA 2DEUA 1AOJA 2GTJA 3ULRB 2ED0A 3TSZA 1Y71A 3CC2Q 4CC4B 3C12A 2RI2A 1XQHA 1YHQQ 1X6GA 4C8QG 4J9CA 2GQVA 4PJOA 1I4K1 4B6MA 3MKDA 4M7AE 1KJWA 3CC7T 2DL4A 3F70A 4P5NA 4E7HA 1M3AA 3LH5A 1VQ5T 4DBHA 5CCAA 1W2BP 3L2ZA 3LLRA 4PJOF 3CCMT 4J9DA 5ECAA 4IIMA 5I11A 1SRLA 1NLPC 1N6AA 3FB9A 1ZBXA 2EGCA 2A3LA 1GFCA 5KYYA 4J7IA 3LX7A 2E6NA 1VYTA 2DXUA 5GAN6 1D1AA 2ABLA 2CZ1B 2O4XA 3SWNA 1OULA 1ZSZC 4IUTA 3CXCP 1R0CB 3JCMg 4FT4A 4C0DC 2EBPA 1FX7A 1M1FA 2RD1A 2JUFA 2EW3A 5KYWB 3CC7Q 1VUBA 2JW4A 2ZPGB 1Q95G 1VQ5Q 4IKFA 4O6JA 4V2SA 3CBMA 1KD1C 2GGRA 4M78D 1SRMA 2AIRB 4Z88A 3V8JA 4DOVA 2C0TA 1ZQ1A 2IG0A 1YJWA 4BUGA 2LTOA 1UJ0A 2JMCA 2DTOA 4E7LA 3I35A 2QAZA 4WF2A 1R77A 3REAB 1KQSP 4RTXA 1W1FA 2M16A 2YWWA 2D0NA 4DQ2A 3HL8A 1I81A 4FCYA 2G6FX 4E47A 4YTLA 1X6BA 1GBRA 4AG1C 1IHVA 2GCXA 1KD1R 1GBQA 1VQ6Q 4M7AF 3J80E 1U1TA 3C94A 4F7UG 3EFRA 1N27A 4KH0B 1KG1A 4HT9A 3I9QA 4M7DA 2E10A 3SB2A 1RADB 1CKBA 4QKUA 3HKSA 5GAN3 4PLLA 3CCJA 2DETA 2QTXA 4MMKA 3KXTA 4M7DF 4ME7A 8ATCB 2RMOA 3N5BB 4AG2C 2O9VA 2LVMA 2RO0A 4N0AA 3VRYA 2JXBA 2X3XD 4A4GA 1KIKA 2LC4A 1QP2A 2COZA 1JU5C 1OU9A 4X1VA 1G3TA 5KYUB 2K57A 2HZYA 3P8DA 4J9GA 1V76A 1P92A 2R5AA 1WYXA 1WLPB 2B86A 2RF0A 5FU7C 3V7RA 2XIDA 3VYHB 1X2KA 3E2UA 4E7SA 3X26B 1M30A 4LUDA 4FYWB 3ZL7C 4CC2A 1VIFA 2QG9B 2PNIA 3MHXA 2M1HA 2VB6A 4C8QD 2EYYA 3JB9G 4M78E 3OYCA 1KQ1A 4E7IA 2R58A 3VS3A 1M3BA 3C95A 5CIUA 3A8LB 1AHJB 4E7JA 2YT6A 2FB7A
chains in the Genus database with same CATH topology
2JM8A 4F14A 2FPFA 3NMZC 4E6RA 1A0NB 1YWPA 1E7OA 2KT1A 4ORZA 4GBQA 1OOTA 4LE9A 1UHCA 1U3OA 2LJ0A 1WXTA 4A63B 2ESWA 1SHGA 2VVKA 1WI7A 2DILA 2HCKA 2CUBA 1NYGA 4QT7A 2F2XA 3VS7A 2EYXA 2K7AA 5IXFA 4J9BA 1WXUA 2MOXA 4Y92A 4JZ4A 2J7IA 2MCNA 3QWYA 1J3TA 3EG0A 1TUCA 3VS5A 1GCQC 2A36A 2V1QA 4IIOA 2F2WA 2K79A 3GBQA 5GJWB 4AFQC 4RTVA 2DNUA 2ROLA 3M0RA 2X3WD 1RLQC 1SPKA 3EHRA 2FEIA 3UA7A 3M0SA 2LX7A 2L3SA 3EG1A 2RNAA 1T0HA 2KBTA 1BU1A 2ECZA 1NEGA 1ABOA 2DL7A 2CT4A 1MUZA 3SHWA 2VWFA 1K76A 4HVUA 3I5SA 1UG1A 3H0HA 2GTOA 5FWCA 4OMQA 3VS0A 2QDLA 2DX1A 2DM1A 2M51A 4ZNXA 2LQWA 1UUEA 1BB9A 4HXJA 2DRMA 2IIMA 4WCIA 2HSPA 2RPNA 1UFFA 2LZ6B 4J9IA 3UF4A 1JQQA 1ABQA 1U5SA 1V1CA 4LUEA 2YUNA 4RTTA 2GNCA 3NHNA 1WXBA 1M8MA 2BZ8A 2NUZA 1WFWA 1PKTA 2KYBA 1VYVA 1H3HA 2W0ZA 5GJVB 1T0JA 3VS4A 2AZSA 2JT4A 2O31A 1LCKA 4OMNA 2A28A 4RTZA 4OMMA 2ROTA 3PE0A 1OPKA 1JEGA 2ED1A 1YN8A 1H92A 5I22A 3RNJA 1X27A 1X69A 2DBKA 2DLPA 2M0YA 3EG2A 1OPLA 4RTWA 1UDLA 2EGEA 2A08A 1MV3A 2KYMA 2HDAA 2E5KA 4AFZC 3A98A 1W70A 1N5ZA 1U06A 1BK2A 3JV3A 4OMLA 3H0IA 4LN2A 5HCKA 4F17A 2CH4A 4R0KA 1AWWA 2DJQA 2D8HA 2FPEA 2K6DA 4F16A 5IHKA 2GQIA 2HEQA 1GCPA 4Z89A 2K2MA 2K3BA 2HBWA 5FW9A 3IQLA 3M0PA 2OI3A 1I07A 1Y0MA 2O9SA 1HSQA 3PVQA 1B07A 1G2BA 1T3SA 1FMKA 5IHNA 1M27C 3NGPA 2L3QA 1QKXA 4JPBW 1AVZC 3FJ5A 2KR3A 2EPDA 2H8HA 1ZX6A 4M4ZA 1B3QA 2C0IA 2DL8A 3H41A 2J6FA 1GRIA 2F2VA 1ZUUA 1PKSA 2AZVA 3M0UA 1S1NA 1AWJA 2FRWA 1QWFA 1Y57A 2AKKA 2EQIA 2K9GA 1NYFA 1WX6A 2RQUA 1UGVA 1WA7A 1Z9ZA 1ZUYA 4AFSC 1MV0B 2RQRA 3O5ZA 2DMOA 1VA7A 3M0QA 5L23A 2RQWA 2FPDA 1X2QA 2AKLA 2KE9A 1NM7A 2D1XA 4HVWA 4JZ3A 2EKHA 2JM9A 2OAWA 2CSQA 2BTTA 1PWTA 1PNJA 1ZUKA 2EVRA 2JS0A 1JXOA 1YWOA 1UECA 2J6KA 4HVVA 1WDXA 5FWBA 1K0XA 3THKA 2VKNA 4RTUA 1HJDA 3RBBB 3EHQA 1EFNA 1UJYA 1QWEA 2YSQA 1RLPC 2CH4W 3VS1A 3CQTA 4J9FA 1AOJA 2GTJA 3ULRB 2ED0A 2CUDA 3TSZA 4LNPA 4CC7A 2J6OA 4CC4B 4JJDA 1NG2A 1X6GA 1I0CA 1H8KA 4J9CA 1Z9QA 2LCSA 2LQNA 3REBB 2YUQA 1NLOC 1IO6A 2BZYA 1KJWA 2DL4A 2JS2A 2RQVA 1M3AA 3LH5A 1SHFA 3UA6A 1AD5A 2CDTA 2W10A 1SSHA 1T3LA 4J9DA 4D8KA 5ECAA 4IIMA 2I0NA 5I11A 1SRLA 2KNBB 1NLPC 5IH2A 2OJ2A 2YDLA 4DEYA 2CSIA 1UTIA 1UHFA 1GCQA 2KRMA 4CC3A 1NEBA 2EGCA 2O88A 1GFCA 1YCSB 2DRKA 1GFDA 2KROA 1VYTA 2ABLA 2CT3A 2LJ3A 1CSKA 1M3CA 1RI9A 3EGUA 2LMJA 1YP5A 2L2PA 1HD3A 2EBPA 4KRTA 2KGTA 2EW3A 2KXDA 2V1RA 1PRMC 2JW4A 1K0SA 3QWXX 2P4RA 3M0TA 2GGRA 1SRMA 4Z88A 2EGAA 2KEAA 2C0TA 2ENMA 1X43A 4D8DA 2LJ1A 2SRCA 1ZLMA 3U23A 4GLMA 2AK5A 1G83A 2GBQA 4JJCA 5EC7A 1UJ0A 2JMCA 5IXBA 1QKWA 2DBMA 4EIKA 3I35A 4JJBA 2A37A 4J9EA 1AWOA 1WIEA 1YNZA 4K11A 3REAB 4RTXA 1ARKA 3SEMA 1W1FA 1QLYA 2D0NA 1K9AA 3KFVA 2EYWA 2JTEA 1RUWA 2G6FX 1X6BA 1GBRA 4AG1C 2MIOA 2FO0A 1GBQA 1K4US 1AWXA 1AEYA 1UE9A 2KRSA 3I9QA 3I5RA 2L0AA 1VYUA 2DYBA 2EYZA 2YUPA 1SEMA 3VS6A 2BZXA 2D8JA 1CKBA 2NWMA 2DL3A 2SEMA 2XMFA 1KSWA 1OV3A 2C0OA 1OEBA 2RMOA 2LNHB 3VRZA 1W6XA 4AG2C 1AZEA 2O9VA 1JO8A 3VRYA 2JXBA 2X3XD 1E6GA 1KIKA 2KT8A 1CKAA 4AFUC 1ZBJA 4OMPA 2DL5A 1BBZA 1JU5C 5IHIA 4X1VA 2FRYA 2O2OA 2J06A 2CREA 1I1JA 2RQTA 4J9GA 2L3PA 3EG3A 2KXCA 3H0FA 1ZSGA 1WYXA 4J9HA 1WLPB 4RUGA 1K1ZA 2B86A 4RTYA 2RF0A 3R6NA 1AZGB 3PVLA 4FSSA 1X2KA 3UATA 4ESRA 2KRNA 1M30A 4LUDA 3NPFA 4OMOA 2J05A 1XOVA 3ZL7C 3C0CA 4CC2A 1PRLC 2DF6A 2LP5A 2PNIA 2FG0A 1KFZA 1QCFA 2DE0X 1E6HA 4DEXA 3TVTA 2EYYA 2PZ1A 2PTKA 2YUOA 4Z8AA 2DA9A 2RN8A 3VS3A 1GL5A 1M3BA 1FYNA 1TG0A 3VS2A 2DVJA 1TUDA 1PHTA 2YT6A 2JMAA 1JXMA 4HCKA 3TSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JM8 A;  4F14 A;  2FPF A;  3NMZ C;  4E6R A;  1A0N B;  1YWP A;  1E7O A;  2KT1 A;  4ORZ A;  4GBQ A;  1OOT A;  4LE9 A;  1UHC A;  1U3O A;  2LJ0 A;  1WXT A;  4A63 B;  2ESW A;  1SHG A;  2VVK A;  1WI7 A;  2DIL A;  2HCK A;  2CUB A;  1NYG A;  4QT7 A;  2F2X A;  3VS7 A;  2EYX A;  2K7A A;  5IXF A;  4J9B A;  1WXU A;  2MOX A;  4Y92 A;  4JZ4 A;  2J7I A;  2MCN A;  3QWY A;  1J3T A;  3EG0 A;  1TUC A;  3VS5 A;  1GCQ C;  2A36 A;  2V1Q A;  4IIO A;  2F2W A;  2K79 A;  3GBQ A;  5GJW B;  4AFQ C;  4RTV A;  2DNU A;  2ROL A;  3M0R A;  2X3W D;  1RLQ C;  1SPK A;  3EHR A;  2FEI A;  3UA7 A;  3M0S A;  2LX7 A;  2L3S A;  3EG1 A;  2RNA A;  1T0H A;  2KBT A;  1BU1 A;  2ECZ A;  1NEG A;  1ABO A;  2DL7 A;  2CT4 A;  1MUZ A;  3SHW A;  2VWF A;  1K76 A;  4HVU A;  3I5S A;  1UG1 A;  3H0H A;  2GTO A;  5FWC A;  4OMQ A;  3VS0 A;  2QDL A;  2DX1 A;  2DM1 A;  2M51 A;  4ZNX A;  2LQW A;  1UUE A;  1BB9 A;  4HXJ A;  2DRM A;  2IIM A;  4WCI A;  2HSP A;  2RPN A;  1UFF A;  2LZ6 B;  4J9I A;  3UF4 A;  1JQQ A;  1ABQ A;  1U5S A;  1V1C A;  4LUE A;  2YUN A;  4RTT A;  2GNC A;  3NHN A;  1WXB A;  1M8M A;  2BZ8 A;  2NUZ A;  1WFW A;  1PKT A;  2KYB A;  1VYV A;  1H3H A;  2W0Z A;  5GJV B;  1T0J A;  3VS4 A;  2AZS A;  2JT4 A;  2O31 A;  1LCK A;  4OMN A;  2A28 A;  4RTZ A;  4OMM A;  2ROT A;  3PE0 A;  1OPK A;  1JEG A;  2ED1 A;  1YN8 A;  1H92 A;  5I22 A;  3RNJ A;  1X27 A;  1X69 A;  2DBK A;  2DLP A;  2M0Y A;  3EG2 A;  1OPL A;  4RTW A;  1UDL A;  2EGE A;  2A08 A;  1MV3 A;  2KYM A;  2HDA A;  2E5K A;  4AFZ C;  3A98 A;  1W70 A;  1N5Z A;  1U06 A;  1BK2 A;  3JV3 A;  4OML A;  3H0I A;  4LN2 A;  5HCK A;  4F17 A;  2CH4 A;  4R0K A;  1AWW A;  2DJQ A;  2D8H A;  2FPE A;  2K6D A;  4F16 A;  5IHK A;  2GQI A;  2HEQ A;  1GCP A;  4Z89 A;  2K2M A;  2K3B A;  2HBW A;  5FW9 A;  3IQL A;  3M0P A;  2OI3 A;  1I07 A;  1Y0M A;  2O9S A;  1HSQ A;  3PVQ A;  1B07 A;  1G2B A;  1T3S A;  1FMK A;  5IHN A;  1M27 C;  3NGP A;  2L3Q A;  1QKX A;  4JPB W;  1AVZ C;  3FJ5 A;  2KR3 A;  2EPD A;  2H8H A;  1ZX6 A;  4M4Z A;  1B3Q A;  2C0I A;  2DL8 A;  3H41 A;  2J6F A;  1GRI A;  2F2V A;  1ZUU A;  1PKS A;  2AZV A;  3M0U A;  1S1N A;  1AWJ A;  2FRW A;  1QWF A;  1Y57 A;  2AKK A;  2EQI A;  2K9G A;  1NYF A;  1WX6 A;  2RQU A;  1UGV A;  1WA7 A;  1Z9Z A;  1ZUY A;  4AFS C;  1MV0 B;  2RQR A;  3O5Z A;  2DMO A;  1VA7 A;  3M0Q A;  5L23 A;  2RQW A;  2FPD A;  1X2Q A;  2AKL A;  2KE9 A;  1NM7 A;  2D1X A;  4HVW A;  4JZ3 A;  2EKH A;  2JM9 A;  2OAW A;  2CSQ A;  2BTT A;  1PWT A;  1PNJ A;  1ZUK A;  2EVR A;  2JS0 A;  1JXO A;  1YWO A;  1UEC A;  2J6K A;  4HVV A;  1WDX A;  5FWB A;  1K0X A;  3THK A;  2VKN A;  4RTU A;  1HJD A;  3RBB B;  3EHQ A;  1EFN A;  1UJY A;  1QWE A;  2YSQ A;  1RLP C;  2CH4 W;  3VS1 A;  3CQT A;  4J9F A;  1AOJ A;  2GTJ A;  3ULR B;  2ED0 A;  2CUD A;  3TSZ A;  4LNP A;  4CC7 A;  2J6O A;  4CC4 B;  4JJD A;  1NG2 A;  1X6G A;  1I0C A;  1H8K A;  4J9C A;  1Z9Q A;  2LCS A;  2LQN A;  3REB B;  2YUQ A;  1NLO C;  1IO6 A;  2BZY A;  1KJW A;  2DL4 A;  2JS2 A;  2RQV A;  1M3A A;  3LH5 A;  1SHF A;  3UA6 A;  1AD5 A;  2CDT A;  2W10 A;  1SSH A;  1T3L A;  4J9D A;  4D8K A;  5ECA A;  4IIM A;  2I0N A;  5I11 A;  1SRL A;  2KNB B;  1NLP C;  5IH2 A;  2OJ2 A;  2YDL A;  4DEY A;  2CSI A;  1UTI A;  1UHF A;  1GCQ A;  2KRM A;  4CC3 A;  1NEB A;  2EGC A;  2O88 A;  1GFC A;  1YCS B;  2DRK A;  1GFD A;  2KRO A;  1VYT A;  2ABL A;  2CT3 A;  2LJ3 A;  1CSK A;  1M3C A;  1RI9 A;  3EGU A;  2LMJ A;  1YP5 A;  2L2P A;  1HD3 A;  2EBP A;  4KRT A;  2KGT A;  2EW3 A;  2KXD A;  2V1R A;  1PRM C;  2JW4 A;  1K0S A;  3QWX X;  2P4R A;  3M0T A;  2GGR A;  1SRM A;  4Z88 A;  2EGA A;  2KEA A;  2C0T A;  2ENM A;  1X43 A;  4D8D A;  2LJ1 A;  2SRC A;  1ZLM A;  3U23 A;  4GLM A;  2AK5 A;  1G83 A;  2GBQ A;  4JJC A;  5EC7 A;  1UJ0 A;  2JMC A;  5IXB A;  1QKW A;  2DBM A;  4EIK A;  3I35 A;  4JJB A;  2A37 A;  4J9E A;  1AWO A;  1WIE A;  1YNZ A;  4K11 A;  3REA B;  4RTX A;  1ARK A;  3SEM A;  1W1F A;  1QLY A;  2D0N A;  1K9A A;  3KFV A;  2EYW A;  2JTE A;  1RUW A;  2G6F X;  1X6B A;  1GBR A;  4AG1 C;  2MIO A;  2FO0 A;  1GBQ A;  1K4U S;  1AWX A;  1AEY A;  1UE9 A;  2KRS A;  3I9Q A;  3I5R A;  2L0A A;  1VYU A;  2DYB A;  2EYZ A;  2YUP A;  1SEM A;  3VS6 A;  2BZX A;  2D8J A;  1CKB A;  2NWM A;  2DL3 A;  2SEM A;  2XMF A;  1KSW A;  1OV3 A;  2C0O A;  1OEB A;  2RMO A;  2LNH B;  3VRZ A;  1W6X A;  4AG2 C;  1AZE A;  2O9V A;  1JO8 A;  3VRY A;  2JXB A;  2X3X D;  1E6G A;  1KIK A;  2KT8 A;  1CKA A;  4AFU C;  1ZBJ A;  4OMP A;  2DL5 A;  1BBZ A;  1JU5 C;  5IHI A;  4X1V A;  2FRY A;  2O2O A;  2J06 A;  2CRE A;  1I1J A;  2RQT A;  4J9G A;  2L3P A;  3EG3 A;  2KXC A;  3H0F A;  1ZSG A;  1WYX A;  4J9H A;  1WLP B;  4RUG A;  1K1Z A;  2B86 A;  4RTY A;  2RF0 A;  3R6N A;  1AZG B;  3PVL A;  4FSS A;  1X2K A;  3UAT A;  4ESR A;  2KRN A;  1M30 A;  4LUD A;  3NPF A;  4OMO A;  2J05 A;  1XOV A;  3ZL7 C;  3C0C A;  4CC2 A;  1PRL C;  2DF6 A;  2LP5 A;  2PNI A;  2FG0 A;  1KFZ A;  1QCF A;  2DE0 X;  1E6H A;  4DEX A;  3TVT A;  2EYY A;  2PZ1 A;  2PTK A;  2YUO A;  4Z8A A;  2DA9 A;  2RN8 A;  3VS3 A;  1GL5 A;  1M3B A;  1FYN A;  1TG0 A;  3VS2 A;  2DVJ A;  1TUD A;  1PHT A;  2YT6 A;  2JMA A;  1JXM A;  4HCK A;  3TSW A; 
#chains in the Genus database with same CATH topology
 2FPF A;  3A8H B;  4PJO C;  4E6R A;  1E7O A;  2KT1 A;  3C4S A;  2ESW A;  1SHG A;  3VV0 A;  2NUP A;  2VVK A;  2DIL A;  3VJP A;  2CUB A;  2X35 A;  1NYG A;  1ZA1 B;  3CCV Q;  3CCE Q;  4FSX A;  2EYX A;  5GAN f;  5IXF A;  1WXU A;  3M4G A;  2HAX A;  2HKQ B;  4OB3 B;  4Y92 A;  3OYD A;  4XTY A;  3QWY A;  1J3T A;  4ZN1 A;  1VQL A;  1FWZ A;  2VYT A;  1HYO A;  4M75 B;  1VQO Q;  3SWN C;  1JB0 E;  1RLQ C;  1SPK A;  5LJ3 f;  3X20 B;  2L3S A;  3EG1 A;  5D6Y A;  1T0H A;  3GF5 A;  1Q86 C;  4NL3 A;  3CME T;  2PVO B;  4LXC A;  4OGC A;  2CT4 A;  1VQP A;  1WHL A;  3SHW A;  3PFS A;  5A2Q E;  1WHG A;  1LJO A;  4MDX A;  5CVI A;  1M2V B;  1MMN A;  3G6E T;  3CCL T;  1M90 C;  2DM1 A;  1JJ2 A;  4ZNX A;  3O8V A;  3EAE A;  4RG8 A;  4HXJ A;  2NYS A;  1WHK A;  1UFF A;  2QQS A;  4JUV A;  2K3X A;  2YUN A;  2X51 A;  2GNC A;  4GY5 A;  1WXB A;  4XTU A;  2BZ8 A;  1N9S A;  2EYQ A;  1B34 B;  5GJV B;  4C8Q E;  1K9M C;  3UWN A;  4FL6 A;  3OW2 P;  4N4G A;  3OQ5 A;  2A28 A;  4RTZ A;  2EFI A;  5CKB A;  4OMM A;  4M7D C;  2R57 A;  3I55 T;  1M90 R;  1OPK A;  1JEG A;  1PD1 A;  1YN8 A;  3TU4 K;  3R6O A;  2F5K A;  1MGQ A;  2F69 A;  1X27 A;  3MP6 A;  4ZGJ B;  4LDU A;  3OYE A;  3RMS A;  3I56 A;  1OPL A;  2AHJ B;  5DY9 A;  4RTW A;  4N0A C;  2A08 A;  3M54 A;  5KYW A;  4A4F A;  4M7D G;  5GAM h;  2ZPE B;  1KK7 A;  3CPW S;  1KC8 U;  4LDX A;  5HCK A;  2DJQ A;  1OX8 A;  2D0Q B;  3H9N A;  5GAN 4;  4HKE A;  2B8A A;  3OMG A;  2YXY A;  4Z89 A;  3I55 Q;  2RHX A;  3X25 B;  4BY6 C;  2HBW A;  5IN1 A;  3JB9 D;  1YBY A;  2ZGW A;  1WJR A;  6AT1 B;  2NLU A;  2RJD A;  3IQL A;  1VQK T;  3BW1 A;  3L1A A;  4A4H A;  1YI2 A;  5KE2 A;  2QEX A;  1HSQ A;  2HNI A;  5IHN A;  2QI2 A;  2L3Q A;  3UPU A;  4PJM A;  4LD9 K;  1ZX6 A;  1B3Q A;  5HK0 A;  2DL8 A;  3CC2 A;  3H41 A;  3BE3 A;  2KK4 A;  3G1J A;  4C8Q F;  1YHQ A;  3T9N A;  1VQN T;  3M5A A;  2OTL T;  1PKS A;  1S1N A;  4FU6 A;  4OMF B;  1BI2 A;  4F7U E;  1NYF A;  2PUO B;  5GAO n;  1NE8 A;  1UGV A;  1Z9Z A;  1NJI C;  3OYI A;  1MV0 B;  1K8A R;  5L23 A;  2ZPI B;  2AKL A;  4PJO D;  3S3M A;  1PD0 A;  2E4H A;  4X9D A;  1C6V X;  3E9G A;  1YWO A;  5J39 A;  4E7Z A;  4R56 A;  5KYU A;  1SKU B;  2HBP A;  2KAF A;  1K0X A;  2HKN A;  4MML A;  2I2L A;  3HHT B;  1HJD A;  3RBB B;  3EH1 A;  3GP8 A;  1EFN A;  1VQN Q;  1UJY A;  2OTL Q;  1QWE A;  2M02 A;  3CD6 T;  2CH4 W;  5J3B A;  3CC7 A;  2CUD A;  1VQ5 A;  5EG2 A;  5M9O A;  2XKO C;  4CC7 A;  3NTK A;  1VQ8 T;  2WSF E;  1H8K A;  2NUT A;  2X4W A;  5D7U A;  3JCM e;  3QDR B;  2YUQ A;  1I8F A;  3JCM Q;  2JS2 A;  2RQV A;  1OU8 A;  2CP3 A;  4QVZ A;  1YIJ T;  4HCC A;  1M5Q 1;  3M9Q A;  3UA6 A;  1AD5 A;  1YFN A;  3X24 B;  3QHS A;  1SSH A;  3DB3 A;  2Z0W A;  4AMC A;  3RKW A;  2KNB B;  3SDZ A;  4EPC A;  4E7K A;  2OJ2 A;  4FM4 B;  1VQ6 A;  2KRM A;  4F7U F;  2RB6 A;  1NEB A;  4DBF A;  3WXM B;  2O88 A;  3CD6 Q;  4FT2 A;  1QVF S;  1RI0 A;  1GFD A;  5IT9 E;  3QZ9 B;  4XU3 A;  2F5T X;  3QYH B;  1Q81 U;  1M3C A;  4BI3 A;  2YLC A;  3EGX B;  1RAC B;  3JRZ A;  5A0G A;  3EGU A;  2LMJ A;  2E1H A;  1K9M U;  2JVV A;  1Y96 B;  3CCS T;  2KXD A;  4XTZ A;  2MK5 A;  4M7D D;  1K0S A;  3GLX A;  4JS5 A;  2KEA A;  1RAE B;  2ENM A;  1X43 A;  1ZLM A;  1VQM Q;  4Z02 A;  2C06 A;  5CKE A;  3DKM A;  3QDF A;  3TSW A;  2DBM A;  2OTJ Q;  4JJB A;  2BUD A;  2DER A;  1YNZ A;  2KI7 A;  1U8R A;  1ARK A;  3SEM A;  3JAM E;  4L6V 5;  3JB9 I;  4M77 A;  1QLY A;  1ACM B;  1K9A A;  3KFV A;  2QA4 T;  2EYW A;  3TCJ A;  3QSU A;  3UT1 A;  1M2V A;  2FO0 A;  1TOV A;  2HQX A;  3EFO B;  1K4U S;  2JOY A;  1WNL A;  1QVG S;  1AEY A;  4M77 F;  3M56 A;  3CMA T;  4PJL A;  1VYU A;  2DYB A;  2YRC A;  2DVE A;  2YUP A;  1OZ3 A;  5DLQ E;  2NWM A;  2FZK B;  2XMF A;  5IAY A;  4DBQ A;  2E12 A;  1H3Z A;  1VQ4 Q;  1OEB A;  4RCB A;  2LNH B;  3VRZ A;  3D7S B;  2VV5 A;  2CZ0 B;  4KGX B;  1JO8 A;  3CCR T;  2KT8 A;  1XNI A;  2E5Q A;  1ZBJ A;  2DXT A;  2DL5 A;  3QXE B;  1BBZ A;  1YJN T;  3OYN A;  3RIR A;  4II1 A;  1LNX A;  3CCE A;  3CCV A;  1I1J A;  3M58 A;  2L3P A;  3EG3 A;  4EMK B;  2KXC A;  2QTV A;  5LJ3 d;  8AT1 B;  1N8R U;  1NJI U;  3CMA Q;  4J9H A;  4Y28 E;  1S72 T;  1K1Z A;  3CBP A;  1AZG B;  5LJ5 d;  4IUV A;  4C92 B;  1VQ9 T;  3NPF A;  1VQO A;  5KCO A;  3TRE A;  5L8R E;  1XJW B;  3E1S A;  4M7D E;  4DEX A;  3TVT A;  2PZ1 A;  3RKX A;  3OS2 A;  3JCM W;  1GL5 A;  1FYN A;  3VS2 A;  2DVJ A;  1G3S A;  1TUD A;  1PHT A;  2G3R A;  2PQW A;  2O2O A;  1JXM A;  3J81 E;  4JRI A;  2JM8 A;  1MND A;  1C0M A;  3P8B B;  1SG5 A;  2LT4 A;  2VGN A;  1S72 Q;  4GBQ A;  1U3O A;  2LJ0 A;  1WXT A;  3CPF A;  3CCM Q;  2CP2 A;  2M0O A;  4QT7 A;  4J8O A;  3VS7 A;  1VQ9 Q;  1ZHI A;  4C0G A;  2MOX A;  1PSF A;  1XTD A;  4JZ4 A;  3MCA B;  1R8O B;  2P4T A;  2A36 A;  5C6S A;  1UGS B;  4IIO A;  3OYB A;  2K79 A;  4XU2 A;  5AT1 B;  2MI6 A;  4AFQ C;  3M0R A;  2MWP A;  5AYF A;  2XG8 D;  2HMA A;  3RR6 A;  4FW2 A;  3M0S A;  5GAN 5;  4JRK A;  1IGU A;  3MET A;  1QP3 A;  1K73 U;  3M53 A;  4IUP A;  1BU1 A;  4LDW A;  2ECZ A;  2EQU A;  1TWB A;  1WZO A;  2MWO A;  1BI0 A;  3JCM X;  1UG1 A;  2WAC A;  2XHC A;  3H0H A;  3OMC A;  3HRS A;  5GAM g;  3CCQ T;  5GAM j;  5GAO m;  3HFN A;  1KC8 C;  2M51 A;  1VQ7 T;  2LQW A;  1TSF A;  1UUE A;  1IRE B;  3CPW P;  4J9I A;  2RPN A;  3TQ7 P;  1EZZ B;  3AHU A;  1V1C A;  4M77 C;  5D6W A;  4RKU E;  4RTT A;  2RHY A;  3I55 A;  5LL6 S;  2JTF A;  2QDY B;  2NUZ A;  1WFW A;  2L3R A;  1H3H A;  3GPL A;  3VS4 A;  2O31 A;  4O5V A;  2XIC A;  4OMN A;  4PFO A;  2PVD B;  1KC8 R;  2DD4 A;  2WSC E;  4C5G A;  4DOW A;  3RNJ A;  4M77 G;  2BE7 D;  3JCM d;  3OYK A;  2CP0 A;  1D0Y A;  3EGX A;  3LYI A;  2DLP A;  2M0Y A;  4HCB A;  3JB9 H;  1UDL A;  2EIF A;  1Y96 A;  4MZP A;  2FHD A;  1W70 A;  5KYX B;  1VIE A;  3CPW A;  5GMK j;  3OSS C;  3X28 B;  4F17 A;  1AWW A;  2K6D A;  2GQI A;  3HP9 A;  1M8V A;  1YJ9 T;  2K2M A;  5J26 A;  2K3B A;  2E70 A;  1JJ2 P;  2OI3 A;  3BFM A;  2O9S A;  1PC0 A;  2MF2 A;  1G2B A;  1VQN A;  1FMK A;  3OB9 A;  2OTL A;  4E2F B;  3NGP A;  5FU6 B;  1FMW A;  2DD5 A;  3PMT A;  4JPB W;  2JJ9 A;  3PTA A;  3A8G B;  2QQA A;  3EFO A;  2FL7 A;  2H8H A;  2QAS A;  4M4Z A;  1PCX A;  1LVK A;  4DBR A;  2GFU A;  1W2B S;  2J6F A;  3EGD B;  1ZUU A;  1V29 B;  2AZV A;  1RAG B;  1QWF A;  3G71 T;  2A0F B;  2YHT A;  2AKK A;  2K9G A;  1OQK A;  2P0K A;  5LJ5 f;  1ZUY A;  3M4Y A;  4AFS C;  1YJ9 Q;  3O5Z A;  2DMO A;  2K4Y A;  4EDU A;  3OYF A;  2JZ2 A;  4F04 B;  1UGP B;  2KY9 A;  2QQR A;  1X2Q A;  2OAU A;  3ZFJ A;  4JZ3 A;  2CSQ A;  3LW5 E;  1PWT A;  3CXC S;  4KUD K;  3HRU A;  2JS0 A;  1JXO A;  5HKC A;  3CD6 A;  1UEC A;  3EFS A;  3MP1 A;  3L2V A;  1Q86 R;  4HVV A;  1WDX A;  2JTM A;  4EMK A;  4D6W A;  3THK A;  1Q81 C;  3URG A;  4C5H A;  2CP6 A;  1MMD A;  1QVF P;  3EHQ A;  5CKF A;  3WVE B;  2RI5 A;  3OS1 A;  4FIB A;  1YCY A;  3CC4 T;  2KQW A;  3G71 Q;  2RH2 A;  3CQT A;  3CME Q;  4MZM A;  1RL2 A;  4C92 A;  5KH6 A;  4LNP A;  2X9H A;  3JCM b;  3M59 A;  3CCU T;  4JJD A;  2EWN A;  2DZC A;  1KQS S;  1I0C A;  2CGH A;  4BE0 A;  3FJP A;  3V8K A;  1KHC A;  2E64 A;  2VXF A;  1VQM A;  1Z9Q A;  2LCS A;  2LQN A;  3REB B;  2XDD A;  1NLO C;  1Q81 R;  4L59 A;  3G6E Q;  3CCL Q;  3OBW A;  2OTJ A;  3PIO A;  1SHF A;  3PIP A;  1K9M R;  4A53 A;  1PM3 A;  1T3L A;  4D8K A;  2VGM A;  4C5I A;  5IH2 A;  2YDL A;  4DEY A;  1UTI A;  1QQJ A;  1GCQ A;  4CC3 A;  3EH2 A;  3CC4 Q;  1PG5 B;  2DRK A;  1QVF A;  4PJO B;  2KRO A;  4M77 D;  2XD0 A;  1IZ6 A;  4XK8 E;  1MMA A;  3CCU Q;  1RI9 A;  1YP5 A;  3FDR A;  2E41 A;  2L2P A;  1HD3 A;  2EKO A;  1VQ4 A;  3ZBD A;  2KGT A;  2HL3 A;  3OBY A;  2V1R A;  1PRM C;  2VAS A;  3QG1 A;  2P4R A;  3QJ6 A;  5FRN A;  4QVD A;  5GMK l;  2JNG A;  4D8D A;  1SSF A;  1G83 A;  4JJC A;  5EC7 A;  1QKW A;  2V8J A;  4EIK A;  1BI1 A;  2L89 A;  1X01 A;  4J9E A;  1WIE A;  2H3J A;  1RAB B;  1M4Z A;  1N8R C;  2ZCF B;  3CMA A;  3MJX A;  2JTE A;  4NL2 A;  5GMK h;  5GAO r;  5GAN 7;  2MIO A;  2KVQ G;  3JCM f;  5GAN 8;  1VQK Q;  2FYK A;  4JRP A;  2CZ7 B;  2Y4X A;  2KSS A;  1QVG A;  4KUI A;  1VQL T;  1G5V A;  1HK9 A;  1UE9 A;  4PNO A;  1Q7Y U;  3DLL A;  1WJS A;  1NPR A;  2L0A A;  4IUR A;  1SEM A;  3VS6 A;  2BZX A;  2LQK A;  1TH7 A;  2R5M A;  4M7A B;  1QCN A;  1BYM A;  5GAO q;  1M9S A;  1N8R R;  1MHN A;  1NJI R;  1OI1 A;  1QMC A;  3GNG A;  4ZGE B;  2L5Q A;  3H8Z A;  1IB8 A;  1W6X A;  3SFM A;  3QBY A;  1E6G A;  1YIT T;  4HT8 A;  3VYG A;  1VQP T;  5CR2 A;  1S72 A;  4M7D B;  3L2U A;  2J06 A;  5FRO A;  3CCM A;  2P0Q A;  1UGQ B;  2HD0 A;  2DIQ A;  3OYG A;  1VQ9 A;  3H0F A;  1ZSG A;  3BDL A;  4PL6 A;  4M77 E;  2YRD A;  4KT0 E;  3RKY A;  3L2W A;  3NFC A;  2XI9 A;  1NBE B;  3R6N A;  2MYS A;  3UAT A;  4ESR A;  3MO8 A;  4JLG A;  4OMO A;  1UEB A;  2J05 A;  1XOV A;  3C0C A;  5GAN g;  4EMK C;  2FVU A;  3ZEH A;  5GAN j;  2RHU A;  2CKK A;  2FG0 A;  5FLX E;  2RM4 A;  3J7A F;  4KBM B;  2PTK A;  3V8L A;  4Z8A A;  4OGE A;  2BIV A;  1YIT Q;  1K73 C;  2RN8 A;  4IUQ A;  3UDC A;  1TG0 A;  2LRQ A;  1UB4 A;  2E3I A;  3RER A;  4C92 C;  4CRI A;  2MMP A;  2XDP A;  1VQ8 Q;  3G4S T;  1BCO A;  1DJ7 B;  5LJ3 g;  1MV3 A;  4HCK A;  5LJ3 j;  2V26 A;  2K2V A;  3A5Z B;  3JCM c;  4DA4 A;  1YWP A;  3I56 T;  3BDU A;  2EJ9 A;  1YIJ Q;  2LX9 A;  4M75 A;  4PK4 A;  4ORZ A;  3MEW A;  4LE9 A;  3QUI A;  1VOM A;  4A63 B;  3OW2 S;  3EGD A;  3ASK A;  2X4X A;  1IXD A;  1O9S A;  1K73 R;  2DJZ A;  2K7A A;  2CS7 A;  5CO7 A;  4M75 F;  1Q82 C;  2RI3 A;  4C92 G;  2J7I A;  5I2S A;  1D3B B;  2MPX C;  2VXE A;  5GAM e;  2PVG B;  4QQG A;  1I5L A;  1TUC A;  5HY6 A;  1GCQ C;  3VS5 A;  4ZN3 A;  3JCM J;  2F2W A;  2Y90 A;  2QGG A;  3GBQ A;  1RAF B;  5GJW B;  5CQY A;  2DYI A;  2X3W D;  4XU1 A;  2P0P A;  2QEX T;  3G4S Q;  3OY9 A;  1I5O B;  1TS9 A;  2NUP B;  2FEI A;  3CCS Q;  2RNA A;  1OX9 A;  3FC3 A;  1H64 1;  4ATO A;  2KBT A;  2ZPB B;  2RJF A;  1M1G A;  1NEG A;  1ABO A;  2DL7 A;  3CC2 T;  1B34 A;  1YHQ T;  2VWF A;  5DM7 R;  1WHH A;  2CP5 A;  2RK1 A;  1Y07 A;  5FWC A;  4OMQ A;  3ER0 A;  3VS0 A;  2IVW A;  5KCH A;  2GFA A;  5D6X A;  2QDL A;  4ZTF A;  1PSE A;  3QKJ A;  1BB9 A;  1FXX A;  2DRM A;  4J6Y A;  2IIM A;  3V7S A;  2QA4 Q;  4QQD A;  3UF4 A;  3INZ A;  1U5S A;  3NHN A;  4M78 B;  2RJC A;  3GIB A;  2E3H A;  5GMK e;  1PKT A;  3PNW C;  2W0Z A;  3A8M B;  2AZS A;  4N4I A;  2JT4 A;  2JN0 A;  3L2R A;  4A4E A;  2ED1 A;  3NTI A;  3A8O B;  3VU3 C;  4RMO A;  2LDM A;  4KH1 B;  4OVA A;  2QGF B;  1X69 A;  2DBK A;  2F1L A;  4PJN A;  2RJE A;  3CCR Q;  3EG2 A;  1YJN Q;  4ELY C;  2KDS A;  4WTO B;  2HDA A;  2E5K A;  4EMG A;  1YJ9 A;  1N5Z A;  1BK2 A;  2CZ6 B;  3MEA A;  4OML A;  1WJQ A;  3H0I A;  4LN2 A;  2K5L A;  2CH4 A;  4R0K A;  4J83 A;  2FPE A;  2LT1 A;  2KMT A;  5IHK A;  2D9T A;  3QJY A;  2HEQ A;  1EIF A;  1BKB A;  3JSC A;  3DB4 A;  5HK3 A;  1VQ6 T;  3H6Z A;  3LWH A;  4ZGD B;  1T3S A;  4ZTJ A;  4PFZ A;  4Y91 A;  4J6W A;  2RA2 A;  3OS0 A;  1QKX A;  4OB1 B;  2PUK B;  4LDV A;  1AVZ C;  2QYZ A;  5CQX A;  3G71 A;  2IPO B;  2KR3 A;  3CME A;  2EPD A;  5GAN h;  1O75 A;  2C0I A;  4FYX B;  2VC8 A;  2A7Y A;  2FZC B;  2DTI A;  3OA6 A;  3V7C A;  1W2B A;  3QPH A;  1M1K U;  3OYH A;  1AWJ A;  3LH0 A;  2FRW A;  3AT1 B;  5FU6 C;  4M7A A;  4R55 A;  3G6E A;  3CCL A;  5I21 A;  1EX4 A;  4C92 D;  4C8Q B;  1Y7X A;  4M75 C;  5LJ3 h;  2RQR A;  1VA7 A;  1BI3 A;  2FPD A;  4LD6 A;  2KE9 A;  3E19 A;  4HVW A;  2PU9 B;  4J7F A;  2LCL A;  2EKH A;  5GAN 2;  3CXC A;  1PNJ A;  4MDW A;  5LJ5 h;  2CP7 A;  3S3N A;  1IGQ A;  3G7Z A;  1ZUK A;  2ATC B;  3CC4 A;  1M2O A;  2J6K A;  2HQE A;  2VKN A;  4RTU A;  5FRM A;  1Q82 U;  3SD4 A;  3CCU A;  4M75 G;  4BB7 A;  1RLP C;  3ME9 A;  3OYL A;  4AT1 B;  4J9F A;  3GNF B;  5A0L A;  2DEQ A;  2J6O A;  4JLI A;  1KQS A;  1NG2 A;  4L5G A;  2RHZ A;  1WGS A;  1OYX A;  1IO6 A;  2BZY A;  4XTX A;  3CCQ Q;  2M9U A;  3FLG A;  2HSE B;  2WSE E;  1VQ7 Q;  2VUB A;  4J6X A;  2CDT A;  4C0Z A;  4NOY A;  2W10 A;  4PLI A;  3CCV T;  2LNV A;  3PGG A;  3DLM A;  4BDZ A;  3CCE T;  4B9W A;  1ZSZ B;  2I0N A;  4C0D B;  3JCM P;  1VQK A;  3RMQ A;  2CSI A;  3NTH A;  1UHF A;  1WHJ A;  2X4J A;  3L2Q A;  2LQ8 A;  1YCS B;  2NUT B;  1Q7Y C;  1B7T A;  4KUL A;  2CT3 A;  2LJ3 A;  5CKD A;  1CSK A;  2CYZ B;  3P8H A;  1VQO T;  4F7U B;  4IUU A;  1D3B A;  2DXC A;  4KGV B;  4KRT A;  2BKD N;  4BI8 B;  4C92 E;  3QWX X;  4OB2 B;  3M0T A;  1QVP A;  2EGA A;  5CAI A;  2LJ1 A;  1X6O A;  2SRC A;  3U23 A;  1Q7Y R;  4GLM A;  2AK5 A;  2GBQ A;  2DTH A;  4NS5 A;  5IXB A;  2A37 A;  1AWO A;  4MZT A;  4K11 A;  3OYJ A;  1D09 B;  5GAM d;  1SF9 A;  1R0B G;  1YJW T;  4PJO G;  1RUW A;  1NPP A;  5CK9 A;  3JB9 J;  2XDB A;  1D1C A;  3HSB A;  1AWX A;  4QW2 A;  2KRS A;  5KYN A;  3I5R A;  3OYA A;  4ANJ A;  2EYZ A;  2L8D A;  2D8J A;  4M78 A;  2DL3 A;  2SEM A;  3JCM h;  2BE9 B;  1KSW A;  1YIT A;  1OV3 A;  2C0O A;  1BCM A;  4J5Y A;  2QQ9 A;  4M77 B;  3LGL A;  2K3Y A;  1VQ8 A;  3RUX A;  4FYY B;  5GAN e;  4M78 F;  1AZE A;  1KD1 U;  3CEY A;  1CKA A;  1YIJ A;  4AFU C;  1YJW Q;  3CCJ T;  4M7A C;  3OYY A;  1GXI E;  4OMP A;  2EJG A;  5FU7 B;  3EG9 B;  2EQM A;  5IHI A;  1LOJ A;  2FRY A;  3LGF A;  2CRE A;  3PMI A;  2QQB A;  2RQT A;  2ZAE A;  5LJ3 e;  4C92 F;  2H3E B;  5DLO A;  4RG2 A;  1LPL A;  4RUG A;  4M75 D;  2HL5 C;  4UC4 A;  4RTY A;  1X75 C;  3HTR A;  4BD3 A;  3M55 A;  5LJ5 e;  4A54 A;  3PVL A;  4FSS A;  3RES A;  1D0Z A;  2KRN A;  4M7A G;  1RAA B;  1PRL C;  3VUZ A;  2DF6 A;  2LP5 A;  3G4S A;  1KFZ A;  1QCF A;  2DE0 X;  1E6H A;  3GOX A;  3HRT A;  3MP8 A;  1UGR B;  3CCS A;  2K5I A;  2V8K A;  2YUO A;  2P84 A;  2DA9 A;  3QYG B;  2EQJ A;  4JJN K;  3CCJ Q;  1ZA2 B;  2X4Y A;  1QVG P;  4C0F A;  1FMV A;  3QII A;  2E6Z A;  4KGZ B;  3OS5 A;  2DZ9 A;  2JMA A;  2AT1 B;  4TVR A;  1D0X A;  1TTH B;  4F14 A;  4ELZ C;  4VUB A;  4PFP A;  2YLB A;  3NMZ C;  1A0N B;  2DFU A;  2RHI A;  3OSV A;  4HA8 A;  1OOT A;  1UHC A;  3OW2 A;  4FYV B;  1MNE A;  5KYY B;  1WI7 A;  4BI4 A;  2HCK A;  5GAO p;  2QA4 A;  4PKC C;  2F2X A;  1IRX A;  3L42 A;  2DO3 A;  2O4X B;  3SWN B;  4J9B A;  2MCN A;  1NZ9 A;  4C8Q A;  4EMH A;  1K8A C;  3EG0 A;  3LWI A;  4XTW A;  2V1Q A;  2EJF A;  2GF7 A;  2E65 A;  2MAM A;  4RTV A;  2DNU A;  2ROL A;  1N9R A;  2O01 E;  3MEV A;  4PJJ A;  3KUF A;  1QW1 A;  3A1P A;  3EHR A;  3UA7 A;  4FW1 A;  2LX7 A;  2QK0 A;  4OF1 A;  4BE2 A;  4N4H A;  3CCR A;  4CI0 C;  1MUZ A;  2DIG A;  1RAH B;  4JRQ A;  1YJN A;  2OX7 A;  1K76 A;  4HVU A;  3I5S A;  2GTO A;  1AT1 B;  2DX1 A;  4M75 E;  1JJ2 S;  1WQW A;  1G3Y A;  4C5E A;  2D6F A;  2QXF A;  3CBO A;  4WCI A;  2HSP A;  3OYM A;  2HQH A;  2LZ6 B;  3QO3 A;  1JQQ A;  1ABQ A;  5CKH A;  4LUE A;  1TXQ A;  4XU0 A;  1M8M A;  1TU0 B;  1WPY A;  1U1S A;  4X34 A;  1TUG B;  2KYB A;  1VYV A;  4XQ3 A;  4OB0 B;  1T0J A;  3HPW A;  1VQL Q;  2LCC A;  4OP0 A;  5C0M A;  1C1A A;  3MEU A;  1LCK A;  2EAY A;  5KYX A;  1ZSZ A;  2ROT A;  2ZPH B;  2DXB A;  3PE0 A;  2XU8 A;  4M78 C;  1H92 A;  7AT1 B;  5I22 A;  1Q86 U;  4RCC A;  5A0D A;  2EQK A;  5GAM f;  1BIA A;  1M1K C;  5GMK i;  4F7U A;  1WQ7 A;  3HFO A;  4BE1 A;  1VQP Q;  4JS4 A;  2EGE A;  2KYM A;  4B9X A;  1VQM T;  4AFZ C;  3A98 A;  4BY6 B;  1U06 A;  4Q5W A;  1G3W A;  3JV3 A;  3S6W A;  1KHI A;  1M90 U;  2OTJ T;  4M78 G;  1MMG A;  2D8H A;  4M7A D;  2ZZD A;  4BDY A;  4F16 A;  5KE3 A;  1D1B A;  5LJ5 g;  5LJ5 j;  1GCP A;  1M1K R;  1QCO A;  5FW9 A;  3VUB A;  5GMK m;  3M0P A;  3WVD B;  9ATC B;  4BAC A;  2DAQ A;  2COW A;  1I07 A;  3FEO A;  1Y0M A;  3PVQ A;  1B07 A;  3MPU B;  4JDS A;  4HCZ A;  1M27 C;  3RDV A;  2DPP B;  2FZG B;  2COY A;  3QZ5 B;  4X9C A;  3FJ5 A;  3FIF A;  3E9F A;  1KQ2 A;  1YI2 T;  1VQ4 T;  4XTV A;  4PJO E;  1OZ2 A;  1GRI A;  2F2V A;  2DKG A;  3M0U A;  1HXD A;  4LDY A;  3TEE A;  2RK2 A;  3FRN A;  3I56 Q;  1Y57 A;  3CCQ A;  2EQI A;  1Q82 R;  1WX6 A;  3Q1J A;  2RQU A;  1W4S A;  1WA7 A;  1VQ7 A;  3JCM V;  3M0Q A;  4XAX B;  2XK0 A;  2RQW A;  3PT9 A;  3M57 A;  1NM7 A;  2D1X A;  4GLK A;  2Y4Y A;  2OAW A;  2JM9 A;  2BTT A;  3VKI A;  4A4K A;  2DK3 A;  2EVR A;  3EG9 A;  3JB9 F;  2K5F A;  2YRV A;  3BY7 A;  4C8Q C;  1RAI B;  1BIB A;  2V8I A;  5FWB A;  3KBG A;  1F1B B;  1YI2 Q;  2QEX Q;  2ZPF B;  1G8X A;  1WHM A;  4QQ6 A;  5GAO l;  1JRI A;  1IHW A;  1K8A U;  2YSQ A;  5I2M A;  5GAN d;  4QVC A;  1JBM A;  3VS1 A;  3S3O A;  2DEU A;  1AOJ A;  2GTJ A;  3ULR B;  2ED0 A;  3TSZ A;  1Y71 A;  3CC2 Q;  4CC4 B;  3C12 A;  2RI2 A;  1XQH A;  1YHQ Q;  1X6G A;  4C8Q G;  4J9C A;  2GQV A;  4PJO A;  1I4K 1;  4B6M A;  3MKD A;  4M7A E;  1KJW A;  3CC7 T;  2DL4 A;  3F70 A;  4P5N A;  4E7H A;  1M3A A;  3LH5 A;  1VQ5 T;  4DBH A;  5CCA A;  1W2B P;  3L2Z A;  3LLR A;  4PJO F;  3CCM T;  4J9D A;  5ECA A;  4IIM A;  5I11 A;  1SRL A;  1NLP C;  1N6A A;  3FB9 A;  1ZBX A;  2EGC A;  2A3L A;  1GFC A;  5KYY A;  4J7I A;  3LX7 A;  2E6N A;  1VYT A;  2DXU A;  5GAN 6;  1D1A A;  2ABL A;  2CZ1 B;  2O4X A;  3SWN A;  1OUL A;  1ZSZ C;  4IUT A;  3CXC P;  1R0C B;  3JCM g;  4FT4 A;  4C0D C;  2EBP A;  1FX7 A;  1M1F A;  2RD1 A;  2JUF A;  2EW3 A;  5KYW B;  3CC7 Q;  1VUB A;  2JW4 A;  2ZPG B;  1Q95 G;  1VQ5 Q;  4IKF A;  4O6J A;  4V2S A;  3CBM A;  1KD1 C;  2GGR A;  4M78 D;  1SRM A;  2AIR B;  4Z88 A;  3V8J A;  4DOV A;  2C0T A;  1ZQ1 A;  2IG0 A;  1YJW A;  4BUG A;  2LTO A;  1UJ0 A;  2JMC A;  2DTO A;  4E7L A;  3I35 A;  2QAZ A;  4WF2 A;  1R77 A;  3REA B;  1KQS P;  4RTX A;  1W1F A;  2M16 A;  2YWW A;  2D0N A;  4DQ2 A;  3HL8 A;  1I81 A;  4FCY A;  2G6F X;  4E47 A;  4YTL A;  1X6B A;  1GBR A;  4AG1 C;  1IHV A;  2GCX A;  1KD1 R;  1GBQ A;  1VQ6 Q;  4M7A F;  3J80 E;  1U1T A;  3C94 A;  4F7U G;  3EFR A;  1N27 A;  4KH0 B;  1KG1 A;  4HT9 A;  3I9Q A;  4M7D A;  2E10 A;  3SB2 A;  1RAD B;  1CKB A;  4QKU A;  3HKS A;  5GAN 3;  4PLL A;  3CCJ A;  2DET A;  2QTX A;  4MMK A;  3KXT A;  4M7D F;  4ME7 A;  8ATC B;  2RMO A;  3N5B B;  4AG2 C;  2O9V A;  2LVM A;  2RO0 A;  4N0A A;  3VRY A;  2JXB A;  2X3X D;  4A4G A;  1KIK A;  2LC4 A;  1QP2 A;  2COZ A;  1JU5 C;  1OU9 A;  4X1V A;  1G3T A;  5KYU B;  2K57 A;  2HZY A;  3P8D A;  4J9G A;  1V76 A;  1P92 A;  2R5A A;  1WYX A;  1WLP B;  2B86 A;  2RF0 A;  5FU7 C;  3V7R A;  2XID A;  3VYH B;  1X2K A;  3E2U A;  4E7S A;  3X26 B;  1M30 A;  4LUD A;  4FYW B;  3ZL7 C;  4CC2 A;  1VIF A;  2QG9 B;  2PNI A;  3MHX A;  2M1H A;  2VB6 A;  4C8Q D;  2EYY A;  3JB9 G;  4M78 E;  3OYC A;  1KQ1 A;  4E7I A;  2R58 A;  3VS3 A;  1M3B A;  3C95 A;  5CIU A;  3A8L B;  1AHJ B;  4E7J A;  2YT6 A;  2FB7 A; 
#chains in the Genus database with same CATH homology
 2JM8 A;  4F14 A;  2FPF A;  3NMZ C;  4E6R A;  1A0N B;  1YWP A;  1E7O A;  2KT1 A;  4ORZ A;  4GBQ A;  1OOT A;  4LE9 A;  1UHC A;  1U3O A;  2LJ0 A;  1WXT A;  4A63 B;  2ESW A;  1SHG A;  2VVK A;  1WI7 A;  2DIL A;  2HCK A;  2CUB A;  1NYG A;  4QT7 A;  2F2X A;  3VS7 A;  2EYX A;  2K7A A;  5IXF A;  4J9B A;  1WXU A;  2MOX A;  4Y92 A;  4JZ4 A;  2J7I A;  2MCN A;  3QWY A;  1J3T A;  3EG0 A;  1TUC A;  3VS5 A;  1GCQ C;  2A36 A;  2V1Q A;  4IIO A;  2F2W A;  2K79 A;  3GBQ A;  5GJW B;  4AFQ C;  4RTV A;  2DNU A;  2ROL A;  3M0R A;  2X3W D;  1RLQ C;  1SPK A;  3EHR A;  2FEI A;  3UA7 A;  3M0S A;  2LX7 A;  2L3S A;  3EG1 A;  2RNA A;  1T0H A;  2KBT A;  1BU1 A;  2ECZ A;  1NEG A;  1ABO A;  2DL7 A;  2CT4 A;  1MUZ A;  3SHW A;  2VWF A;  1K76 A;  4HVU A;  3I5S A;  1UG1 A;  3H0H A;  2GTO A;  5FWC A;  4OMQ A;  3VS0 A;  2QDL A;  2DX1 A;  2DM1 A;  2M51 A;  4ZNX A;  2LQW A;  1UUE A;  1BB9 A;  4HXJ A;  2DRM A;  2IIM A;  4WCI A;  2HSP A;  2RPN A;  1UFF A;  2LZ6 B;  4J9I A;  3UF4 A;  1JQQ A;  1ABQ A;  1U5S A;  1V1C A;  4LUE A;  2YUN A;  4RTT A;  2GNC A;  3NHN A;  1WXB A;  1M8M A;  2BZ8 A;  2NUZ A;  1WFW A;  1PKT A;  2KYB A;  1VYV A;  1H3H A;  2W0Z A;  5GJV B;  1T0J A;  3VS4 A;  2AZS A;  2JT4 A;  2O31 A;  1LCK A;  4OMN A;  2A28 A;  4RTZ A;  4OMM A;  2ROT A;  3PE0 A;  1OPK A;  1JEG A;  2ED1 A;  1YN8 A;  1H92 A;  5I22 A;  3RNJ A;  1X27 A;  1X69 A;  2DBK A;  2DLP A;  2M0Y A;  3EG2 A;  1OPL A;  4RTW A;  1UDL A;  2EGE A;  2A08 A;  1MV3 A;  2KYM A;  2HDA A;  2E5K A;  4AFZ C;  3A98 A;  1W70 A;  1N5Z A;  1U06 A;  1BK2 A;  3JV3 A;  4OML A;  3H0I A;  4LN2 A;  5HCK A;  4F17 A;  2CH4 A;  4R0K A;  1AWW A;  2DJQ A;  2D8H A;  2FPE A;  2K6D A;  4F16 A;  5IHK A;  2GQI A;  2HEQ A;  1GCP A;  4Z89 A;  2K2M A;  2K3B A;  2HBW A;  5FW9 A;  3IQL A;  3M0P A;  2OI3 A;  1I07 A;  1Y0M A;  2O9S A;  1HSQ A;  3PVQ A;  1B07 A;  1G2B A;  1T3S A;  1FMK A;  5IHN A;  1M27 C;  3NGP A;  2L3Q A;  1QKX A;  4JPB W;  1AVZ C;  3FJ5 A;  2KR3 A;  2EPD A;  2H8H A;  1ZX6 A;  4M4Z A;  1B3Q A;  2C0I A;  2DL8 A;  3H41 A;  2J6F A;  1GRI A;  2F2V A;  1ZUU A;  1PKS A;  2AZV A;  3M0U A;  1S1N A;  1AWJ A;  2FRW A;  1QWF A;  1Y57 A;  2AKK A;  2EQI A;  2K9G A;  1NYF A;  1WX6 A;  2RQU A;  1UGV A;  1WA7 A;  1Z9Z A;  1ZUY A;  4AFS C;  1MV0 B;  2RQR A;  3O5Z A;  2DMO A;  1VA7 A;  3M0Q A;  5L23 A;  2RQW A;  2FPD A;  1X2Q A;  2AKL A;  2KE9 A;  1NM7 A;  2D1X A;  4HVW A;  4JZ3 A;  2EKH A;  2JM9 A;  2OAW A;  2CSQ A;  2BTT A;  1PWT A;  1PNJ A;  1ZUK A;  2EVR A;  2JS0 A;  1JXO A;  1YWO A;  1UEC A;  2J6K A;  4HVV A;  1WDX A;  5FWB A;  1K0X A;  3THK A;  2VKN A;  4RTU A;  1HJD A;  3RBB B;  3EHQ A;  1EFN A;  1UJY A;  1QWE A;  2YSQ A;  1RLP C;  2CH4 W;  3VS1 A;  3CQT A;  4J9F A;  1AOJ A;  2GTJ A;  3ULR B;  2ED0 A;  2CUD A;  3TSZ A;  4LNP A;  4CC7 A;  2J6O A;  4CC4 B;  4JJD A;  1NG2 A;  1X6G A;  1I0C A;  1H8K A;  4J9C A;  1Z9Q A;  2LCS A;  2LQN A;  3REB B;  2YUQ A;  1NLO C;  1IO6 A;  2BZY A;  1KJW A;  2DL4 A;  2JS2 A;  2RQV A;  1M3A A;  3LH5 A;  1SHF A;  3UA6 A;  1AD5 A;  2CDT A;  2W10 A;  1SSH A;  1T3L A;  4J9D A;  4D8K A;  5ECA A;  4IIM A;  2I0N A;  5I11 A;  1SRL A;  2KNB B;  1NLP C;  5IH2 A;  2OJ2 A;  2YDL A;  4DEY A;  2CSI A;  1UTI A;  1UHF A;  1GCQ A;  2KRM A;  4CC3 A;  1NEB A;  2EGC A;  2O88 A;  1GFC A;  1YCS B;  2DRK A;  1GFD A;  2KRO A;  1VYT A;  2ABL A;  2CT3 A;  2LJ3 A;  1CSK A;  1M3C A;  1RI9 A;  3EGU A;  2LMJ A;  1YP5 A;  2L2P A;  1HD3 A;  2EBP A;  4KRT A;  2KGT A;  2EW3 A;  2KXD A;  2V1R A;  1PRM C;  2JW4 A;  1K0S A;  3QWX X;  2P4R A;  3M0T A;  2GGR A;  1SRM A;  4Z88 A;  2EGA A;  2KEA A;  2C0T A;  2ENM A;  1X43 A;  4D8D A;  2LJ1 A;  2SRC A;  1ZLM A;  3U23 A;  4GLM A;  2AK5 A;  1G83 A;  2GBQ A;  4JJC A;  5EC7 A;  1UJ0 A;  2JMC A;  5IXB A;  1QKW A;  2DBM A;  4EIK A;  3I35 A;  4JJB A;  2A37 A;  4J9E A;  1AWO A;  1WIE A;  1YNZ A;  4K11 A;  3REA B;  4RTX A;  1ARK A;  3SEM A;  1W1F A;  1QLY A;  2D0N A;  1K9A A;  3KFV A;  2EYW A;  2JTE A;  1RUW A;  2G6F X;  1X6B A;  1GBR A;  4AG1 C;  2MIO A;  2FO0 A;  1GBQ A;  1K4U S;  1AWX A;  1AEY A;  1UE9 A;  2KRS A;  3I9Q A;  3I5R A;  2L0A A;  1VYU A;  2DYB A;  2EYZ A;  2YUP A;  1SEM A;  3VS6 A;  2BZX A;  2D8J A;  1CKB A;  2NWM A;  2DL3 A;  2SEM A;  2XMF A;  1KSW A;  1OV3 A;  2C0O A;  1OEB A;  2RMO A;  2LNH B;  3VRZ A;  1W6X A;  4AG2 C;  1AZE A;  2O9V A;  1JO8 A;  3VRY A;  2JXB A;  2X3X D;  1E6G A;  1KIK A;  2KT8 A;  1CKA A;  4AFU C;  1ZBJ A;  4OMP A;  2DL5 A;  1BBZ A;  1JU5 C;  5IHI A;  4X1V A;  2FRY A;  2O2O A;  2J06 A;  2CRE A;  1I1J A;  2RQT A;  4J9G A;  2L3P A;  3EG3 A;  2KXC A;  3H0F A;  1ZSG A;  1WYX A;  4J9H A;  1WLP B;  4RUG A;  1K1Z A;  2B86 A;  4RTY A;  2RF0 A;  3R6N A;  1AZG B;  3PVL A;  4FSS A;  1X2K A;  3UAT A;  4ESR A;  2KRN A;  1M30 A;  4LUD A;  3NPF A;  4OMO A;  2J05 A;  1XOV A;  3ZL7 C;  3C0C A;  4CC2 A;  1PRL C;  2DF6 A;  2LP5 A;  2PNI A;  2FG0 A;  1KFZ A;  1QCF A;  2DE0 X;  1E6H A;  4DEX A;  3TVT A;  2EYY A;  2PZ1 A;  2PTK A;  2YUO A;  4Z8A A;  2DA9 A;  2RN8 A;  3VS3 A;  1GL5 A;  1M3B A;  1FYN A;  1TG0 A;  3VS2 A;  2DVJ A;  1TUD A;  1PHT A;  2YT6 A;  2JMA A;  1JXM A;  4HCK A;  3TSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...