2A08A

Structure of the yeast yhh6 sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
AMATAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVRVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 41.8 kDa protein in SPO13-ARG4 intergenic regio
publication title 3-D proteome of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 10
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a08A00
2KBTA 1Y0MA 1TG0A 2ESWA 3M0RA 2EPDA 1V1CA 1X43A 3TSWA 3ULRB 2A28A 1B07A 1PHTA 2K6DA 1JQQA 1PKSA 3O5ZA 2D8HA 1XOVA 3FJ5A 2GQIA 4OMPA 2LNHB 2DE0X 5EC7A 1W6XA 4OMNA 1GBRA 2RQTA 1W70A 2MOXA 3REAB 2VVKA 3VS5A 1ARKA 1PRLC 5FWBA 4RTXA 2JXBA 2L3PA 2CSIA 2ECZA 2EW3A 1K0XA 1CKBA 2KEAA 1JEGA 2P4RA 1GL5A 5GJWB 2JM8A 2CH4A 2W0ZA 2LJ3A 2KYMA 2EYWA 2ABLA 2MCNA 2EBPA 2IIMA 2V1RA 3EG2A 2CH4W 2HEQA 4AFZC 1M3BA 1NG2A 2FEIA 1M3CA 2L0AA 1QWFA 4OMOA 4GLMA 1I1JA 3VS2A 2K3BA 4AFSC 2KXDA 2VWFA 1JXOA 2A36A 1NLPC 2FRWA 2X3WD 3RBBB 1AOJA 1NYGA 1UFFA 2EYXA 4Z8AA 3H41A 2BZXA 2NUZA 4Z89A 1ZLMA 2KE9A 1FMKA 3M0SA 2AKLA 5I11A 1PRMC 4ESRA 2O2OA 1WXBA 2AK5A 1GFDA 2DNUA 2MIOA 1WI7A 4JZ3A 1YWOA 2BZ8A 2RMOA 1M3AA 1S1NA 1E7OA 1ZSGA 1JO8A 1U3OA 2BTTA 3RNJA 3H0FA 4DEXA 2O31A 2D0NA 3A98A 1YNZA 2HCKA 3M0UA 4OMQA 2M51A 1KFZA 1UG1A 2SEMA 3LH5A 3SEMA 1UJ0A 2EVRA 2K9GA 4JZ4A 2EYZA 2RQUA 1ZX6A 1CKAA 4RTVA 2J6OA 2I0NA 2DL5A 1UHFA 2CSQA 2NWMA 2LP5A 4HVWA 2EKHA 1K76A 1SRMA 4JJDA 3QWXX 3I35A 1K9AA 2YDLA 3VS3A 1E6HA 5HCKA 1I07A 3M0TA 1H92A 4IIOA 2LX7A 2FPFA 1ZBJA 2J05A 2KROA 4RTZA 1Z9ZA 2XMFA 4RTYA 2RF0A 3CQTA 3VS1A 2DLPA 2JS0A 1NEGA 1UUEA 3TVTA 2C0OA 2KT8A 1UE9A 2KRNA 2DJQA 2GNCA 1OOTA 1VYTA 2EGCA 1WX6A 2YT6A 4JJCA 1ABQA 1BU1A 1YCSB 2FPEA 1JXMA 1W1FA 1UDLA 1AWWA 3M0QA 2FRYA 4F14A 3EG1A 2KT1A 3PVQA 1X2QA 4HCKA 1AWXA 2DA9A 2DX1A 3SHWA 1AZEA 1OPKA 1WFWA 1UHCA 2OI3A 3VS6A 1PKTA 1RI9A 1SSHA 3THKA 1T3SA 4AG1C 2FO0A 1HSQA 3VRYA 2CT3A 3VRZA 5IH2A 1MV3A 1K0SA 2DL4A 2K2MA 2KYBA 2X3XD 3EHQA 1WDXA 2ED0A 2RQVA 2YUOA 3QWYA 1UJYA 2O9SA 5IXBA 4RUGA 2JM9A 2B86A 5ECAA 5FWCA 1T0JA 2JMCA 1Z9QA 1UGVA 2E5KA 2ENMA 3EG0A 4FSSA 2RQRA 2BZYA 2PNIA 4KRTA 4RTWA 4J9CA 1OPLA 3UA7A 1AVZC 4LN2A 1KJWA 2DM1A 1X2KA 2DL3A 1QWEA 1AWOA 2EYYA 1RLQC 4J9DA 2F2WA 2K79A 1WXTA 4RTTA 2F2VA 2HSPA 2L3QA 1QKWA 2C0TA 3C0CA 1H3HA 4J9BA 3I5RA 3KFVA 5IXFA 3UATA 1X69A 2EGEA 2JTEA 2SRCA 1AD5A 1M8MA 1WIEA 2KNBB 2DVJA 3JV3A 1K4US 1SRLA 1ZUUA 2G6FX 3M0PA 2DRKA 1BB9A 1VYVA 1H8KA 2DBMA 2O9VA 5L23A 1QLYA 2DF6A 2FG0A 5FW9A 2YUNA 2RQWA 1BK2A 2KRMA 4E6RA 2YUQA 2AZVA 1NEBA 3NMZC 1GCQC 3VS0A 1T0HA 1RLPC 1X6GA 1BBZA 2FPDA 1TUDA 4RTUA 3H0HA 3UF4A 1K1ZA 4R0KA 4QT7A 2RNAA 1M30A 1ABOA 4J9EA 2L2PA 4D8DA 1NLOC 2AKKA 1GCQA 1GRIA 4F17A 1FYNA 1U06A 4LUDA 2KGTA 2ROTA 2RPNA 2GBQA 4OMLA 1SHFA 2J7IA 1VA7A 3R6NA 4D8KA 4AFUC 1RUWA 2LQNA 1ZUKA 1AEYA 1E6GA 2LQWA 3GBQA 4JPBW 4Z88A 4ZNXA 1PNJA 2AZSA 2J6FA 1U5SA 2DILA 4LNPA 1WA7A 4EIKA 1WXUA 2F2XA 2HDAA 3NGPA 2VKNA 1WYXA 1UECA 1GFCA 3ZL7C 1UTIA 2LJ1A 5I22A 2LMJA 4J9FA 1M27C 2KRSA 2DL8A 4M4ZA 1GCPA 1HD3A 1B3QA 4AG2C 1X27A 1I0CA 1GBQA 1KSWA 1T3LA 2CREA 2EQIA 4CC7A 2H8HA 2D8JA 2HBWA 4AFQC 4OMMA 2J06A 2LCSA 1AZGB 4HXJA 4CC3A 2OJ2A 2L3SA 1VYUA 1SHGA 3IQLA 2C0IA 3NPFA 4JJBA 1TUCA 2QDLA 2CDTA 1CSKA 2GTOA 3PVLA 4GBQA 2D1XA 4CC4B 2YSQA 3VS4A 1J3TA 3EG3A 2GTJA 4CC2A 1AWJA 1OEBA 2PZ1A 4J9IA 4LUEA 2JMAA 1SPKA 3I5SA 4IIMA 5GJVB 2M0YA 2JS2A 4LE9A 3EGUA 2J6KA 1KIKA 4WCIA 1N5ZA 4F16A 2K7AA 3REBB 3EHRA 4X1VA 2YUPA 3U23A 2O88A 2A37A 2RN8A 3UA6A 4HVUA 4ORZA 2DBKA 4J9HA 2CUBA 4A63B 3NHNA 1X6BA 1YP5A 3TSZA 2LJ0A 1PWTA 2DRMA 2W10A 3H0IA 3VS7A 2KR3A 2A08A 4K11A 2DYBA 5IHKA 4DEYA 2CT4A 1IO6A 1A0NB 1G83A 2ROLA 2LZ6B 1EFNA 2ED1A 1QKXA 1SEMA 2PTKA 1ZUYA 1JU5C 2JT4A 1MV0B 3I9QA 2GGRA 1HJDA 4HVVA 2V1QA 4Y92A 1NM7A 1OV3A 5IHIA 1WLPB 4J9GA 1YWPA 5IHNA 2DL7A 1QCFA 1YN8A 1MUZA 2DMOA 2EGAA 2OAWA 2CUDA 1LCKA 2KXCA 2JW4A 3PE0A 1Y57A 1G2BA 1NYFA
chains in the Genus database with same CATH superfamily
4Y28E 1TG0A 1YCYA 5KYYB 3M0RA 1WHGA 2VGNA 2QAZA 1X43A 3TSWA 6AT1B 2JZ2A 2HD0A 4M7DE 3Q1JA 2GFAA 2ZPEB 4E7LA 5CQYA 2K6DA 2F5KA 1W2BS 4PL6A 1PKSA 3FJ5A 2JUFA 3A8GB 3GOXA 2LNHB 2DE0X 2JTFA 3CCSQ 2DEQA 1W6XA 2QI2A 3CXCS 2HQEA 2RQTA 1RAEB 2MOXA 3MJXA 5LJ3f 1D0ZA 3V8KA 1RL2A 2O01E 2E12A 3BDUA 1VIEA 2JXBA 1Q82U 3M58A 2EWNA 3LGLA 2NYSA 2OTJQ 2KEAA 1GXIE 2JM8A 3JB9F 1HYOA 2JVVA 3LH0A 3GF5A 1ZSZC 2LJ3A 2ABLA 5CVIA 2EBPA 4JS5A 3J7AF 4BE0A 3BW1A 3EG2A 1Q86C 1OU8A 1KQSA 1M3BA 1M3CA 1Y07A 1QWFA 4GLMA 1D09B 2HQXA 3HRSA 4AFSC 2FRWA 1NLPC 2FHDA 1AOJA 1NYGA 3TREA 2ZCFB 3CCJT 3H41A 3ME9A 4PJOA 4Z89A 2DIGA 5FRMA 4E7ZA 5FLXE 4ESRA 1AT1B 2QEXA 5LJ5g 3A1PA 1WI7A 3VJPA 1FWZA 2BZ8A 1M3AA 4OB1B 1ZSGA 2JN0A 2RHIA 3EG9B 1U3OA 4WF2A 3JCMP 4KT0E 4A4EA 2HCKA 5HK3A 5D6WA 3G1JA 4M77D 3QIIA 3OYCA 2XDBA 2M51A 1UG1A 2CP5A 2EVRA 3MEUA 4DQ2A 2BE7D 4JZ4A 4L5GA 2RQUA 3JCMc 3CC7Q 2YWWA 2J6OA 4OP0A 4EMKB 2DXUA 5IAYA 3EGXA 2E1HA 2M0OA 4M77C 5KYXB 2KY9A 3G4SQ 3OYAA 2HSEB 1MMNA 2ZAEA 3J80E 3A8MB 3HHTB 1K9AA 2YDLA 2KQWA 3CMAT 1IGQA 1I07A 1FX7A 4IIOA 3OSSC 1WHKA 4M75D 4N4IA 1I5LA 3G71T 3VS1A 2JS0A 2COWA 1UUEA 3V8LA 4C8QG 1VQMA 2Y90A 1I5OB 4M7AG 4JJNK 1OOTA 1QVFS 5LJ5f 3JRZA 1ABQA 1XQHA 5GAOl 1M90C 1JXMA 1UDLA 3EGDA 2FRYA 2DA9A 4M75C 1OX8A 2V8JA 4PJOE 3L2WA 1UHCA 5CKBA 1IREB 1PKTA 3RR6A 5DLOA 4MMKA 4ZN1A 3SFMA 3OB9A 3HTRA 4F7UA 5DM7R 1T3SA 2FO0A 4QVDA 2F1LA 1P92A 3VRYA 2CT3A 3OYJA 1K0SA 3OS0A 2X3XD 5CR2A 4LXCA 5J26A 3L2RA 1K9MC 1UJYA 2LDMA 4R55A 2DIQA 5FWCA 4FSSA 2DERA 2BZYA 1G8XA 2QYZA 4N4HA 4RTWA 5KYUA 3L2VA 4J9CA 5LJ5d 3URGA 5EG2A 4J6XA 3L42A 4MDWA 4KULA 2DEUA 2EYYA 4GLKA 2K79A 4AMCA 4RTTA 3V7RA 2HSPA 4J6WA 2K4YA 4PJOB 4M78G 3OW2S 1U1SA 3LLRA 4R56A 1IHWA 3KFVA 2ZPIB 5M9OA 2C06A 1HK9A 5CAIA 2DKGA 1MNDA 1TSFA 1AD5A 1YJNA 5GAOq 2KAFA 3QPHA 3CCJA 2G6FX 2R5MA 3ASKA 1MMGA 1QLYA 1PG5B 4OB0B 3SDZA 1RAAB 2KMTA 1W2BA 4C92G 1BBZA 1JJ2S 4NL2A 4RTUA 2VV5A 5LJ3h 2YLCA 1JBMA 3RMSA 1OI1A 4F7UE 1PC0A 4E2FB 1GCQA 3CD6T 5GAN3 1KQ1A 1OX9A 2E64A 4LUDA 4BE1A 2RPNA 1N8RR 4IUQA 3QJ6A 3PNWC 5CCAA 4OMLA 4XTXA 3BDLA 2J7IA 1VQ9T 1BIBA 4E7HA 1RUWA 4WTOB 3G6ET 3HFOA 4KGVB 1E6GA 2LQWA 1YI2Q 2V26A 4PLLA 4X34A 4M7DF 3TU4K 3QSUA 3TEEA 4EIKA 1OZ2A 3OQ5A 1KHCA 1WYXA 1Q86U 3X20B 1QQJA 1UECA 3OYIA 5GMKm 2EQKA 2KSSA 1M27C 2OTLT 1LJOA 4M4ZA 1X01A 3EGDB 1HD3A 1B3QA 1S72T 1WHLA 3MKDA 3JAME 2CREA 3DLMA 3L2UA 2KK4A 3PIPA 2CP2A 2HBWA 2E3IA 4BE2A 1X75C 2OJ2A 1SHGA 2MAMA 4LDVA 3NPFA 4JJBA 3WXMB 1TUCA 3OYFA 2F5TX 5GMKe 1XNIA 4BDZA 4NOYA 4A4GA 2K5IA 1M90R 3A8HB 4GBQA 2OAUA 3QDFA 1RACB 3MP1A 5KYUB 2GTJA 4CC2A 1G3TA 1AWJA 4OMFB 1VQLQ 4J83A 3PIOA 1RABB 3CC4T 4IIMA 4ZGJB 3OYEA 1VQ5T 2DFUA 1VQ8T 3G7ZA 4J7IA 2DTOA 3HFNA 3BFMA 2A37A 1K9MR 2DXCA 2CP6A 4C8QD 5D6YA 3E2UA 4EMHA 3NHNA 5LJ5h 1JB0E 4JLIA 3E1SA 2EYQA 2A08A 2DYBA 2CT4A 5GAN6 2LZ6B 1EFNA 2XIDA 2ZPGB 1BI2A 4FYVB 1M90U 3C95A 2DTHA 2DAQA 1ZUYA 1JU5C 3I9QA 3L2ZA 1Q81U 4FW2A 1HJDA 5KYYA 4YTLA 1NM7A 1UB4A 1OV3A 1WLPB 1XJWB 2AHJB 2CYZB 3QBYA 5IHNA 1VQPQ 3WVDB 2KXCA 2XDPA 4JS4A 4M77G 1NYFA 3SWNC 4M77A 3ULRB 2A28A 3CMAQ 1XTDA 1WQWA 3CCET 3PMIA 3M5AA 5A0GA 1M9SA 2YRDA 3G71Q 1D0XA 1GBRA 3CD6A 1W70A 2VVKA 4PJOF 1HXDA 3RERA 1PRLC 4KBMB 2X35A 2L3PA 4N0AC 4DBFA 2MWOA 4M78D 2CZ1B 4ELZC 1IB8A 2QEXT 2LTOA 4F04B 4M75A 4KGZB 2P4RA 1GL5A 2EFIA 2CH4A 1R0BG 4IKFA 2IPOB 2QQ9A 2MWPA 2KYMA 5KE2A 2KDSA 2V1RA 4DOWA 4M78C 3X26B 2FEIA 2L0AA 1S72A 2E6ZA 3MHXA 1TWBA 3CCQQ 1M1KC 1JXOA 2A36A 4C92D 2X3WD 1YHQQ 3RBBB 1KC8C 2M9UA 3AHUA 1N27A 4O5VA 2KE9A 3R6OA 2AKLA 2PQWA 5I11A 1PRMC 1OU9A 3HRUA 3OY9A 1VQKQ 4Q5WA 2MIOA 1GFDA 1ZSZB 1YWOA 4FIBA 2AT1B 1S1NA 2ZPHB 2BTTA 3RNJA 2O31A 4BD3A 1TUGB 1Q7YC 2G3RA 1YNZA 3M55A 3TQ7P 1LVKA 2YRVA 2M16A 3M0UA 4OMQA 4DA4A 2EQUA 3CCRA 1VQMT 3LH5A 5GAN4 3UPUA 3JCMe 1UJ0A 4HCZA 2EIFA 2L89A 2JNGA 2DZ9A 1VQ5A 1ZX6A 1VQ8A 3M53A 3JB9J 1UHFA 4HVWA 2LP5A 4J6YA 4JJDA 4HT9A 1SRMA 3QWXX 4C0DB 5GAOn 3RESA 2MI6A 4F7UF 1H92A 3QUIA 3HSBA 1ZBJA 1YIJT 4FM4B 4M75E 4RTZA 2DLPA 3PT9A 3TCJA 4LDXA 2C0OA 2KRNA 2GNCA 2EQMA 4Z02A 2RJCA 1VYTA 2EGCA 1RAIB 4ZTFA 4JJCA 1BU1A 1YCSB 4M77B 5KCHA 4F14A 4PLIA 2KT1A 1X2QA 4HCKA 1VQ9Q 5AYFA 3A8OB 1YJ9T 1PD0A 3G6EQ 1N9SA 3CC2T 1K8AU 1M1FA 3SHWA 1WHMA 3OYBA 4E7JA 1K73R 2OX7A 2P0PA 3THKA 5KYWB 4RKUE 3L1AA 4E7KA 1MV3A 1MMDA 2DL4A 3EHQA 2YRCA 2ED0A 3CCEA 2OTLQ 3QWYA 3QYHB 4RUGA 1UGPB 2D9TA 2JM9A 2B86A 5ECAA 2KI7A 3P8DA 1VQ4T 1Z9QA 2E5KA 1ZA1B 5KCOA 2YLBA 3EG0A 4M75B 3L2QA 2RQRA 2JOYA 4DOVA 1YJNT 4KH0B 1OPLA 3S3OA 3UA7A 2QTVA 2E70A 3OYMA 4LN2A 4EPCA 2NUTA 5KE3A 3CBPA 2MMPA 1RLQC 4J9DA 3KUFA 2F2WA 1WXTA 3MPUB 4DBQA 2L3QA 2C0TA 2EAYA 1N8RC 3CPFA 3QKJA 2EJ9A 1M2OA 2RK1A 1NPPA 5GANd 3ZFJA 2QQAA 2QDYB 1X69A 2JTEA 2WSEE 3CC4Q 1VQ5Q 1WIEA 1N9RA 4KH1B 1N6AA 3JV3A 3CCUT 1ZUUA 3CCLT 1H8KA 2DBMA 2O9VA 2QA4Q 2DF6A 2P84A 5FW9A 1VQNT 1IGUA 4ME7A 1VQOT 4B6MA 1M1KR 1Q95G 1KC8R 3NMZC 3VS0A 1X6GA 2FPDA 5FU7C 2CP3A 1K1ZA 4J8OA 2FL7A 4R0KA 2PUKB 4EDUA 4QT7A 1QCOA 1WJQA 4J9EA 2I2LA 2QG9B 2XKOC 2L2PA 3JCMg 4PKCC 4F17A 1U06A 2MPXC 2IVWA 1D1BA 1TH7A 3VU3C 1H3ZA 3CMEA 4Y91A 3CEYA 2QQRA 2YXYA 1SHFA 4C8QA 1VA7A 1Q7YR 4D8KA 4AFUC 4M7AA 1KD1C 4Z88A 1PNJA 5D6XA 2X4YA 3MEAA 2HDAA 3NGPA 5CQXA 4M7DD 1VIFA 3JB9I 1X6OA 4L6V5 1UTIA 5GMKj 1YJWT 4EMGA 2LMJA 1R77A 4J9FA 2KRSA 1YIJA 3M59A 2VYTA 3CCEQ 1GCPA 1TU0B 1YITT 1I0CA 1KSWA 1GBQA 5I2MA 1T3LA 5AT1B 4IUPA 4M7DC 1V76A 1NBEB 3V7CA 4OMMA 2J06A 5GMKl 3CCMT 2COYA 3OYYA 4HXJA 4CC3A 1OULA 1VYUA 3BY7A 5GANj 4AT1B 1YJ9A 1WNLA 2X51A 3CC2A 2Y4XA 3JCMf 2CDTA 2QEXQ 5FROA 2GTOA 2P4TA 2X9HA 3ZEHA 1U1TA 2YSQA 3VS4A 3FRNA 2QGFB 3EG3A 5IT9E 3O8VA 4BB7A 4LUEA 5A0DA 2JMAA 3JB9H 3DB3A 3I5SA 5GJVB 2NUTB 4M78A 1VQ4A 2LX9A 4WCIA 2K7AA 3REBB 3EHRA 4X1VA 3LYIA 5GAMj 4A54A 1RAFB 2QQBA 3JCMQ 2A0FB 3JB9G 4C8QE 1H641 2RHXA 4M7AE 2CUBA 2HL3A 4A63B 2NLUA 4M77F 1WJRA 1YP5A 1UEBA 2XDDA 2LCCA 2RK2A 2W10A 2KR3A 3DKMA 4K11A 3JCMd 5IHKA 4QVCA 1IO6A 4C92A 2ED1A 4BUGA 3CXCP 2PTKA 2R58A 1MV0B 3QG1A 2GGRA 3LWIA 1VQMQ 4B9WA 1SF9A 1G3WA 1YWPA 2ZZDA 1YN8A 1MUZA 3CCUA 1B34A 2FYKA 3PFSA 4XTYA 5CIUA 3CCVT 3CCLA 3OYKA 4M75F 2HBPA 1VQNA 2RD1A 5GAN7 4A4FA 1VQOA 2EPDA 1F1BB 1V1CA 3NTKA 3OYGA 2R5AA 3PMTA 4TVRA 1IXDA 1B07A 3CCST 2XHCA 1PHTA 1KG1A 4C8QB 1BCOA 4M7AB 4KGXB 2LQKA 3QZ5B 1C0MA 1XOVA 1PSEA 2GQIA 4OMNA 3SB2A 4PFZA 5HY6A 3DB4A 4V2SA 2GCXA 1KQ2A 3X25B 4MDXA 4RTXA 4FYXB 2ECZA 4UC4A 1YJ9Q 2E65A 1D1CA 1K0XA 1CKBA 1JEGA 2M02A 5CKDA 1N8RU 4HCCA 3OSVA 2FZGB 3P8HA 1YFNA 2W0ZA 2EYWA 3GLXA 2DETA 4PNOA 2IIMA 1YJWA 2LNVA 1KD1R 4AFZC 7AT1B 1NG2A 3NFCA 4OMOA 3E19A 1I1JA 3CCRT 1PD1A 2K3BA 2L3RA 3HP9A 1YITA 4C92E 2KXDA 1ZSZA 1UFFA 1VQ4Q 1G5VA 3MP6A 2BZXA 2NUZA 1I8FA 1ZLMA 3M0SA 4ZN3A 1YJNQ 4HKEA 4PJNA 3CCMA 2ATCB 5GANe 3CCJQ 2K5LA 2AK5A 2FZKB 3CBMA 4OVAA 1KK7A 4DBRA 2XI9A 4BI4A 3PTAA 1DJ7B 4DEXA 4M78B 9ATCB 2JJ9A 2D0NA 1ZQ1A 2IG0A 4GY5A 3A98A 2RHUA 4BI8B 1M2VA 2B8AA 3WVEB 1QVFP 1U8RA 1Y96A 1KFZA 2SEMA 1C6VX 4C5IA 1I81A 2Z0WA 4IURA 1D0YA 3META 4XU1A 1TS9A 4CRIA 2DTIA 3OYNA 5GAOr 5GAMe 4RTVA 4FCYA 2WACA 4QQ6A 2I0NA 1K73C 2CSQA 3JCMW 4PK4A 4C92B 2EKHA 5CKEA 2K57A 3I35A 1VQOQ 1E6HA 5HCKA 4FW1A 4QKUA 4KUIA 3OBWA 3FB9A 2BE9B 2LVMA 3JCMJ 1K9MU 1Z9ZA 2RF0A 1QVGP 5I21A 1BI1A 1NEGA 2L8DA 3TVTA 4CI0C 1B34B 2DJQA 1SG5A 3RIRA 3JCMh 2EKOA 2MYSA 2X4WA 2HAXA 2EJGA 1W1FA 5KYWA 3M0QA 3PVQA 2BKDN 4RMOA 5KYNA 3F70A 2PVOB 1OPKA 5DY9A 2OI3A 3D7SB 3VS6A 3CCVA 3EFOA 4BI3A 3VV0A 2Y4YA 4QQDA 3VRZA 3OW2P 5IH2A 2K2MA 3MP8A 3CCSA 1VQ6T 5GAN2 2RQVA 2YUOA 2DYIA 4ANJA 2O9SA 4A4KA 3JB9D 1YITQ 2JMCA 2RI3A 2KVQG 1WHJA 2ENMA 2L5QA 3C4SA 2K3XA 1QW1A 5CK9A 2PNIA 1SKUB 4M7DG 4JRQA 2A3LA 3S3MA 3VUZA 2X4JA 1TTHB 4FSXA 2OTJA 3VYGA 2DM1A 4OGEA 4JRKA 4C0GA 1X2KA 1JJ2P 4N4GA 1QMCA 1BI3A 4NS5A 2F2VA 3MCAB 3E9GA 1QKWA 3M56A 1M4ZA 4FT2A 4C5HA 2RM4A 3C0CA 1H3HA 1M8VA 4J9BA 4M77E 5IXFA 5FU6C 2RJFA 3UATA 2EGEA 1OZ3A 1M8MA 4C8QF 1SSFA 3S6WA 3CMET 2KNBB 2DVJA 4ATOA 4M7AF 2DVEA 2DZCA 4X9DA 3MEWA 2DRKA 1VYVA 5GANg 3I55T 1WQ7A 2FG0A 1M2VB 3E9FA 2RQWA 1BK2A 2KRMA 2PUOB 2AZVA 4E47A 1Y96B 4LD6A 2D6FA 1GCQC 1T0HA 1RLPC 3RDVA 1WPYA 1TUDA 2EJFA 1M1GA 4FT4A 2RNAA 3GIBA 1M30A 3P8BB 1QP3A 4MZPA 4D8DA 2AKKA 1KHIA 1FYNA 2P0QA 4L59A 5C0MA 2QTXA 3CC7A 2MF2A 1YI2T 4RG2A 3MO8A 2GBQA 5GAMg 3OYHA 3R6NA 3CD6Q 4HT8A 3ZBDA 3G4SA 1ZUKA 3UT1A 3FDRA 3VUBA 4ZNXA 4PFPA 4O6JA 4LNPA 5FU7B 3CCVQ 3V7SA 2F2XA 3RKXA 4JUVA 2HL5C 3SD4A 4BY6C 5I22A 3OA6A 1UGSB 2DL8A 8ATCB 3VKIA 5GANf 2HQHA 1OYXA 2HZYA 4M78F 2EQIA 3KXTA 2RJDA 1S72Q 3EFOB 1Y7XA 3QYGB 3JCMV 2LCSA 1KQSP 1AZGB 5LL6S 3RMQA 3GP8A 3IQLA 2C0IA 4RCCA 2QXFA 4FU6A 2HMAA 2QDLA 1ACMB 4A53A 3OMGA 5IN1A 1M5Q1 1NZ9A 5J39A 4IUTA 4HCBA 4PJLA 3EFSA 1VQLT 2RB6A 4C92F 5GAN5 5GAMf 1W4SA 3KBGA 3EH2A 4LDYA 2LT1A 1V29B 1PCXA 4PJOG 5KH6A 4M7DB 1VQ6A 5CKHA 3CPWP 1K73U 3CCRQ 4RG8A 2E6NA 2JS2A 4LE9A 5LJ3d 2J6KA 2BUDA 1QCNA 1N5ZA 1RI0A 3U23A 2CZ7B 2RN8A 1VQ8Q 2R57A 3C12A 4ORZA 4ELYC 2DBKA 4BACA 5J3BA 2XD0A 2E5QA 4C0DC 3CPWA 2CZ0B 2LJ0A 3UWNA 3I56T 2DPPB 2E10A 2DRMA 3H0IA 3QXEB 2LQ8A 3HL8A 1A0NB 2VB6A 5HK0A 1QKXA 2WSFE 4PJMA 4FL6A 1OQKA 5GAMd 1SEMA 3OS5A 2JT4A 2QQSA 1VQPT 4LDWA 4C0ZA 2V1QA 4Y92A 1G3YA 2K2VA 2RO0A 2DL7A 1QCFA 4XTZA 2EGAA 2DMOA 2CS7A 2CUDA 2K3YA 2JTMA 1Y57A 3I55A 2KBTA 1Y0MA 3OYDA 5GAN8 2ESWA 2F69A 1ZBXA 3S3NA 3FEOA 3EAEA 2XU8A 2XK0A 4NL3A 3ER0A 4QQGA 1WHHA 1JQQA 3O5ZA 2D8HA 3SWNA 4P5NA 4OMPA 5EC7A 1M1KU 4LDUA 1KC8U 3OMCA 3MEVA 2AIRB 3PGGA 3REAB 4XQ3A 3VS5A 1Q81C 4QVZA 1ARKA 1I4K1 5FWBA 1YI2A 4OGCA 2FB7A 3HRTA 4F7UG 3NTHA 2CSIA 2QK0A 2V8KA 2EW3A 4FYYB 3QJYA 5GJWB 1NJIC 5LJ3j 3M4GA 1Q7YU 3FJPA 4N0AA 3X24B 2MCNA 1QVGS 3CCQT 5HKCA 3OS1A 3H9NA 1YHQT 2VASA 2CH4W 1VQ7T 2HEQA 2NUPA 2DO3A 1VQ6Q 3VS2A 3JCMX 1WJSA 2VWFA 3X28B 1WGSA 2EYXA 4Z8AA 4BDYA 2HKQB 1VQKT 1G3SA 1FMKA 2O4XA 3RKYA 2O2OA 4E7SA 1WXBA 2DNUA 4JZ3A 4EMKC 2M1HA 2RMOA 1D3BA 1E7OA 1JO8A 2H3EB 1O75A 3H0FA 2WSCE 4J7FA 8AT1B 1IZ6A 5GMKh 2E41A 3QO3A 1VQLA 2FZCB 1FMVA 1W2BP 2PVDB 2LT4A 3M54A 1RADB 1ZA2B 1R8OB 3A5ZB 3SEMA 4XTUA 1VOMA 2K9GA 3HPWA 3GPLA 4JRPA 1Q86R 3LGFA 3JCMb 2EYZA 1CKAA 2CZ6B 3CMEQ 4C5EA 3GNGA 3H6ZA 3AT1B 2DL5A 2PU9B 2NWMA 1K76A 2HKNA 5GANh 3I55Q 4XTWA 1BIAA 2EQJA 5GAOm 3VS3A 3CXCA 3M0TA 2LX7A 2FPFA 3FIFA 3LX7A 3I56A 2J05A 4MZTA 2KROA 4RTYA 2XMFA 2DXTA 3CQTA 3EGXB 3BE3A 5DLQE 2XG8D 4ZTJA 2DD4A 2KT8A 3QHSA 1YIJQ 1UE9A 2GQVA 1WX6A 2YT6A 1UGRB 2FPEA 1VQPA 1Y71A 1AWWA 3EG1A 1AWXA 1MNEA 2DX1A 3OBYA 5GAMh 1ZHIA 4B9XA 4A4HA 2DK3A 4MZMA 3N5BB 2DXBA 2OTJT 4XTVA 1AZEA 1WFWA 4PJOD 1TOVA 4M78E 3SWNB 1BI0A 1RI9A 5LJ5j 1SSHA 3CMAA 5GMKi 2E3HA 5CO7A 3DLLA 3CC2Q 3JSCA 2LC4A 4AG1C 5FRNA 2FVUA 4KUDK 1HSQA 3G71A 2KYBA 4C5GA 1WDXA 5L8RE 4JLGA 5IXBA 1AHJB 4HA8A 1WZOA 2VC8A 4IUVA 4PJOC 3RKWA 1T0JA 4MMLA 1EIFA 1UGVA 4F7UB 1BCMA 2LCLA 4KRTA 3RUXA 2RH2A 4RCBA 2CGHA 1AVZC 3LWHA 1KJWA 1FXXA 4LD9K 1K8AC 2NUPB 2DL3A 3FLGA 1QWEA 4J5YA 2XICA 1Q82C 1AWOA 5LJ3e 1Q81R 2YHTA 2COZA 2D0QB 4PJJA 4ZGDB 3H8ZA 3CCQA 3I5RA 1YHQA 1QVPA 2VXFA 2O4XB 1VQ7A 2RI5A 3INZA 1NJIR 1O9SA 3CC7T 2SRCA 2QA4T 5A2QE 1D3BB 1KQSS 1RAGB 4JDSA 2MK5A 1K4US 1SRLA 1FMWA 2VUBA 3M0PA 1KD1U 1VQKA 1BB9A 3G4ST 4M7AD 5L23A 2DD5A 2K5FA 2ZPFB 3J81E 1R0CB 2YUNA 1MMAA 2GF7A 4E6RA 2YUQA 5C6SA 1D1AA 3UDCA 3CCUQ 1NEBA 1QVFA 3CCLQ 2CP0A 1EX4A 2V8IA 3OYLA 3H0HA 3UF4A 1VQNQ 2BIVA 3I56Q 4DBHA 1YBYA 1ABOA 2A7YA 4C8QC 5FU6B 1UGQB 4M7AC 1NLOC 1RAHB 1GRIA 2LRQA 3CPWS 1MGQA 1TXQA 4XU2A 2KGTA 4VUBA 2ROTA 3QDRB 3FC3A 3LW5E 2LQNA 1EZZB 1AEYA 2CP7A 1NJIU 3GBQA 4JPBW 2AZSA 2J6FA 1U5SA 1QVGA 4FYWB 1VUBA 2DILA 3M4YA 1WA7A 3M9QA 4XU0A 4OB2B 1WXUA 2HNIA 1IRXA 2VKNA 1GFCA 3ZL7C 2LJ1A 4XAXB 1IHVA 2X4XA 5GAOp 4AG2C 1YJWQ 1X27A 4QW2A 4II1A 1LPLA 4OB3B 3NTIA 3C94A 4CC7A 1VQ9A 2H8HA 2D8JA 4AFQC 1JRIA 3G6EA 4M75G 2RHZA 2L3SA 3OW2A 1PSFA 4BY6B 1MHNA 1QP2A 3CCMQ 4M7DA 5LJ5e 2RI2A 3HKSA 1CSKA 1LNXA 5D7UA 4C0FA 3GNFB 3PVLA 4CC4B 2D1XA 1BKBA 5A0LA 2OTLA 1J3TA 1LOJA 2QASA 3EFRA 4IUUA 3V8JA 2ZGWA 2VXEA 1PM3A 1OEBA 2PZ1A 4J9IA 3A8LB 2QGGA 1VQ7Q 3EG9A 3T9NA 1SPKA 2RA2A 1C1AA 2DJZA 2M0YA 3M57A 3OS2A 4D6WA 1JJ2A 3EGUA 2CKKA 1KIKA 4F16A 5CKFA 2YUPA 4X9CA 2E4HA 2GFUA 2PVGB 2O88A 2RHYA 2ZPBB 3UA6A 4HVUA 1BYMA 1B7TA 2H3JA 4C92C 4J9HA 4XU3A 5LJ3g 4JRIA 1NE8A 1X6BA 3TSZA 2VGMA 3CBOA 1PWTA 3VYHB 3VS7A 4E7IA 4EMKA 4DEYA 1G83A 2ROLA 5KYXA 3QZ9B 2P0KA 4ZGEB 1K8AR 3CC4A 5I2SA 1Q82R 4HVVA 4XK8E 5IHIA 4J9GA 4PFOA 2QA4A 4OF1A 2RJEA 2OAWA 1LCKA 3EH1A 2JW4A 3PE0A 1NPRA 1G2BA
chains in the Genus database with same CATH topology
2KBTA 1Y0MA 1TG0A 2ESWA 3M0RA 2EPDA 1V1CA 1X43A 3TSWA 3ULRB 2A28A 1B07A 1PHTA 2K6DA 1JQQA 1PKSA 3O5ZA 2D8HA 1XOVA 3FJ5A 2GQIA 4OMPA 2LNHB 2DE0X 5EC7A 1W6XA 4OMNA 1GBRA 2RQTA 1W70A 2MOXA 3REAB 2VVKA 3VS5A 1ARKA 1PRLC 5FWBA 4RTXA 2JXBA 2L3PA 2CSIA 2ECZA 2EW3A 1K0XA 1CKBA 2KEAA 1JEGA 2P4RA 1GL5A 5GJWB 2JM8A 2CH4A 2W0ZA 2LJ3A 2KYMA 2EYWA 2ABLA 2MCNA 2EBPA 2IIMA 2V1RA 3EG2A 2CH4W 2HEQA 4AFZC 1M3BA 1NG2A 2FEIA 1M3CA 2L0AA 1QWFA 4OMOA 4GLMA 1I1JA 3VS2A 2K3BA 4AFSC 2KXDA 2VWFA 1JXOA 2A36A 1NLPC 2FRWA 2X3WD 3RBBB 1AOJA 1NYGA 1UFFA 2EYXA 4Z8AA 3H41A 2BZXA 2NUZA 4Z89A 1ZLMA 2KE9A 1FMKA 3M0SA 2AKLA 5I11A 1PRMC 4ESRA 2O2OA 1WXBA 2AK5A 1GFDA 2DNUA 2MIOA 1WI7A 4JZ3A 1YWOA 2BZ8A 2RMOA 1M3AA 1S1NA 1E7OA 1ZSGA 1JO8A 1U3OA 2BTTA 3RNJA 3H0FA 4DEXA 2O31A 2D0NA 3A98A 1YNZA 2HCKA 3M0UA 4OMQA 2M51A 1KFZA 1UG1A 2SEMA 3LH5A 3SEMA 1UJ0A 2EVRA 2K9GA 4JZ4A 2EYZA 2RQUA 1ZX6A 1CKAA 4RTVA 2J6OA 2I0NA 2DL5A 1UHFA 2CSQA 2NWMA 2LP5A 4HVWA 2EKHA 1K76A 1SRMA 4JJDA 3QWXX 3I35A 1K9AA 2YDLA 3VS3A 1E6HA 5HCKA 1I07A 3M0TA 1H92A 4IIOA 2LX7A 2FPFA 1ZBJA 2J05A 2KROA 4RTZA 1Z9ZA 2XMFA 4RTYA 2RF0A 3CQTA 3VS1A 2DLPA 2JS0A 1NEGA 1UUEA 3TVTA 2C0OA 2KT8A 1UE9A 2KRNA 2DJQA 2GNCA 1OOTA 1VYTA 2EGCA 1WX6A 2YT6A 4JJCA 1ABQA 1BU1A 1YCSB 2FPEA 1JXMA 1W1FA 1UDLA 1AWWA 3M0QA 2FRYA 4F14A 3EG1A 2KT1A 3PVQA 1X2QA 4HCKA 1AWXA 2DA9A 2DX1A 3SHWA 1AZEA 1OPKA 1WFWA 1UHCA 2OI3A 3VS6A 1PKTA 1RI9A 1SSHA 3THKA 1T3SA 4AG1C 2FO0A 1HSQA 3VRYA 2CT3A 3VRZA 5IH2A 1MV3A 1K0SA 2DL4A 2K2MA 2KYBA 2X3XD 3EHQA 1WDXA 2ED0A 2RQVA 2YUOA 3QWYA 1UJYA 2O9SA 5IXBA 4RUGA 2JM9A 2B86A 5ECAA 5FWCA 1T0JA 2JMCA 1Z9QA 1UGVA 2E5KA 2ENMA 3EG0A 4FSSA 2RQRA 2BZYA 2PNIA 4KRTA 4RTWA 4J9CA 1OPLA 3UA7A 1AVZC 4LN2A 1KJWA 2DM1A 1X2KA 2DL3A 1QWEA 1AWOA 2EYYA 1RLQC 4J9DA 2F2WA 2K79A 1WXTA 4RTTA 2F2VA 2HSPA 2L3QA 1QKWA 2C0TA 3C0CA 1H3HA 4J9BA 3I5RA 3KFVA 5IXFA 3UATA 1X69A 2EGEA 2JTEA 2SRCA 1AD5A 1M8MA 1WIEA 2KNBB 2DVJA 3JV3A 1K4US 1SRLA 1ZUUA 2G6FX 3M0PA 2DRKA 1BB9A 1VYVA 1H8KA 2DBMA 2O9VA 5L23A 1QLYA 2DF6A 2FG0A 5FW9A 2YUNA 2RQWA 1BK2A 2KRMA 4E6RA 2YUQA 2AZVA 1NEBA 3NMZC 1GCQC 3VS0A 1T0HA 1RLPC 1X6GA 1BBZA 2FPDA 1TUDA 4RTUA 3H0HA 3UF4A 1K1ZA 4R0KA 4QT7A 2RNAA 1M30A 1ABOA 4J9EA 2L2PA 4D8DA 1NLOC 2AKKA 1GCQA 1GRIA 4F17A 1FYNA 1U06A 4LUDA 2KGTA 2ROTA 2RPNA 2GBQA 4OMLA 1SHFA 2J7IA 1VA7A 3R6NA 4D8KA 4AFUC 1RUWA 2LQNA 1ZUKA 1AEYA 1E6GA 2LQWA 3GBQA 4JPBW 4Z88A 4ZNXA 1PNJA 2AZSA 2J6FA 1U5SA 2DILA 4LNPA 1WA7A 4EIKA 1WXUA 2F2XA 2HDAA 3NGPA 2VKNA 1WYXA 1UECA 1GFCA 3ZL7C 1UTIA 2LJ1A 5I22A 2LMJA 4J9FA 1M27C 2KRSA 2DL8A 4M4ZA 1GCPA 1HD3A 1B3QA 4AG2C 1X27A 1I0CA 1GBQA 1KSWA 1T3LA 2CREA 2EQIA 4CC7A 2H8HA 2D8JA 2HBWA 4AFQC 4OMMA 2J06A 2LCSA 1AZGB 4HXJA 4CC3A 2OJ2A 2L3SA 1VYUA 1SHGA 3IQLA 2C0IA 3NPFA 4JJBA 1TUCA 2QDLA 2CDTA 1CSKA 2GTOA 3PVLA 4GBQA 2D1XA 4CC4B 2YSQA 3VS4A 1J3TA 3EG3A 2GTJA 4CC2A 1AWJA 1OEBA 2PZ1A 4J9IA 4LUEA 2JMAA 1SPKA 3I5SA 4IIMA 5GJVB 2M0YA 2JS2A 4LE9A 3EGUA 2J6KA 1KIKA 4WCIA 1N5ZA 4F16A 2K7AA 3REBB 3EHRA 4X1VA 2YUPA 3U23A 2O88A 2A37A 2RN8A 3UA6A 4HVUA 4ORZA 2DBKA 4J9HA 2CUBA 4A63B 3NHNA 1X6BA 1YP5A 3TSZA 2LJ0A 1PWTA 2DRMA 2W10A 3H0IA 3VS7A 2KR3A 2A08A 4K11A 2DYBA 5IHKA 4DEYA 2CT4A 1IO6A 1A0NB 1G83A 2ROLA 2LZ6B 1EFNA 2ED1A 1QKXA 1SEMA 2PTKA 1ZUYA 1JU5C 2JT4A 1MV0B 3I9QA 2GGRA 1HJDA 4HVVA 2V1QA 4Y92A 1NM7A 1OV3A 5IHIA 1WLPB 4J9GA 1YWPA 5IHNA 2DL7A 1QCFA 1YN8A 1MUZA 2DMOA 2EGAA 2OAWA 2CUDA 1LCKA 2KXCA 2JW4A 3PE0A 1Y57A 1G2BA 1NYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBT A;  1Y0M A;  1TG0 A;  2ESW A;  3M0R A;  2EPD A;  1V1C A;  1X43 A;  3TSW A;  3ULR B;  2A28 A;  1B07 A;  1PHT A;  2K6D A;  1JQQ A;  1PKS A;  3O5Z A;  2D8H A;  1XOV A;  3FJ5 A;  2GQI A;  4OMP A;  2LNH B;  2DE0 X;  5EC7 A;  1W6X A;  4OMN A;  1GBR A;  2RQT A;  1W70 A;  2MOX A;  3REA B;  2VVK A;  3VS5 A;  1ARK A;  1PRL C;  5FWB A;  4RTX A;  2JXB A;  2L3P A;  2CSI A;  2ECZ A;  2EW3 A;  1K0X A;  1CKB A;  2KEA A;  1JEG A;  2P4R A;  1GL5 A;  5GJW B;  2JM8 A;  2CH4 A;  2W0Z A;  2LJ3 A;  2KYM A;  2EYW A;  2ABL A;  2MCN A;  2EBP A;  2IIM A;  2V1R A;  3EG2 A;  2CH4 W;  2HEQ A;  4AFZ C;  1M3B A;  1NG2 A;  2FEI A;  1M3C A;  2L0A A;  1QWF A;  4OMO A;  4GLM A;  1I1J A;  3VS2 A;  2K3B A;  4AFS C;  2KXD A;  2VWF A;  1JXO A;  2A36 A;  1NLP C;  2FRW A;  2X3W D;  3RBB B;  1AOJ A;  1NYG A;  1UFF A;  2EYX A;  4Z8A A;  3H41 A;  2BZX A;  2NUZ A;  4Z89 A;  1ZLM A;  2KE9 A;  1FMK A;  3M0S A;  2AKL A;  5I11 A;  1PRM C;  4ESR A;  2O2O A;  1WXB A;  2AK5 A;  1GFD A;  2DNU A;  2MIO A;  1WI7 A;  4JZ3 A;  1YWO A;  2BZ8 A;  2RMO A;  1M3A A;  1S1N A;  1E7O A;  1ZSG A;  1JO8 A;  1U3O A;  2BTT A;  3RNJ A;  3H0F A;  4DEX A;  2O31 A;  2D0N A;  3A98 A;  1YNZ A;  2HCK A;  3M0U A;  4OMQ A;  2M51 A;  1KFZ A;  1UG1 A;  2SEM A;  3LH5 A;  3SEM A;  1UJ0 A;  2EVR A;  2K9G A;  4JZ4 A;  2EYZ A;  2RQU A;  1ZX6 A;  1CKA A;  4RTV A;  2J6O A;  2I0N A;  2DL5 A;  1UHF A;  2CSQ A;  2NWM A;  2LP5 A;  4HVW A;  2EKH A;  1K76 A;  1SRM A;  4JJD A;  3QWX X;  3I35 A;  1K9A A;  2YDL A;  3VS3 A;  1E6H A;  5HCK A;  1I07 A;  3M0T A;  1H92 A;  4IIO A;  2LX7 A;  2FPF A;  1ZBJ A;  2J05 A;  2KRO A;  4RTZ A;  1Z9Z A;  2XMF A;  4RTY A;  2RF0 A;  3CQT A;  3VS1 A;  2DLP A;  2JS0 A;  1NEG A;  1UUE A;  3TVT A;  2C0O A;  2KT8 A;  1UE9 A;  2KRN A;  2DJQ A;  2GNC A;  1OOT A;  1VYT A;  2EGC A;  1WX6 A;  2YT6 A;  4JJC A;  1ABQ A;  1BU1 A;  1YCS B;  2FPE A;  1JXM A;  1W1F A;  1UDL A;  1AWW A;  3M0Q A;  2FRY A;  4F14 A;  3EG1 A;  2KT1 A;  3PVQ A;  1X2Q A;  4HCK A;  1AWX A;  2DA9 A;  2DX1 A;  3SHW A;  1AZE A;  1OPK A;  1WFW A;  1UHC A;  2OI3 A;  3VS6 A;  1PKT A;  1RI9 A;  1SSH A;  3THK A;  1T3S A;  4AG1 C;  2FO0 A;  1HSQ A;  3VRY A;  2CT3 A;  3VRZ A;  5IH2 A;  1MV3 A;  1K0S A;  2DL4 A;  2K2M A;  2KYB A;  2X3X D;  3EHQ A;  1WDX A;  2ED0 A;  2RQV A;  2YUO A;  3QWY A;  1UJY A;  2O9S A;  5IXB A;  4RUG A;  2JM9 A;  2B86 A;  5ECA A;  5FWC A;  1T0J A;  2JMC A;  1Z9Q A;  1UGV A;  2E5K A;  2ENM A;  3EG0 A;  4FSS A;  2RQR A;  2BZY A;  2PNI A;  4KRT A;  4RTW A;  4J9C A;  1OPL A;  3UA7 A;  1AVZ C;  4LN2 A;  1KJW A;  2DM1 A;  1X2K A;  2DL3 A;  1QWE A;  1AWO A;  2EYY A;  1RLQ C;  4J9D A;  2F2W A;  2K79 A;  1WXT A;  4RTT A;  2F2V A;  2HSP A;  2L3Q A;  1QKW A;  2C0T A;  3C0C A;  1H3H A;  4J9B A;  3I5R A;  3KFV A;  5IXF A;  3UAT A;  1X69 A;  2EGE A;  2JTE A;  2SRC A;  1AD5 A;  1M8M A;  1WIE A;  2KNB B;  2DVJ A;  3JV3 A;  1K4U S;  1SRL A;  1ZUU A;  2G6F X;  3M0P A;  2DRK A;  1BB9 A;  1VYV A;  1H8K A;  2DBM A;  2O9V A;  5L23 A;  1QLY A;  2DF6 A;  2FG0 A;  5FW9 A;  2YUN A;  2RQW A;  1BK2 A;  2KRM A;  4E6R A;  2YUQ A;  2AZV A;  1NEB A;  3NMZ C;  1GCQ C;  3VS0 A;  1T0H A;  1RLP C;  1X6G A;  1BBZ A;  2FPD A;  1TUD A;  4RTU A;  3H0H A;  3UF4 A;  1K1Z A;  4R0K A;  4QT7 A;  2RNA A;  1M30 A;  1ABO A;  4J9E A;  2L2P A;  4D8D A;  1NLO C;  2AKK A;  1GCQ A;  1GRI A;  4F17 A;  1FYN A;  1U06 A;  4LUD A;  2KGT A;  2ROT A;  2RPN A;  2GBQ A;  4OML A;  1SHF A;  2J7I A;  1VA7 A;  3R6N A;  4D8K A;  4AFU C;  1RUW A;  2LQN A;  1ZUK A;  1AEY A;  1E6G A;  2LQW A;  3GBQ A;  4JPB W;  4Z88 A;  4ZNX A;  1PNJ A;  2AZS A;  2J6F A;  1U5S A;  2DIL A;  4LNP A;  1WA7 A;  4EIK A;  1WXU A;  2F2X A;  2HDA A;  3NGP A;  2VKN A;  1WYX A;  1UEC A;  1GFC A;  3ZL7 C;  1UTI A;  2LJ1 A;  5I22 A;  2LMJ A;  4J9F A;  1M27 C;  2KRS A;  2DL8 A;  4M4Z A;  1GCP A;  1HD3 A;  1B3Q A;  4AG2 C;  1X27 A;  1I0C A;  1GBQ A;  1KSW A;  1T3L A;  2CRE A;  2EQI A;  4CC7 A;  2H8H A;  2D8J A;  2HBW A;  4AFQ C;  4OMM A;  2J06 A;  2LCS A;  1AZG B;  4HXJ A;  4CC3 A;  2OJ2 A;  2L3S A;  1VYU A;  1SHG A;  3IQL A;  2C0I A;  3NPF A;  4JJB A;  1TUC A;  2QDL A;  2CDT A;  1CSK A;  2GTO A;  3PVL A;  4GBQ A;  2D1X A;  4CC4 B;  2YSQ A;  3VS4 A;  1J3T A;  3EG3 A;  2GTJ A;  4CC2 A;  1AWJ A;  1OEB A;  2PZ1 A;  4J9I A;  4LUE A;  2JMA A;  1SPK A;  3I5S A;  4IIM A;  5GJV B;  2M0Y A;  2JS2 A;  4LE9 A;  3EGU A;  2J6K A;  1KIK A;  4WCI A;  1N5Z A;  4F16 A;  2K7A A;  3REB B;  3EHR A;  4X1V A;  2YUP A;  3U23 A;  2O88 A;  2A37 A;  2RN8 A;  3UA6 A;  4HVU A;  4ORZ A;  2DBK A;  4J9H A;  2CUB A;  4A63 B;  3NHN A;  1X6B A;  1YP5 A;  3TSZ A;  2LJ0 A;  1PWT A;  2DRM A;  2W10 A;  3H0I A;  3VS7 A;  2KR3 A;  2A08 A;  4K11 A;  2DYB A;  5IHK A;  4DEY A;  2CT4 A;  1IO6 A;  1A0N B;  1G83 A;  2ROL A;  2LZ6 B;  1EFN A;  2ED1 A;  1QKX A;  1SEM A;  2PTK A;  1ZUY A;  1JU5 C;  2JT4 A;  1MV0 B;  3I9Q A;  2GGR A;  1HJD A;  4HVV A;  2V1Q A;  4Y92 A;  1NM7 A;  1OV3 A;  5IHI A;  1WLP B;  4J9G A;  1YWP A;  5IHN A;  2DL7 A;  1QCF A;  1YN8 A;  1MUZ A;  2DMO A;  2EGA A;  2OAW A;  2CUD A;  1LCK A;  2KXC A;  2JW4 A;  3PE0 A;  1Y57 A;  1G2B A;  1NYF A; 
#chains in the Genus database with same CATH topology
 4Y28 E;  1TG0 A;  1YCY A;  5KYY B;  3M0R A;  1WHG A;  2VGN A;  2QAZ A;  1X43 A;  3TSW A;  6AT1 B;  2JZ2 A;  2HD0 A;  4M7D E;  3Q1J A;  2GFA A;  2ZPE B;  4E7L A;  5CQY A;  2K6D A;  2F5K A;  1W2B S;  4PL6 A;  1PKS A;  3FJ5 A;  2JUF A;  3A8G B;  3GOX A;  2LNH B;  2DE0 X;  2JTF A;  3CCS Q;  2DEQ A;  1W6X A;  2QI2 A;  3CXC S;  2HQE A;  2RQT A;  1RAE B;  2MOX A;  3MJX A;  5LJ3 f;  1D0Z A;  3V8K A;  1RL2 A;  2O01 E;  2E12 A;  3BDU A;  1VIE A;  2JXB A;  1Q82 U;  3M58 A;  2EWN A;  3LGL A;  2NYS A;  2OTJ Q;  2KEA A;  1GXI E;  2JM8 A;  3JB9 F;  1HYO A;  2JVV A;  3LH0 A;  3GF5 A;  1ZSZ C;  2LJ3 A;  2ABL A;  5CVI A;  2EBP A;  4JS5 A;  3J7A F;  4BE0 A;  3BW1 A;  3EG2 A;  1Q86 C;  1OU8 A;  1KQS A;  1M3B A;  1M3C A;  1Y07 A;  1QWF A;  4GLM A;  1D09 B;  2HQX A;  3HRS A;  4AFS C;  2FRW A;  1NLP C;  2FHD A;  1AOJ A;  1NYG A;  3TRE A;  2ZCF B;  3CCJ T;  3H41 A;  3ME9 A;  4PJO A;  4Z89 A;  2DIG A;  5FRM A;  4E7Z A;  5FLX E;  4ESR A;  1AT1 B;  2QEX A;  5LJ5 g;  3A1P A;  1WI7 A;  3VJP A;  1FWZ A;  2BZ8 A;  1M3A A;  4OB1 B;  1ZSG A;  2JN0 A;  2RHI A;  3EG9 B;  1U3O A;  4WF2 A;  3JCM P;  4KT0 E;  4A4E A;  2HCK A;  5HK3 A;  5D6W A;  3G1J A;  4M77 D;  3QII A;  3OYC A;  2XDB A;  2M51 A;  1UG1 A;  2CP5 A;  2EVR A;  3MEU A;  4DQ2 A;  2BE7 D;  4JZ4 A;  4L5G A;  2RQU A;  3JCM c;  3CC7 Q;  2YWW A;  2J6O A;  4OP0 A;  4EMK B;  2DXU A;  5IAY A;  3EGX A;  2E1H A;  2M0O A;  4M77 C;  5KYX B;  2KY9 A;  3G4S Q;  3OYA A;  2HSE B;  1MMN A;  2ZAE A;  3J80 E;  3A8M B;  3HHT B;  1K9A A;  2YDL A;  2KQW A;  3CMA T;  1IGQ A;  1I07 A;  1FX7 A;  4IIO A;  3OSS C;  1WHK A;  4M75 D;  4N4I A;  1I5L A;  3G71 T;  3VS1 A;  2JS0 A;  2COW A;  1UUE A;  3V8L A;  4C8Q G;  1VQM A;  2Y90 A;  1I5O B;  4M7A G;  4JJN K;  1OOT A;  1QVF S;  5LJ5 f;  3JRZ A;  1ABQ A;  1XQH A;  5GAO l;  1M90 C;  1JXM A;  1UDL A;  3EGD A;  2FRY A;  2DA9 A;  4M75 C;  1OX8 A;  2V8J A;  4PJO E;  3L2W A;  1UHC A;  5CKB A;  1IRE B;  1PKT A;  3RR6 A;  5DLO A;  4MMK A;  4ZN1 A;  3SFM A;  3OB9 A;  3HTR A;  4F7U A;  5DM7 R;  1T3S A;  2FO0 A;  4QVD A;  2F1L A;  1P92 A;  3VRY A;  2CT3 A;  3OYJ A;  1K0S A;  3OS0 A;  2X3X D;  5CR2 A;  4LXC A;  5J26 A;  3L2R A;  1K9M C;  1UJY A;  2LDM A;  4R55 A;  2DIQ A;  5FWC A;  4FSS A;  2DER A;  2BZY A;  1G8X A;  2QYZ A;  4N4H A;  4RTW A;  5KYU A;  3L2V A;  4J9C A;  5LJ5 d;  3URG A;  5EG2 A;  4J6X A;  3L42 A;  4MDW A;  4KUL A;  2DEU A;  2EYY A;  4GLK A;  2K79 A;  4AMC A;  4RTT A;  3V7R A;  2HSP A;  4J6W A;  2K4Y A;  4PJO B;  4M78 G;  3OW2 S;  1U1S A;  3LLR A;  4R56 A;  1IHW A;  3KFV A;  2ZPI B;  5M9O A;  2C06 A;  1HK9 A;  5CAI A;  2DKG A;  1MND A;  1TSF A;  1AD5 A;  1YJN A;  5GAO q;  2KAF A;  3QPH A;  3CCJ A;  2G6F X;  2R5M A;  3ASK A;  1MMG A;  1QLY A;  1PG5 B;  4OB0 B;  3SDZ A;  1RAA B;  2KMT A;  1W2B A;  4C92 G;  1BBZ A;  1JJ2 S;  4NL2 A;  4RTU A;  2VV5 A;  5LJ3 h;  2YLC A;  1JBM A;  3RMS A;  1OI1 A;  4F7U E;  1PC0 A;  4E2F B;  1GCQ A;  3CD6 T;  5GAN 3;  1KQ1 A;  1OX9 A;  2E64 A;  4LUD A;  4BE1 A;  2RPN A;  1N8R R;  4IUQ A;  3QJ6 A;  3PNW C;  5CCA A;  4OML A;  4XTX A;  3BDL A;  2J7I A;  1VQ9 T;  1BIB A;  4E7H A;  1RUW A;  4WTO B;  3G6E T;  3HFO A;  4KGV B;  1E6G A;  2LQW A;  1YI2 Q;  2V26 A;  4PLL A;  4X34 A;  4M7D F;  3TU4 K;  3QSU A;  3TEE A;  4EIK A;  1OZ2 A;  3OQ5 A;  1KHC A;  1WYX A;  1Q86 U;  3X20 B;  1QQJ A;  1UEC A;  3OYI A;  5GMK m;  2EQK A;  2KSS A;  1M27 C;  2OTL T;  1LJO A;  4M4Z A;  1X01 A;  3EGD B;  1HD3 A;  1B3Q A;  1S72 T;  1WHL A;  3MKD A;  3JAM E;  2CRE A;  3DLM A;  3L2U A;  2KK4 A;  3PIP A;  2CP2 A;  2HBW A;  2E3I A;  4BE2 A;  1X75 C;  2OJ2 A;  1SHG A;  2MAM A;  4LDV A;  3NPF A;  4JJB A;  3WXM B;  1TUC A;  3OYF A;  2F5T X;  5GMK e;  1XNI A;  4BDZ A;  4NOY A;  4A4G A;  2K5I A;  1M90 R;  3A8H B;  4GBQ A;  2OAU A;  3QDF A;  1RAC B;  3MP1 A;  5KYU B;  2GTJ A;  4CC2 A;  1G3T A;  1AWJ A;  4OMF B;  1VQL Q;  4J83 A;  3PIO A;  1RAB B;  3CC4 T;  4IIM A;  4ZGJ B;  3OYE A;  1VQ5 T;  2DFU A;  1VQ8 T;  3G7Z A;  4J7I A;  2DTO A;  3HFN A;  3BFM A;  2A37 A;  1K9M R;  2DXC A;  2CP6 A;  4C8Q D;  5D6Y A;  3E2U A;  4EMH A;  3NHN A;  5LJ5 h;  1JB0 E;  4JLI A;  3E1S A;  2EYQ A;  2A08 A;  2DYB A;  2CT4 A;  5GAN 6;  2LZ6 B;  1EFN A;  2XID A;  2ZPG B;  1BI2 A;  4FYV B;  1M90 U;  3C95 A;  2DTH A;  2DAQ A;  1ZUY A;  1JU5 C;  3I9Q A;  3L2Z A;  1Q81 U;  4FW2 A;  1HJD A;  5KYY A;  4YTL A;  1NM7 A;  1UB4 A;  1OV3 A;  1WLP B;  1XJW B;  2AHJ B;  2CYZ B;  3QBY A;  5IHN A;  1VQP Q;  3WVD B;  2KXC A;  2XDP A;  4JS4 A;  4M77 G;  1NYF A;  3SWN C;  4M77 A;  3ULR B;  2A28 A;  3CMA Q;  1XTD A;  1WQW A;  3CCE T;  3PMI A;  3M5A A;  5A0G A;  1M9S A;  2YRD A;  3G71 Q;  1D0X A;  1GBR A;  3CD6 A;  1W70 A;  2VVK A;  4PJO F;  1HXD A;  3RER A;  1PRL C;  4KBM B;  2X35 A;  2L3P A;  4N0A C;  4DBF A;  2MWO A;  4M78 D;  2CZ1 B;  4ELZ C;  1IB8 A;  2QEX T;  2LTO A;  4F04 B;  4M75 A;  4KGZ B;  2P4R A;  1GL5 A;  2EFI A;  2CH4 A;  1R0B G;  4IKF A;  2IPO B;  2QQ9 A;  2MWP A;  2KYM A;  5KE2 A;  2KDS A;  2V1R A;  4DOW A;  4M78 C;  3X26 B;  2FEI A;  2L0A A;  1S72 A;  2E6Z A;  3MHX A;  1TWB A;  3CCQ Q;  1M1K C;  1JXO A;  2A36 A;  4C92 D;  2X3W D;  1YHQ Q;  3RBB B;  1KC8 C;  2M9U A;  3AHU A;  1N27 A;  4O5V A;  2KE9 A;  3R6O A;  2AKL A;  2PQW A;  5I11 A;  1PRM C;  1OU9 A;  3HRU A;  3OY9 A;  1VQK Q;  4Q5W A;  2MIO A;  1GFD A;  1ZSZ B;  1YWO A;  4FIB A;  2AT1 B;  1S1N A;  2ZPH B;  2BTT A;  3RNJ A;  2O31 A;  4BD3 A;  1TUG B;  1Q7Y C;  2G3R A;  1YNZ A;  3M55 A;  3TQ7 P;  1LVK A;  2YRV A;  2M16 A;  3M0U A;  4OMQ A;  4DA4 A;  2EQU A;  3CCR A;  1VQM T;  3LH5 A;  5GAN 4;  3UPU A;  3JCM e;  1UJ0 A;  4HCZ A;  2EIF A;  2L89 A;  2JNG A;  2DZ9 A;  1VQ5 A;  1ZX6 A;  1VQ8 A;  3M53 A;  3JB9 J;  1UHF A;  4HVW A;  2LP5 A;  4J6Y A;  4JJD A;  4HT9 A;  1SRM A;  3QWX X;  4C0D B;  5GAO n;  3RES A;  2MI6 A;  4F7U F;  1H92 A;  3QUI A;  3HSB A;  1ZBJ A;  1YIJ T;  4FM4 B;  4M75 E;  4RTZ A;  2DLP A;  3PT9 A;  3TCJ A;  4LDX A;  2C0O A;  2KRN A;  2GNC A;  2EQM A;  4Z02 A;  2RJC A;  1VYT A;  2EGC A;  1RAI B;  4ZTF A;  4JJC A;  1BU1 A;  1YCS B;  4M77 B;  5KCH A;  4F14 A;  4PLI A;  2KT1 A;  1X2Q A;  4HCK A;  1VQ9 Q;  5AYF A;  3A8O B;  1YJ9 T;  1PD0 A;  3G6E Q;  1N9S A;  3CC2 T;  1K8A U;  1M1F A;  3SHW A;  1WHM A;  3OYB A;  4E7J A;  1K73 R;  2OX7 A;  2P0P A;  3THK A;  5KYW B;  4RKU E;  3L1A A;  4E7K A;  1MV3 A;  1MMD A;  2DL4 A;  3EHQ A;  2YRC A;  2ED0 A;  3CCE A;  2OTL Q;  3QWY A;  3QYH B;  4RUG A;  1UGP B;  2D9T A;  2JM9 A;  2B86 A;  5ECA A;  2KI7 A;  3P8D A;  1VQ4 T;  1Z9Q A;  2E5K A;  1ZA1 B;  5KCO A;  2YLB A;  3EG0 A;  4M75 B;  3L2Q A;  2RQR A;  2JOY A;  4DOV A;  1YJN T;  4KH0 B;  1OPL A;  3S3O A;  3UA7 A;  2QTV A;  2E70 A;  3OYM A;  4LN2 A;  4EPC A;  2NUT A;  5KE3 A;  3CBP A;  2MMP A;  1RLQ C;  4J9D A;  3KUF A;  2F2W A;  1WXT A;  3MPU B;  4DBQ A;  2L3Q A;  2C0T A;  2EAY A;  1N8R C;  3CPF A;  3QKJ A;  2EJ9 A;  1M2O A;  2RK1 A;  1NPP A;  5GAN d;  3ZFJ A;  2QQA A;  2QDY B;  1X69 A;  2JTE A;  2WSE E;  3CC4 Q;  1VQ5 Q;  1WIE A;  1N9R A;  4KH1 B;  1N6A A;  3JV3 A;  3CCU T;  1ZUU A;  3CCL T;  1H8K A;  2DBM A;  2O9V A;  2QA4 Q;  2DF6 A;  2P84 A;  5FW9 A;  1VQN T;  1IGU A;  4ME7 A;  1VQO T;  4B6M A;  1M1K R;  1Q95 G;  1KC8 R;  3NMZ C;  3VS0 A;  1X6G A;  2FPD A;  5FU7 C;  2CP3 A;  1K1Z A;  4J8O A;  2FL7 A;  4R0K A;  2PUK B;  4EDU A;  4QT7 A;  1QCO A;  1WJQ A;  4J9E A;  2I2L A;  2QG9 B;  2XKO C;  2L2P A;  3JCM g;  4PKC C;  4F17 A;  1U06 A;  2MPX C;  2IVW A;  1D1B A;  1TH7 A;  3VU3 C;  1H3Z A;  3CME A;  4Y91 A;  3CEY A;  2QQR A;  2YXY A;  1SHF A;  4C8Q A;  1VA7 A;  1Q7Y R;  4D8K A;  4AFU C;  4M7A A;  1KD1 C;  4Z88 A;  1PNJ A;  5D6X A;  2X4Y A;  3MEA A;  2HDA A;  3NGP A;  5CQX A;  4M7D D;  1VIF A;  3JB9 I;  1X6O A;  4L6V 5;  1UTI A;  5GMK j;  1YJW T;  4EMG A;  2LMJ A;  1R77 A;  4J9F A;  2KRS A;  1YIJ A;  3M59 A;  2VYT A;  3CCE Q;  1GCP A;  1TU0 B;  1YIT T;  1I0C A;  1KSW A;  1GBQ A;  5I2M A;  1T3L A;  5AT1 B;  4IUP A;  4M7D C;  1V76 A;  1NBE B;  3V7C A;  4OMM A;  2J06 A;  5GMK l;  3CCM T;  2COY A;  3OYY A;  4HXJ A;  4CC3 A;  1OUL A;  1VYU A;  3BY7 A;  5GAN j;  4AT1 B;  1YJ9 A;  1WNL A;  2X51 A;  3CC2 A;  2Y4X A;  3JCM f;  2CDT A;  2QEX Q;  5FRO A;  2GTO A;  2P4T A;  2X9H A;  3ZEH A;  1U1T A;  2YSQ A;  3VS4 A;  3FRN A;  2QGF B;  3EG3 A;  5IT9 E;  3O8V A;  4BB7 A;  4LUE A;  5A0D A;  2JMA A;  3JB9 H;  3DB3 A;  3I5S A;  5GJV B;  2NUT B;  4M78 A;  1VQ4 A;  2LX9 A;  4WCI A;  2K7A A;  3REB B;  3EHR A;  4X1V A;  3LYI A;  5GAM j;  4A54 A;  1RAF B;  2QQB A;  3JCM Q;  2A0F B;  3JB9 G;  4C8Q E;  1H64 1;  2RHX A;  4M7A E;  2CUB A;  2HL3 A;  4A63 B;  2NLU A;  4M77 F;  1WJR A;  1YP5 A;  1UEB A;  2XDD A;  2LCC A;  2RK2 A;  2W10 A;  2KR3 A;  3DKM A;  4K11 A;  3JCM d;  5IHK A;  4QVC A;  1IO6 A;  4C92 A;  2ED1 A;  4BUG A;  3CXC P;  2PTK A;  2R58 A;  1MV0 B;  3QG1 A;  2GGR A;  3LWI A;  1VQM Q;  4B9W A;  1SF9 A;  1G3W A;  1YWP A;  2ZZD A;  1YN8 A;  1MUZ A;  3CCU A;  1B34 A;  2FYK A;  3PFS A;  4XTY A;  5CIU A;  3CCV T;  3CCL A;  3OYK A;  4M75 F;  2HBP A;  1VQN A;  2RD1 A;  5GAN 7;  4A4F A;  1VQO A;  2EPD A;  1F1B B;  1V1C A;  3NTK A;  3OYG A;  2R5A A;  3PMT A;  4TVR A;  1IXD A;  1B07 A;  3CCS T;  2XHC A;  1PHT A;  1KG1 A;  4C8Q B;  1BCO A;  4M7A B;  4KGX B;  2LQK A;  3QZ5 B;  1C0M A;  1XOV A;  1PSE A;  2GQI A;  4OMN A;  3SB2 A;  4PFZ A;  5HY6 A;  3DB4 A;  4V2S A;  2GCX A;  1KQ2 A;  3X25 B;  4MDX A;  4RTX A;  4FYX B;  2ECZ A;  4UC4 A;  1YJ9 Q;  2E65 A;  1D1C A;  1K0X A;  1CKB A;  1JEG A;  2M02 A;  5CKD A;  1N8R U;  4HCC A;  3OSV A;  2FZG B;  3P8H A;  1YFN A;  2W0Z A;  2EYW A;  3GLX A;  2DET A;  4PNO A;  2IIM A;  1YJW A;  2LNV A;  1KD1 R;  4AFZ C;  7AT1 B;  1NG2 A;  3NFC A;  4OMO A;  3E19 A;  1I1J A;  3CCR T;  1PD1 A;  2K3B A;  2L3R A;  3HP9 A;  1YIT A;  4C92 E;  2KXD A;  1ZSZ A;  1UFF A;  1VQ4 Q;  1G5V A;  3MP6 A;  2BZX A;  2NUZ A;  1I8F A;  1ZLM A;  3M0S A;  4ZN3 A;  1YJN Q;  4HKE A;  4PJN A;  3CCM A;  2ATC B;  5GAN e;  3CCJ Q;  2K5L A;  2AK5 A;  2FZK B;  3CBM A;  4OVA A;  1KK7 A;  4DBR A;  2XI9 A;  4BI4 A;  3PTA A;  1DJ7 B;  4DEX A;  4M78 B;  9ATC B;  2JJ9 A;  2D0N A;  1ZQ1 A;  2IG0 A;  4GY5 A;  3A98 A;  2RHU A;  4BI8 B;  1M2V A;  2B8A A;  3WVE B;  1QVF P;  1U8R A;  1Y96 A;  1KFZ A;  2SEM A;  1C6V X;  4C5I A;  1I81 A;  2Z0W A;  4IUR A;  1D0Y A;  3MET A;  4XU1 A;  1TS9 A;  4CRI A;  2DTI A;  3OYN A;  5GAO r;  5GAM e;  4RTV A;  4FCY A;  2WAC A;  4QQ6 A;  2I0N A;  1K73 C;  2CSQ A;  3JCM W;  4PK4 A;  4C92 B;  2EKH A;  5CKE A;  2K57 A;  3I35 A;  1VQO Q;  1E6H A;  5HCK A;  4FW1 A;  4QKU A;  4KUI A;  3OBW A;  3FB9 A;  2BE9 B;  2LVM A;  3JCM J;  1K9M U;  1Z9Z A;  2RF0 A;  1QVG P;  5I21 A;  1BI1 A;  1NEG A;  2L8D A;  3TVT A;  4CI0 C;  1B34 B;  2DJQ A;  1SG5 A;  3RIR A;  3JCM h;  2EKO A;  2MYS A;  2X4W A;  2HAX A;  2EJG A;  1W1F A;  5KYW A;  3M0Q A;  3PVQ A;  2BKD N;  4RMO A;  5KYN A;  3F70 A;  2PVO B;  1OPK A;  5DY9 A;  2OI3 A;  3D7S B;  3VS6 A;  3CCV A;  3EFO A;  4BI3 A;  3VV0 A;  2Y4Y A;  4QQD A;  3VRZ A;  3OW2 P;  5IH2 A;  2K2M A;  3MP8 A;  3CCS A;  1VQ6 T;  5GAN 2;  2RQV A;  2YUO A;  2DYI A;  4ANJ A;  2O9S A;  4A4K A;  3JB9 D;  1YIT Q;  2JMC A;  2RI3 A;  2KVQ G;  1WHJ A;  2ENM A;  2L5Q A;  3C4S A;  2K3X A;  1QW1 A;  5CK9 A;  2PNI A;  1SKU B;  4M7D G;  4JRQ A;  2A3L A;  3S3M A;  3VUZ A;  2X4J A;  1TTH B;  4FSX A;  2OTJ A;  3VYG A;  2DM1 A;  4OGE A;  4JRK A;  4C0G A;  1X2K A;  1JJ2 P;  4N4G A;  1QMC A;  1BI3 A;  4NS5 A;  2F2V A;  3MCA B;  3E9G A;  1QKW A;  3M56 A;  1M4Z A;  4FT2 A;  4C5H A;  2RM4 A;  3C0C A;  1H3H A;  1M8V A;  4J9B A;  4M77 E;  5IXF A;  5FU6 C;  2RJF A;  3UAT A;  2EGE A;  1OZ3 A;  1M8M A;  4C8Q F;  1SSF A;  3S6W A;  3CME T;  2KNB B;  2DVJ A;  4ATO A;  4M7A F;  2DVE A;  2DZC A;  4X9D A;  3MEW A;  2DRK A;  1VYV A;  5GAN g;  3I55 T;  1WQ7 A;  2FG0 A;  1M2V B;  3E9F A;  2RQW A;  1BK2 A;  2KRM A;  2PUO B;  2AZV A;  4E47 A;  1Y96 B;  4LD6 A;  2D6F A;  1GCQ C;  1T0H A;  1RLP C;  3RDV A;  1WPY A;  1TUD A;  2EJF A;  1M1G A;  4FT4 A;  2RNA A;  3GIB A;  1M30 A;  3P8B B;  1QP3 A;  4MZP A;  4D8D A;  2AKK A;  1KHI A;  1FYN A;  2P0Q A;  4L59 A;  5C0M A;  2QTX A;  3CC7 A;  2MF2 A;  1YI2 T;  4RG2 A;  3MO8 A;  2GBQ A;  5GAM g;  3OYH A;  3R6N A;  3CD6 Q;  4HT8 A;  3ZBD A;  3G4S A;  1ZUK A;  3UT1 A;  3FDR A;  3VUB A;  4ZNX A;  4PFP A;  4O6J A;  4LNP A;  5FU7 B;  3CCV Q;  3V7S A;  2F2X A;  3RKX A;  4JUV A;  2HL5 C;  3SD4 A;  4BY6 C;  5I22 A;  3OA6 A;  1UGS B;  2DL8 A;  8ATC B;  3VKI A;  5GAN f;  2HQH A;  1OYX A;  2HZY A;  4M78 F;  2EQI A;  3KXT A;  2RJD A;  1S72 Q;  3EFO B;  1Y7X A;  3QYG B;  3JCM V;  2LCS A;  1KQS P;  1AZG B;  5LL6 S;  3RMQ A;  3GP8 A;  3IQL A;  2C0I A;  4RCC A;  2QXF A;  4FU6 A;  2HMA A;  2QDL A;  1ACM B;  4A53 A;  3OMG A;  5IN1 A;  1M5Q 1;  1NZ9 A;  5J39 A;  4IUT A;  4HCB A;  4PJL A;  3EFS A;  1VQL T;  2RB6 A;  4C92 F;  5GAN 5;  5GAM f;  1W4S A;  3KBG A;  3EH2 A;  4LDY A;  2LT1 A;  1V29 B;  1PCX A;  4PJO G;  5KH6 A;  4M7D B;  1VQ6 A;  5CKH A;  3CPW P;  1K73 U;  3CCR Q;  4RG8 A;  2E6N A;  2JS2 A;  4LE9 A;  5LJ3 d;  2J6K A;  2BUD A;  1QCN A;  1N5Z A;  1RI0 A;  3U23 A;  2CZ7 B;  2RN8 A;  1VQ8 Q;  2R57 A;  3C12 A;  4ORZ A;  4ELY C;  2DBK A;  4BAC A;  5J3B A;  2XD0 A;  2E5Q A;  4C0D C;  3CPW A;  2CZ0 B;  2LJ0 A;  3UWN A;  3I56 T;  2DPP B;  2E10 A;  2DRM A;  3H0I A;  3QXE B;  2LQ8 A;  3HL8 A;  1A0N B;  2VB6 A;  5HK0 A;  1QKX A;  2WSF E;  4PJM A;  4FL6 A;  1OQK A;  5GAM d;  1SEM A;  3OS5 A;  2JT4 A;  2QQS A;  1VQP T;  4LDW A;  4C0Z A;  2V1Q A;  4Y92 A;  1G3Y A;  2K2V A;  2RO0 A;  2DL7 A;  1QCF A;  4XTZ A;  2EGA A;  2DMO A;  2CS7 A;  2CUD A;  2K3Y A;  2JTM A;  1Y57 A;  3I55 A;  2KBT A;  1Y0M A;  3OYD A;  5GAN 8;  2ESW A;  2F69 A;  1ZBX A;  3S3N A;  3FEO A;  3EAE A;  2XU8 A;  2XK0 A;  4NL3 A;  3ER0 A;  4QQG A;  1WHH A;  1JQQ A;  3O5Z A;  2D8H A;  3SWN A;  4P5N A;  4OMP A;  5EC7 A;  1M1K U;  4LDU A;  1KC8 U;  3OMC A;  3MEV A;  2AIR B;  3PGG A;  3REA B;  4XQ3 A;  3VS5 A;  1Q81 C;  4QVZ A;  1ARK A;  1I4K 1;  5FWB A;  1YI2 A;  4OGC A;  2FB7 A;  3HRT A;  4F7U G;  3NTH A;  2CSI A;  2QK0 A;  2V8K A;  2EW3 A;  4FYY B;  3QJY A;  5GJW B;  1NJI C;  5LJ3 j;  3M4G A;  1Q7Y U;  3FJP A;  4N0A A;  3X24 B;  2MCN A;  1QVG S;  3CCQ T;  5HKC A;  3OS1 A;  3H9N A;  1YHQ T;  2VAS A;  2CH4 W;  1VQ7 T;  2HEQ A;  2NUP A;  2DO3 A;  1VQ6 Q;  3VS2 A;  3JCM X;  1WJS A;  2VWF A;  3X28 B;  1WGS A;  2EYX A;  4Z8A A;  4BDY A;  2HKQ B;  1VQK T;  1G3S A;  1FMK A;  2O4X A;  3RKY A;  2O2O A;  4E7S A;  1WXB A;  2DNU A;  4JZ3 A;  4EMK C;  2M1H A;  2RMO A;  1D3B A;  1E7O A;  1JO8 A;  2H3E B;  1O75 A;  3H0F A;  2WSC E;  4J7F A;  8AT1 B;  1IZ6 A;  5GMK h;  2E41 A;  3QO3 A;  1VQL A;  2FZC B;  1FMV A;  1W2B P;  2PVD B;  2LT4 A;  3M54 A;  1RAD B;  1ZA2 B;  1R8O B;  3A5Z B;  3SEM A;  4XTU A;  1VOM A;  2K9G A;  3HPW A;  3GPL A;  4JRP A;  1Q86 R;  3LGF A;  3JCM b;  2EYZ A;  1CKA A;  2CZ6 B;  3CME Q;  4C5E A;  3GNG A;  3H6Z A;  3AT1 B;  2DL5 A;  2PU9 B;  2NWM A;  1K76 A;  2HKN A;  5GAN h;  3I55 Q;  4XTW A;  1BIA A;  2EQJ A;  5GAO m;  3VS3 A;  3CXC A;  3M0T A;  2LX7 A;  2FPF A;  3FIF A;  3LX7 A;  3I56 A;  2J05 A;  4MZT A;  2KRO A;  4RTY A;  2XMF A;  2DXT A;  3CQT A;  3EGX B;  3BE3 A;  5DLQ E;  2XG8 D;  4ZTJ A;  2DD4 A;  2KT8 A;  3QHS A;  1YIJ Q;  1UE9 A;  2GQV A;  1WX6 A;  2YT6 A;  1UGR B;  2FPE A;  1VQP A;  1Y71 A;  1AWW A;  3EG1 A;  1AWX A;  1MNE A;  2DX1 A;  3OBY A;  5GAM h;  1ZHI A;  4B9X A;  4A4H A;  2DK3 A;  4MZM A;  3N5B B;  2DXB A;  2OTJ T;  4XTV A;  1AZE A;  1WFW A;  4PJO D;  1TOV A;  4M78 E;  3SWN B;  1BI0 A;  1RI9 A;  5LJ5 j;  1SSH A;  3CMA A;  5GMK i;  2E3H A;  5CO7 A;  3DLL A;  3CC2 Q;  3JSC A;  2LC4 A;  4AG1 C;  5FRN A;  2FVU A;  4KUD K;  1HSQ A;  3G71 A;  2KYB A;  4C5G A;  1WDX A;  5L8R E;  4JLG A;  5IXB A;  1AHJ B;  4HA8 A;  1WZO A;  2VC8 A;  4IUV A;  4PJO C;  3RKW A;  1T0J A;  4MML A;  1EIF A;  1UGV A;  4F7U B;  1BCM A;  2LCL A;  4KRT A;  3RUX A;  2RH2 A;  4RCB A;  2CGH A;  1AVZ C;  3LWH A;  1KJW A;  1FXX A;  4LD9 K;  1K8A C;  2NUP B;  2DL3 A;  3FLG A;  1QWE A;  4J5Y A;  2XIC A;  1Q82 C;  1AWO A;  5LJ3 e;  1Q81 R;  2YHT A;  2COZ A;  2D0Q B;  4PJJ A;  4ZGD B;  3H8Z A;  3CCQ A;  3I5R A;  1YHQ A;  1QVP A;  2VXF A;  2O4X B;  1VQ7 A;  2RI5 A;  3INZ A;  1NJI R;  1O9S A;  3CC7 T;  2SRC A;  2QA4 T;  5A2Q E;  1D3B B;  1KQS S;  1RAG B;  4JDS A;  2MK5 A;  1K4U S;  1SRL A;  1FMW A;  2VUB A;  3M0P A;  1KD1 U;  1VQK A;  1BB9 A;  3G4S T;  4M7A D;  5L23 A;  2DD5 A;  2K5F A;  2ZPF B;  3J81 E;  1R0C B;  2YUN A;  1MMA A;  2GF7 A;  4E6R A;  2YUQ A;  5C6S A;  1D1A A;  3UDC A;  3CCU Q;  1NEB A;  1QVF A;  3CCL Q;  2CP0 A;  1EX4 A;  2V8I A;  3OYL A;  3H0H A;  3UF4 A;  1VQN Q;  2BIV A;  3I56 Q;  4DBH A;  1YBY A;  1ABO A;  2A7Y A;  4C8Q C;  5FU6 B;  1UGQ B;  4M7A C;  1NLO C;  1RAH B;  1GRI A;  2LRQ A;  3CPW S;  1MGQ A;  1TXQ A;  4XU2 A;  2KGT A;  4VUB A;  2ROT A;  3QDR B;  3FC3 A;  3LW5 E;  2LQN A;  1EZZ B;  1AEY A;  2CP7 A;  1NJI U;  3GBQ A;  4JPB W;  2AZS A;  2J6F A;  1U5S A;  1QVG A;  4FYW B;  1VUB A;  2DIL A;  3M4Y A;  1WA7 A;  3M9Q A;  4XU0 A;  4OB2 B;  1WXU A;  2HNI A;  1IRX A;  2VKN A;  1GFC A;  3ZL7 C;  2LJ1 A;  4XAX B;  1IHV A;  2X4X A;  5GAO p;  4AG2 C;  1YJW Q;  1X27 A;  4QW2 A;  4II1 A;  1LPL A;  4OB3 B;  3NTI A;  3C94 A;  4CC7 A;  1VQ9 A;  2H8H A;  2D8J A;  4AFQ C;  1JRI A;  3G6E A;  4M75 G;  2RHZ A;  2L3S A;  3OW2 A;  1PSF A;  4BY6 B;  1MHN A;  1QP2 A;  3CCM Q;  4M7D A;  5LJ5 e;  2RI2 A;  3HKS A;  1CSK A;  1LNX A;  5D7U A;  4C0F A;  3GNF B;  3PVL A;  4CC4 B;  2D1X A;  1BKB A;  5A0L A;  2OTL A;  1J3T A;  1LOJ A;  2QAS A;  3EFR A;  4IUU A;  3V8J A;  2ZGW A;  2VXE A;  1PM3 A;  1OEB A;  2PZ1 A;  4J9I A;  3A8L B;  2QGG A;  1VQ7 Q;  3EG9 A;  3T9N A;  1SPK A;  2RA2 A;  1C1A A;  2DJZ A;  2M0Y A;  3M57 A;  3OS2 A;  4D6W A;  1JJ2 A;  3EGU A;  2CKK A;  1KIK A;  4F16 A;  5CKF A;  2YUP A;  4X9C A;  2E4H A;  2GFU A;  2PVG B;  2O88 A;  2RHY A;  2ZPB B;  3UA6 A;  4HVU A;  1BYM A;  1B7T A;  2H3J A;  4C92 C;  4J9H A;  4XU3 A;  5LJ3 g;  4JRI A;  1NE8 A;  1X6B A;  3TSZ A;  2VGM A;  3CBO A;  1PWT A;  3VYH B;  3VS7 A;  4E7I A;  4EMK A;  4DEY A;  1G83 A;  2ROL A;  5KYX A;  3QZ9 B;  2P0K A;  4ZGE B;  1K8A R;  3CC4 A;  5I2S A;  1Q82 R;  4HVV A;  4XK8 E;  5IHI A;  4J9G A;  4PFO A;  2QA4 A;  4OF1 A;  2RJE A;  2OAW A;  1LCK A;  3EH1 A;  2JW4 A;  3PE0 A;  1NPR A;  1G2B A; 
#chains in the Genus database with same CATH homology
 2KBT A;  1Y0M A;  1TG0 A;  2ESW A;  3M0R A;  2EPD A;  1V1C A;  1X43 A;  3TSW A;  3ULR B;  2A28 A;  1B07 A;  1PHT A;  2K6D A;  1JQQ A;  1PKS A;  3O5Z A;  2D8H A;  1XOV A;  3FJ5 A;  2GQI A;  4OMP A;  2LNH B;  2DE0 X;  5EC7 A;  1W6X A;  4OMN A;  1GBR A;  2RQT A;  1W70 A;  2MOX A;  3REA B;  2VVK A;  3VS5 A;  1ARK A;  1PRL C;  5FWB A;  4RTX A;  2JXB A;  2L3P A;  2CSI A;  2ECZ A;  2EW3 A;  1K0X A;  1CKB A;  2KEA A;  1JEG A;  2P4R A;  1GL5 A;  5GJW B;  2JM8 A;  2CH4 A;  2W0Z A;  2LJ3 A;  2KYM A;  2EYW A;  2ABL A;  2MCN A;  2EBP A;  2IIM A;  2V1R A;  3EG2 A;  2CH4 W;  2HEQ A;  4AFZ C;  1M3B A;  1NG2 A;  2FEI A;  1M3C A;  2L0A A;  1QWF A;  4OMO A;  4GLM A;  1I1J A;  3VS2 A;  2K3B A;  4AFS C;  2KXD A;  2VWF A;  1JXO A;  2A36 A;  1NLP C;  2FRW A;  2X3W D;  3RBB B;  1AOJ A;  1NYG A;  1UFF A;  2EYX A;  4Z8A A;  3H41 A;  2BZX A;  2NUZ A;  4Z89 A;  1ZLM A;  2KE9 A;  1FMK A;  3M0S A;  2AKL A;  5I11 A;  1PRM C;  4ESR A;  2O2O A;  1WXB A;  2AK5 A;  1GFD A;  2DNU A;  2MIO A;  1WI7 A;  4JZ3 A;  1YWO A;  2BZ8 A;  2RMO A;  1M3A A;  1S1N A;  1E7O A;  1ZSG A;  1JO8 A;  1U3O A;  2BTT A;  3RNJ A;  3H0F A;  4DEX A;  2O31 A;  2D0N A;  3A98 A;  1YNZ A;  2HCK A;  3M0U A;  4OMQ A;  2M51 A;  1KFZ A;  1UG1 A;  2SEM A;  3LH5 A;  3SEM A;  1UJ0 A;  2EVR A;  2K9G A;  4JZ4 A;  2EYZ A;  2RQU A;  1ZX6 A;  1CKA A;  4RTV A;  2J6O A;  2I0N A;  2DL5 A;  1UHF A;  2CSQ A;  2NWM A;  2LP5 A;  4HVW A;  2EKH A;  1K76 A;  1SRM A;  4JJD A;  3QWX X;  3I35 A;  1K9A A;  2YDL A;  3VS3 A;  1E6H A;  5HCK A;  1I07 A;  3M0T A;  1H92 A;  4IIO A;  2LX7 A;  2FPF A;  1ZBJ A;  2J05 A;  2KRO A;  4RTZ A;  1Z9Z A;  2XMF A;  4RTY A;  2RF0 A;  3CQT A;  3VS1 A;  2DLP A;  2JS0 A;  1NEG A;  1UUE A;  3TVT A;  2C0O A;  2KT8 A;  1UE9 A;  2KRN A;  2DJQ A;  2GNC A;  1OOT A;  1VYT A;  2EGC A;  1WX6 A;  2YT6 A;  4JJC A;  1ABQ A;  1BU1 A;  1YCS B;  2FPE A;  1JXM A;  1W1F A;  1UDL A;  1AWW A;  3M0Q A;  2FRY A;  4F14 A;  3EG1 A;  2KT1 A;  3PVQ A;  1X2Q A;  4HCK A;  1AWX A;  2DA9 A;  2DX1 A;  3SHW A;  1AZE A;  1OPK A;  1WFW A;  1UHC A;  2OI3 A;  3VS6 A;  1PKT A;  1RI9 A;  1SSH A;  3THK A;  1T3S A;  4AG1 C;  2FO0 A;  1HSQ A;  3VRY A;  2CT3 A;  3VRZ A;  5IH2 A;  1MV3 A;  1K0S A;  2DL4 A;  2K2M A;  2KYB A;  2X3X D;  3EHQ A;  1WDX A;  2ED0 A;  2RQV A;  2YUO A;  3QWY A;  1UJY A;  2O9S A;  5IXB A;  4RUG A;  2JM9 A;  2B86 A;  5ECA A;  5FWC A;  1T0J A;  2JMC A;  1Z9Q A;  1UGV A;  2E5K A;  2ENM A;  3EG0 A;  4FSS A;  2RQR A;  2BZY A;  2PNI A;  4KRT A;  4RTW A;  4J9C A;  1OPL A;  3UA7 A;  1AVZ C;  4LN2 A;  1KJW A;  2DM1 A;  1X2K A;  2DL3 A;  1QWE A;  1AWO A;  2EYY A;  1RLQ C;  4J9D A;  2F2W A;  2K79 A;  1WXT A;  4RTT A;  2F2V A;  2HSP A;  2L3Q A;  1QKW A;  2C0T A;  3C0C A;  1H3H A;  4J9B A;  3I5R A;  3KFV A;  5IXF A;  3UAT A;  1X69 A;  2EGE A;  2JTE A;  2SRC A;  1AD5 A;  1M8M A;  1WIE A;  2KNB B;  2DVJ A;  3JV3 A;  1K4U S;  1SRL A;  1ZUU A;  2G6F X;  3M0P A;  2DRK A;  1BB9 A;  1VYV A;  1H8K A;  2DBM A;  2O9V A;  5L23 A;  1QLY A;  2DF6 A;  2FG0 A;  5FW9 A;  2YUN A;  2RQW A;  1BK2 A;  2KRM A;  4E6R A;  2YUQ A;  2AZV A;  1NEB A;  3NMZ C;  1GCQ C;  3VS0 A;  1T0H A;  1RLP C;  1X6G A;  1BBZ A;  2FPD A;  1TUD A;  4RTU A;  3H0H A;  3UF4 A;  1K1Z A;  4R0K A;  4QT7 A;  2RNA A;  1M30 A;  1ABO A;  4J9E A;  2L2P A;  4D8D A;  1NLO C;  2AKK A;  1GCQ A;  1GRI A;  4F17 A;  1FYN A;  1U06 A;  4LUD A;  2KGT A;  2ROT A;  2RPN A;  2GBQ A;  4OML A;  1SHF A;  2J7I A;  1VA7 A;  3R6N A;  4D8K A;  4AFU C;  1RUW A;  2LQN A;  1ZUK A;  1AEY A;  1E6G A;  2LQW A;  3GBQ A;  4JPB W;  4Z88 A;  4ZNX A;  1PNJ A;  2AZS A;  2J6F A;  1U5S A;  2DIL A;  4LNP A;  1WA7 A;  4EIK A;  1WXU A;  2F2X A;  2HDA A;  3NGP A;  2VKN A;  1WYX A;  1UEC A;  1GFC A;  3ZL7 C;  1UTI A;  2LJ1 A;  5I22 A;  2LMJ A;  4J9F A;  1M27 C;  2KRS A;  2DL8 A;  4M4Z A;  1GCP A;  1HD3 A;  1B3Q A;  4AG2 C;  1X27 A;  1I0C A;  1GBQ A;  1KSW A;  1T3L A;  2CRE A;  2EQI A;  4CC7 A;  2H8H A;  2D8J A;  2HBW A;  4AFQ C;  4OMM A;  2J06 A;  2LCS A;  1AZG B;  4HXJ A;  4CC3 A;  2OJ2 A;  2L3S A;  1VYU A;  1SHG A;  3IQL A;  2C0I A;  3NPF A;  4JJB A;  1TUC A;  2QDL A;  2CDT A;  1CSK A;  2GTO A;  3PVL A;  4GBQ A;  2D1X A;  4CC4 B;  2YSQ A;  3VS4 A;  1J3T A;  3EG3 A;  2GTJ A;  4CC2 A;  1AWJ A;  1OEB A;  2PZ1 A;  4J9I A;  4LUE A;  2JMA A;  1SPK A;  3I5S A;  4IIM A;  5GJV B;  2M0Y A;  2JS2 A;  4LE9 A;  3EGU A;  2J6K A;  1KIK A;  4WCI A;  1N5Z A;  4F16 A;  2K7A A;  3REB B;  3EHR A;  4X1V A;  2YUP A;  3U23 A;  2O88 A;  2A37 A;  2RN8 A;  3UA6 A;  4HVU A;  4ORZ A;  2DBK A;  4J9H A;  2CUB A;  4A63 B;  3NHN A;  1X6B A;  1YP5 A;  3TSZ A;  2LJ0 A;  1PWT A;  2DRM A;  2W10 A;  3H0I A;  3VS7 A;  2KR3 A;  2A08 A;  4K11 A;  2DYB A;  5IHK A;  4DEY A;  2CT4 A;  1IO6 A;  1A0N B;  1G83 A;  2ROL A;  2LZ6 B;  1EFN A;  2ED1 A;  1QKX A;  1SEM A;  2PTK A;  1ZUY A;  1JU5 C;  2JT4 A;  1MV0 B;  3I9Q A;  2GGR A;  1HJD A;  4HVV A;  2V1Q A;  4Y92 A;  1NM7 A;  1OV3 A;  5IHI A;  1WLP B;  4J9G A;  1YWP A;  5IHN A;  2DL7 A;  1QCF A;  1YN8 A;  1MUZ A;  2DMO A;  2EGA A;  2OAW A;  2CUD A;  1LCK A;  2KXC A;  2JW4 A;  3PE0 A;  1Y57 A;  1G2B A;  1NYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...