2A0WA

Structure of human purine nucleoside phosphorylase h257g mutant
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANGEEVLAAGKQAAQKLEQFVSILMASIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neighboring group participation in the transition state of human purine nucleoside phosphorylase.
pubmed doi rcsb
molecule keywords Purine nucleoside phosphorylase
molecule tags Transferase
source organism Homo sapiens
total genus 85
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a0wA00
3MMSA 5F7XA 5ETJA 4MCHA 1JE0A 3OZCA 1RT9A 1G2OA 4BN0A 4L5YA 1V4NA 3NM4A 5CXQA 5F76A 3LA8A 4LZWA 1LX7A 1RR6A 1PK9A 5JPCA 5B7GA 1LVUA 1RFGE 4PR3A 5IFKA 1YR3A 4TTAA 3KVRA 4F3CA 3BL6A 1RYZA 1SD2A 4JOSA 4DAEA 4YMLA 1T8YA 4L0MA 4NS1A 3P0EA 5KB3A 1JDVA 3LGSA 5DK6A 3FAZA 1U1CA 1U1EA 3OZEA 4M1EA 1OVGA 1SQ6A 1V3QE 1T0UA 4E1VA 5B7PA 1PK7A 1VHWA 2ON6A 4G8JA 1YQUA 3DPSA 1Z38A 1JPVA 1B8NA 1A9QA 1ECPA 3IEXA 3GB9A 1RSZA 2I4TA 1Z35A 4NSNA 3PNSA 2OC9A 1V48A 1JYSA 4M7WA 4OGLA 3MB8A 4DABA 1RCTE 1PW7A 2A0XA 4D8YA 2A8YA 1Y6RA 4I2VA 1Y1SA 1Z33A 4QAQA 3OZBA 1M73E 2I8AA 4TS3A 5EPUA 4TS9A 1NC1A 1TCUA 4QEZA 5CCEA 1TGYA 1A9PA 1TD1A 1YBFA 2QTTA 1RXYA 3BGSA 1ZOSA 1Y1TA 3PHCA 1YRYE 3DF9A 1A9OA 3BJEA 4D9HA 1SD1A 1CG6A 2OC4A 4LDNA 4OGKA 1PKEA 1C3XA 2Q7OE 1K3FA 3INYA 1U1FA 3EUFA 2QTGA 1Y6QA 5IU6A 4YO8A 1OUMA 4DA0A 3PHBE 1U1DA 2HN9A 1T8WA 4EB8A 3NM5A 1JP7A 4TTIA 4GLJA 1XE3A 2B94A 3UT6A 3UAVA 2OXFA 3NM6B 3K8QA 4L5AA 3D1VA 5F7JA 2AI3A 1JDTA 4TXLA 1T8RA 1ODJA 5F78A 2OECA 4DA6A 4MCIA 4K6OA 4LNAA 4TXMA 1CB0A 3BSFA 1Z5PA 3PNPA 1A9SA 1SJ9A 3IOMA 1ODIA 3KU4A 1Z5NA 3OOHA 4U2KA 4EARA 5CCDA 2AC7A 1OV6A 4MARA 2PGAA 2HWUA 1I80A 4F2WA 3C74A 1Y1QA 2HSWA 4OY3A 3KUKA 1K9SA 3O6VA 4TTJA 4DA7A 2QPLA 3FB1A 3LBAA 3UAXA 3EUEA 4D98A 4QATA 5B7NA 1A9TA 3FNQA 4G41A 4TYMA 1PR4A 1PR5A 3ONVA 3E0QA 1JDSA 2IQ5A 1T8SA 1V41E 1YQQA 4NY1A 3E9RA 1V45E 3UAZA 1V2HE 3OOEA 4DA8A 1FXUA 4OEHA 5F77A 1JE1A 4D8VA 1JDUA 1PF7E 3ENZA 3FUCA 5C80A 5CXSA 5B7QA 3FOWA 4JWTA 2XRFA 1PR1A 3KHSA 5I3CA 3QPBA 1NW4A 1OTYA 3OCCA 4F2PA 4M3NA 4OF4A 3T94A 3DJFA 1K27A 3UAWA 1LV8A 4BMYA 4F3KA 3F8WA 5F7ZA 3KVVA 3O4VA 4OJTA 4DANA 4TXHA 5CYFA 3FWPA 4H1TA 4RJ2A 4BMXA 1PWYE 4YJKA 4QARA 5EFOA 3NBQA 1WTAA 1ODLA 1PBNA 4FFSA 2HRDA 4WKBA 4ECEA 4YNBA 2H8GA 3E9ZA 2GUWA 1OU4A 4PNPA 1Z36A 4WKNA 1A69A 2AI1A 3OPVA 1VHJA 2QSUA 4R2XA 2BSXA 2AI2A 4QFBA 1OTXA 3GGSA 2RJ3A 1A9RA 4DARA 4BMZA 1Z39A 4UC0A 1TCVA 5F7OA 4X24A 1JDZA 4P54A 4L5CA 3DP9A 1PR0A 3ODGA 4WKCA 4L6IA 3EMVA 4IP0A 1TGVA 5EUBA 1RXCA 4G89A 1NC3A 4WKPA 1ODKA 1VFNA 4DAOA 1PR6A 1Z5OA 2A0WA 5CYGA 1ZL2A 4F1WA 4D8XA 1U1GA 4R31A 3U40A 4QASA 3UAYA 3KVYA 1Z34A 4KN5A 5FAKA 5F73A 4GLFA 4WKOA 2QDKA 3SCZA 1Q1GA 2P4SA 1VMKA 3OF3A 5K1ZA 1ULAA 1ULBA 1Y1RA 4TXJA 4JP5A 4TXNA 2A0YA 4R2WA 1Z37A 3EEIA 4LNHA 4GMHA 4GKAA 1QE5A 3DDOA 3TL6A 1N3IA 1B8OA 1RXSA 3K8OE 2ISCA 3P0FA 1PR2A 1RXUA 3OZDA 4LKRA
chains in the Genus database with same CATH superfamily
3O1IC 4B71A 2ZRIA 3CRRA 3EC7A 1QF7A 3C2QA 1AV6A 3A4MA 2EX4A 4WCFB 2PYIA 2FP3A 5I8WA 3DC7A 5DXFA 4LF4B 4Y2HA 5GTDA 3P94A 4PSDA 2ZE5A 3MM4A 5T3YA 3SG0A 2WMYA 5HZKA 3GAAA 4MYRA 4ZEOA 4JP1A 4L5YA 2IYZA 1OX4A 3FGNA 4U7DA 4BWFB 4B4WA 1X0XA 4IDPA 1DKRA 5JLJA 2RGNA 4YRAA 4KFCA 1Q0QA 4GMFA 3NM4A 1R8QA 3MVEA 5DCUA 4ZEWA 1EXNA 3RS0A 1F48A 3F78A 1A27A 3VGJA 4P3NA 2OXCA 3O83A 2Y1XA 5EWLA 5KX5B 1UPCA 1L7PA 3TPCA 2NV0A 4PZZA 5T64A 2H48A 3F3KA 4EUHA 2HIMA 5JIBA 1XRMA 4EG6A 1EJ2A 2GVDC 5BVHA 1DV2A 2GVZC 4JROA 4QGGA 4LFBB 4KPEC 2JCBA 3Q3JB 1KVQA 4BX0A 1HO3A 1SXJE 3WSWA 3ZOKA 1E2FA 4EFDA 3SZGA 1T8YA 1PX0A 3ZV7A 1RKBA 2FK8A 1KKUA 1T2CA 3QOFA 4L15A 3I05A 4H35A 1L1FA 1WZ2A 1FSSA 3UHOA 1TZCA 3K96A 1NT2A 3A14A 5EJFA 3BIWA 3H5RA 4M83A 2UYGA 4PQGA 3T61A 2WDZA 3OE4A 3QVOA 4F2HA 1YTUA 3D0KA 2M98A 2ZTMA 3DXXA 4XQGA 1DT3A 3RSZA 5HJ2A 2DULA 1DXYA 3BH6A 1C41A 3I8SA 1EK0A 2V6IA 3ORSA 3QK7A 3ILVA 5C8VA 2ZI9A 4XYBA 1QP4A 4P33A 1S2LA 4JLDA 4YBZA 3RS7A 2OZPA 4KSYA 1ZKDA 4E1VA 4DZRA 1XGKA 3TCNA 4FYIA 5IT5A 3MEQA 4HRXA 2LTAA 4NYMR 4V0SA 2B1JA 2FSHA 1UM9A 3CCCA 3ZK9A 4KX3A 1ONBA 3STVA 5E6RB 5ITVA 1Y89A 5M5BA 1CRQA 4MO2A 2CMHA 4B34A 3U5TA 1PFVA 3GV0A 4M36A 4HX2A 4L08A 4M60A 2IV3A 1EGAA 4UHFA 2WKQA 3HZHA 1P3JA 2PWYA 1MT0A 1ZM2A 2Q9CA 2RARA 2C7PA 1ADBA 1L5HB 2YWHA 2NU8A 4A10A 4E5YA 3WWCA 4OL9A 2NP7A 2OORC 1KL7A 4HMQA 4UQPA 2ZGVA 3JQPA 2I4RA 4MOWA 3FFWA 5MFPA 3UK2A 4BIMA 3WLEA 4AQYB 4ND1A 3UJBA 1E6MA 1N6NA 2KI5A 1EEHA 3H5LA 2JFGA 3C41J 4PX9A 4YDSA 3GBSA 1JHVA 1NQUA 2G8LA 2OC9A 3MYRA 3MTAA 4RD2A 5A0FA 2WTBA 4EF6A 3T99A 2J46A 1T3SA 4OGLA 4NBSA 4YONB 4G81A 2OB2A 1LKZA 2C2KA 3G9TA 3NTRA 3PNLA 3QEMB 4WY2A 1HQYE 2BKVA 5D7BA 4UTNA 1IOWA 2A0XA 5CVCA 3V1MA 1BO6A 3BA1A 2XRYA 2AX4A 4Z0PA 1TM7E 3DE2X 1XLUA 3ZE8A 2F2TA 4JAVC 4NG4A 5E4FA 3AJAA 4TMYA 4WESB 5DCYA 4EI2A 4AKSA 2OBMA 3QYAA 2NO4A 3R5JA 4QXPA 1A9PA 3PGJA 3LUCA 4ZOCA 1JEOA 4I5IA 2G4CA 5LA6F 2G70A 1TTQB 1WXXA 1BU5A 2AH5A 3ADPA 4NBUA 4U39A 2JGMA 3QY9A 3TB6A 4DDTA 5JBIA 3KFLA 1WIWA 5E7MA 1RWPA 1SBYA 1U7WA 3E2IA 2VP4A 1DDGA 3L7LA 4M1WA 5LZ4A 2ZQYA 1FFCA 2B35A 5K5EA 1W93A 1NF3A 1OXUA 4YQZA 5H1YA 4MUAA 2WA1A 4JB3A 4V3CA 1G4AE 1ZH0A 5A7HA 3RYCB 1Y8QA 2QJFA 4JI2B 4R8VA 1FFGA 1TZMA 4A6EA 4K86A 4PPFA 4GOJA 3TFQA 1BHJA 4TRNA 2NYAA 3W06A 3LT4A 3DS8A 3GLGE 1O94D 1KI6B 3JWPA 4EZEA 4DBLE 1QTNA 4ZYLA 3HVRA 4CEHA 1CKEA 3FFXA 1LDBA 4KO1S 5AICA 3N75A 3WLOA 1Y6QA 3U2QA 1WKVA 1UODA 1C9MA 3CV3A 5JSYA 4Q3KA 1RTTA 3WAKA 1B3RA 1DCKA 1T1SA 2PANA 3G2PA 4FX2A 1FP6A 3V34A 1KAOA 2JLBA 4E21A 1Z29A 3OESA 1TRHA 5BPHA 3OZUA 3U61B 2R8EA 3TTSA 2FPSA 4Q6BA 5BOSB 3VSEA 1XTIA 3EY9A 4QOIA 1CZHA 4FXPA 5FBKA 2XUFA 3EPLA 3DVRX 5LR6A 3NGLA 5TQVA 3E7XA 1H2EA 3WJ1A 5HM6A 4NP6A 5GIOE 1IXYA 3IUQA 1AO3A 1YC2A 3PLAE 1VBNA 1HDXA 3I9FA 5ERXA 3KQQA 2CBZA 2UV8A 2ZS9A 4M9CA 3LOPA 3IDZA 3W5BA 3PDWA 3QFTA 1ZCZA 5G41A 4DWWA 1N1DA 3JARA 1P75A 4CDNA 4YASA 4QFCA 3VMFA 3TMAA 2K7ZA 2JIRA 1G9XA 1ZN2A 3X1YA 3LPAA 3WWZA 4HI0E 2G9NA 2HJWA 1T8RA 3N59A 2HHAA 2LXNA 3ZW7A 3A2KA 2DUUA 2C31A 3WLJA 5A1TA 4BUJA 4XD7D 3UT0A 4UZSA 5CA1B 4UJ3A 1P6XA 3LF2A 1TKRA 5K8LA 2V59A 4IDQA 1GV0A 4U7WA 4M8LA 4MRVA 1QWSA 5FI0B 4UD2A 1LZLA 5DGTA 5BMOA 1ZCJA 4GOOD 4DMKA 3OHSX 1E2UA 1U9IC 4OVKA 3V4VB 4R3WA 2GXSA 4L27A 4OTZA 3REQB 5DRYA 2J33A 5EHNA 3C5WP 1GZUA 4WZBB 2P9ZA 1SXIA 2VVTA 1KP9A 3HBJA 4S1PA 5F78A 1BW9A 1J56A 5H5JA 5IDQA 2FR1A 3B2QA 3BZUA 4PF1A 4D92A 3DHWC 5B5SA 4TYYA 2N9UA 2E3JA 1VSBA 5I9LA 4MYHA 4B2PA 1RWVA 4UUBA 3UPTA 2IUTA 2RMKA 2VHQA 2J3IA 3MCAA 1BRMA 1CBUA 5JCJD 3E18A 2P11A 3WP0A 2Z3ZA 5HJEA 4XX1A 4ARZB 1WS6A 1WXFA 3OO0A 3E8XA 2F3QA 4TT3A 5LL6P 1EFDN 1GCOA 4WA8A 3W2FA 4CGYA 3L7MA 4IIDA 2Q4BA 3CW8X 5DEOA 1DL5A 3IODA 3H3XA 3OEHD 3TZHA 4GPD1 4BMDA 5DTIA 3FPCA 3P2MA 1Z6YA 2UUAB 1A7UA 3PT9A 1Q0LA 4A1FA 3CLTC 3JQFA 3DAPA 4XJTA 2AKEA 1R8SA 5K6RA 3C3EA 5D3QA 1VYUA 3PIIA 1QIIA 2BKXA 2FR8A 2X8BA 1NPYA 3HU1A 4EDFA 1DX9A 2XA1A 1B93A 2P2GA 3CT4A 4BQPA 1ZUHA 1ZINA 1K9SA 2HQ1A 5ALFA 1MHTA 3EPHA 1U3DA 3A3PA 2CLOB 2W8BB 3G5LA 1YI1A 3SIPA 2YXBA 3N70A 2IYQA 2XXBA 4TTJA 4EKDA 4H1HA 5LQNA 2ZB8A 1INLA 2L69A 2HOQA 1C30A 3DBRA 3ZIUA 3ZJ5A 4DC9A 1IMOA 1M2HA 2VHWA 3BHMA 1JQLB 3DMTC 3JQDA 4OQPA 1DTWB 1NURA 3B3GA 1Y34E 4M0EA 2KLBA 1ENZA 3DT6A 4UCXA 3H9CA 1KZYC 1ORVA 2GPAA 1KETA 2ZP1A 4Y9TA 4UDYX 4B3TB 3AUSA 4FOLA 1H6CA 1QH8A 2ZTHA 1O9GA 1Z0UA 1RC1A 3IV9A 4UM5A 1H2XA 3FUUA 5EXTA 2FG7C 4HNRA 4YMIA 1V16A 2GEVA 4YRRA 4CDRA 5KX5A 1MO4A 4PHHA 1V1JA 5M04A 1KOJA 1APBA 3GNSA 3ZTWA 3E3OA 2X22A 4P7JA 2EZ9A 4KN8A 4B43A 4RC9A 2MYPA 2XZDA 4U00A 5GOTA 4ZKEA 4PR0A 2FFHA 1EYZA 2NZJA 3RASA 4DIDA 1P3Y1 2QYOA 3FUVA 1HURA 3KT6A 2BGNA 5CK4A 1QLJA 4HADA 3ESRA 9ABPA 2BKLA 1QHXA 5IWAB 1XIVA 3TAHA 3EA4A 1ZK3A 4WLEA 5DM0A 4GWLA 3W7VA 4D96A 5ISMA 2IUEA 2J1LA 1USWA 1UMDB 1P9RA 1UWKA 4O4IB 1TYDE 5F35A 3J81A 4P7FA 4AG3A 3MJTA 5H4HA 1D2AA 3VPCA 1TKAA 3GLHE 3PQFA 1YDMA 4ZPJA 4FJ1A 1NNI1 1GPJA 2ODQA 2ZKLA 3PZBA 1Z5ZA 3A9RA 3IA2A 1RRPA 2X0FA 4BMYA 5LVAA 1KAEA 1M67A 4G5QA 1MBZA 3KHKA 1O4VA 4NDZA 1ZISA 1VRVA 3OQVA 3QA9A 4BNJA 1P6QA 1VQ1A 2HIAA 3KQWA 4F4FA 3TOZA 3PXAA 1E2BA 3E7WA 2VPTA 4R9RA 3HXTA 2F8TA 5JZ9A 3BEOA 2PL9A 1IN6A 5E6RA 5GPBA 2ORED 1DC4A 1SUSA 5JZVA 5B37A 1CX9B 3MIZA 4JLNA 3TXYA 4D57A 2UYQA 4CV1A 2C92A 5YASA 3NANA 4UHKA 4BTLA 1JJAA 1L1RA 3LFHA 1PL8A 1K68A 4DWJA 1JIVA 2VCYA 1GNPA 3ACBA 4JK3A 1I4DD 1ZRMA 1U99A 3I61A 2GUWA 3PD7A 1T2UA 2YZNA 1QIEA 4Q01A 2OHOA 1OLSB 1WZNA 2VRBA 1B7GO 2G4VA 3P9XA 1T3TA 4RK0A 3GR6A 2F1JA 3N0TA 1M1YE 3AV3A 3A10A 4BJ5A 1U4SA 4BNDB 1JSZA 4JLSA 2IXDA 1UBGA 5DIFA 3B9QA 4BN5A 1JA9A 4FE3A 3TZCA 1EAYA 4EB3A 2A30A 2NUPB 1U0JA 1O6FA 1KJYA 3TBKA 3DL4A 2PSSA 2QX6A 2VHVA 3O2NA 3QEMA 4KJZA 4PPYA 1DDOA 1C1DB 2QTLA 4LQCA 4DWVA 5CVEA 2VWQA 4QXAA 3WFZA 3EAGA 3AUUA 1YO6A 4BBAA 4PAQA 4WESA 3JTMA 4MS1A 4FFPA 1BFDA 3PR3A 1IK4A 1SQGA 2P41A 1JDJA 2I3AA 2YOFA 3JZFA 1VYTA 1D0IA 3KG2A 3OX3A 5ERGB 4Z49A 2O1SA 1JXAA 4GHWA 4PYQA 5TX7A 1T34A 3OTHA 3PGXA 3SKVA 1O54A 4LHEA 4PHTA 4E13A 1ZIOA 4CIYA 5GZ1A 1XNQB 1JG2A 1HORA 1PUXA 4EY4A 4RFVA 3IERA 4GRAA 1AKRA 5KIAA 1OZAA 5SY4A 4OIFA 5FL7D 1GGFA 2JJQA 2VHTA 2VPIA 4AXBA 2IJGX 4HH0A 3WA6A 2H0QA 4F72A 1DIRA 3H2SA 2SECE 2JD2A 3D81A 1C8LA 1A8QA 1DKLA 4RKRA 4YJGB 4KR9A 4DV0B 4FHZA 1RTKA 2RHOA 3IUMA 2CVOA 2QYSA 3C7TA 4MWEA 1OFHA 1TGVA 3ABOB 3LIPA 1OPRA 4ZPXA 5FPHA 4ZCLA 4F2DA 2Y1DA 1OT3A 1G18A 5JO9A 1BNCA 2I33A 1KI6A 4LAFA 1H4SA 3QVUA 2R8PA 1TL7C 4JI1B 5CDUA 3F1LA 4PXSA 4RGVA 4LC0A 3FVTA 4UXHA 2CVQA 5C5IA 1P5JA 1G19A 4GMKA 1OPXA 1QVWA 1WQ4A 2AN5A 2JBAA 2OQIA 4W5HA 3NWOA 4AQDA 1LF0A 6CHYA 3R75A 5I7SA 1U1GA 1HDRA 3KHTA 3NHWA 5KJEA 5H8WA 2IA5A 2V7WA 1MABB 4FE7A 3RSFA 5BOSA 1EFHA 2VZEA 2VJMA 1EDDA 1ESZA 2XLCA 3DTTA 3QW2A 1ZBQA 5PNTA 3WNVA 1K66A 3H99A 4GZLA 4LKOA 1YZFA 4UPVA 5EZQA 5GQSA 4DTIA 2AZMA 1EMDA 2HMUA 5B64A 4JJZA 1JG7A 5H0IA 4LYEA 5CBPA 1KQNA 1NR1A 2C9YA 5B55A 3LHFA 5C7IO 3ZTTA 2DLNA 4H2DA 2Z8XA 4U63A 1QHEA 1E2IA 2BFWA 3SHOA 3BBPA 3F4KA 3DXYA 3OF3A 4HGRA 3C3BA 3S2YA 4PWYA 1DE0A 5IARA 4HEJA 2X58A 2ZJ4A 3WAGA 3KIPA 3IT3A 1LD3A 3X2FA 2HCBA 2BMFA 2JK1A 3GCDA 1HRKA 2GD1O 4P0TA 1D5WA 3I64A 1UXKA 5CA1A 3UV3A 3TWOA 4Y6LA 1P3DA 4LSZA 2RAPA 3I9V6 5COQA 2OOSA 4EATA 5F2KA 4JHXA 5JZSA 2JHGA 4KNYA 4C0JA 4DNPA 1JR6A 4YDQA 4QPCA 3AHGA 5JW6A 4HZGA 3KZCA 4D9NA 4FMPA 3ZWKA 3REQA 1EUYA 4XIFA 3VZBA 2ECKA 1U3UA 2D0DA 4MJ7A 1YFZA 4WZBA 4AVYA 2O8FB 1N6OA 1ORIA 1GUZA 5F5XA 3L3BA 3R24A 3G8AA 4DQKA 3IVGA 3IUBA 5CB4B 3M5PA 4DUPA 3STXA 4Z54A 5A9SA 3O38A 3WNZA 1NR7A 4Z5XA 3ZWBA 4AF8A 4G0YA 1I1HA 1W2GA 4JT9A 4X64B 4KC0A 3L1IA 4AN1A 4DIFA 4PZ9A 5C5EA 1KXJA 3COPA 4GC5A 1OZGA 2OEPA 3E5NA 3AFHA 1EP1B 5A04A 5G3ZA 4ARZA 4ZVSA 5F76A 3ROZA 3P2YA 5EJEA 3D3WB 5JECA 5JPCA 4V0ME 4Z99A 4BVEA 4FKBA 3C16C 1G5IA 1C9JA 2VRCD 5K4GA 4YUVA 1FS6A 1PL0A 1I6KA 1YHYA 2F3PA 3C1OA 4PR3A 4PYKA 3RHZA 4KPFC 5KOJA 1W59A 4G26A 4BLSA 4UBIA 3S8MA 3VNSA 4E15A 1FFYA 1FZTA 4OX9B 3C3MA 3OZWA 5SYAA 1T0IA 4ZA2A 2Q21A 3G8YA 4UM8B 5D85A 2QN3A 1G5QA 3T6KA 2EWMA 4BGDA 4MJXA 2NGRA 5ALKA 4NZMA 2MSNA 2HFJA 4P7GA 2Y92A 1T5TA 2I66A 2OD9A 4MW4A 3ZEAA 2JFVA 1BFKA 1RCUA 1XMQB 1HYGA 5IKMA 3ZI7A 1XVLA 1CY2A 1Z2CA 2H3EA 2ZCUA 3LL7A 2Q2OA 3V97A 2Y2UA 1AGYA 3HJUA 2OPBA 1RABA 1YI0A 3GEHA 1DTWA 4YCBA 3V7NA 3IHWA 1GEGA 4X20B 3UUEA 2FQ1A 2GPBA 3DFZA 3DR5A 3DZHA 2PUBA 2I3ZA 1GGEA 1PSWA 4MV6A 3VHRA 3A6ZA 4C08A 3LYLA 4QPNA 3A6DA 4WDQA 5I7HA 1YRWA 1TADA 1R64A 1XZNA 2FPOA 5EEHA 4KKVA 4GMXA 3W34A 2ZUCA 3V42A 1O57A 4M55A 2WG0A 4R98A 1DFHA 2B30A 3H7IA 3RVSA 2FZ5A 1DXOA 2OZLB 1I8TA 1ZG3A 1EFPB 1TDJA 3PXEA 3NTLA 4FOTA 3TJRA 3RUAA 4N76A 4Q18A 3I9V1 3CT6A 1YB6A 2Y4NA 1RWWA 4GICA 5DX1A 1F51E 2QTRA 2P69A 2WJ3A 3WOHA 5AW6A 2X4LA 4F45A 2P35A 2PUWA 1LQTA 1Z0IA 3CQ9A 5TARA 2D1YA 4QUBA 1SVMA 2O23A 2X1VA 2ZDGA 2QUJA 1SU7A 3EEQA 4CIXA 4PQRA 3LCJA 4ZK6A 1AUVA 3L8YA 4TWBA 1VL5A 2PTHA 1Y3DE 4GMDA 1Z35A 4DSTA 1QH0A 1X74A 2XUKA 8AT1A 1W34A 3GJZA 2XNDA 3NYWA 2R8OA 1SCIA 2ZETA 2HK8A 4K40A 4OHCA 2NU7A 5LP6C 1KNQA 1UMDA 3OU6A 4IQ0A 1LDMA 2D0IA 1IZ8A 2XZOA 4Q39A 1LDGA 1JRLA 2YNMD 4O2LA 2FKAA 3D4OA 3E1GA 3TCXB 3WL3A 2E5WA 4BNUA 4IIHA 1Z15A 3IUYA 3VMMA 2Q0XA 1P7PA 3H86A 4IHJF 1G8SA 1UBHS 1ZIDA 2ZWPA 3HGTA 5AHXA 4E88A 4F60A 1PG0A 3RAEC 4R0VA 4F4IA 3A04A 3K2BA 1TUGA 2H5JA 4TTTS 3R8XA 1ZSNA 1OYWA 1Q0UA 1PYGA 4Y2SA 1B16A 2NQ8A 1YBAA 2EQBA 2EZUA 4UXJA 2RH4A 1GM5A 4S1TA 2QW0X 4DLBA 3JYOA 5TB5A 4LE1A 4LJ7A 5K3EA 1PS8A 3UFXB 4BFZA 2V7GA 3KJFA 2C03A 2O8CB 4R3NA 1SZDA 3PNYA 1KVUA 4AJPA 1E59A 2C5EA 1E98A 2V7BA 3TTYA 1XRLA 4GSYA 3LE8A 3BC1A 5CXUA 3GLFE 1JV2B 2FUG1 3KR2A 1YIOA 1QIKA 1NR5A 1T9HA 2IOQA 2DQYA 2Y0BA 3KLPX 4C4SA 6REQB 1T5LA 3OBBA 1O6GA 4JGBA 4PG8A 5EHXA 2Q2VA 5JSUA 1OLSA 1WLYA 2KM1A 4DYVA 4CJXA 1FX0B 1RAAA 1YS6A 4MQFB 1RPZA 2WNIA 4Q24A 4BNDA 2A7XA 2JCVA 3FHCB 5CBPB 1HEIA 3GBPA 4B0OA 1AKTA 2H2DA 3EYWA 1WJGA 1H93A 2NUPA 3OD1A 1II8A 1HGXA 3U62A 4C0HA 4BEBA 5CG2A 4ZVRA 2Y68A 2IWRA 1T8WA 1C1DA 2YN0A 5EJ4A 1GDDA 2I2FA 2ZUVA 2E4YA 3QUSA 3STYA 4YUYA 1SVSA 2VNIA 2ATXA 4MVJE 4MW9A 3V46A 1MQAA 4FI3C 2EEPA 4Q21A 2G36A 1JP7A 2ZVQX 3RSLA 1L5QA 1XLTA 4L0QA 2PMWB 3P9SA 1DRWA 4XYGA 2C58A 2X23A 3H5TA 2FOIA 5CH5A 3QPWA 3V7FA 3RKSA 3IQZA 3VR6D 2G77B 2XH8A 4JJ8A 3ROKA 2HXSA 2I65A 2ZUDA 4PGFA 3IT2A 4EA6A 2XE8A 4CE6A 3RS8A 2AJTA 2HWWA 4AX8A 2O6LA 1MLDA 3OCWA 1SG9A 2XMGA 5FI3A 4XSHA 2FF5A 3DJYA 4MJLA 5IBCA 2V96A 3D1VA 4IUBS 4X9XA 4IEIA 2ODPA 3DKIA 4YJGA 2AI3A 1G8JA 3GFQA 5DHRA 5DNDA 2CLEB 4JJEA 2V6BA 1DMSA 4KRXA 4REQB 4YAOA 2P78A 1QOPB 2R8ZA 3HQ4O 3KELA 2D4AA 3OFKA 2YCLA 4CT0A 1YKFA 5DYIA 3EXG1 4LTMA 3AIMA 4LNAA 2GETA 4COKA 2AOTA 2FZCA 3UF0A 3IKTA 4X1OA 2O3QA 5ECDA 3UWSA 1CUCA 1I4WA 3ICVA 3A05A 5DX0A 2XMPA 4XKJA 4L3OA 2I71A 5B3KA 1P5RA 1KI4A 5ELXA 1T5DX 4HEA6 3FSGD 1JFTA 1BA3A 1VCOA 3A6HA 2A3NA 1A9SA 2VDJA 1ORWA 1AKNA 2NZXA 4HFMA 2QPTA 2H92A 2IYVA 5G02A 3KJGA 4KE8A 3VZSA 4YRZA 2GTHA 4KMSA 4XTCS 3WIOA 4UZFA 4ZQCB 1WXQA 1X1RA 4YN3A 4CN9A 1I7SB 5K0JA 4NONA 2DFNA 4F5ZA 4FGUA 3V33A 1PI3A 1ML3A 1ULUA 4HCJA 5C32A 2OGZA 2YJTD 4N7BA 3CPJB 2MIIA 5L8VA 5LMUB 4KREA 4IEFB 3LUFA 2DQSA 4NE2A 1JA1A 2PV7A 4OH7A 1YJ8A 2INGX 4QYWA 4DCVA 4Z4CA 2H7YA 2TSYB 2NNWB 1CR6A 2CUNA 3JTEA 4LYGA 3W5JA 3U7FB 1WZUA 3AFNA 4PZ0A 1J7KA 5ADUS 5CDSA 1IZ9A 4BZWA 3FG9A 3N6RA 3ND6A 5LPNA 2OVFA 3D0RA 2WSLA 1ZJ5A 1O94A 2Z9BA 2P40A 3FDZB 3MJHA 1QYIA 1U5BB 1WEHA 3PJDA 1DCTA 2BZSA 2ROQA 4R8KA 3LQ4A 1BC5A 3WNCA 5LOVF 4EFLA 2ZYWX 4YIHA 1BJRE 2FUEA 1QGUB 4KPGA 2V7XA 1QRSA 4JL5A 1JTFA 2QUZA 3C6KA 1SAYA 4HUJA 3DEFA 5JPDA 1G1MA 2R44A 3CMCO 2BJVA 3RREA 4G9BA 3C0KA 3L05A 4OSPA 2VAVA 1GYQA 4OP3A 4GP6A 3D64A 4OQZA 5B1EA 1ODCA 3R3JA 4CV2A 1XTKA 4FKZA 3CC8A 3W8RA 2VQ6A 3C3AA 3BMCB 3TLKA 3ZWMA 5LNK6 2QX4A 3OHMA 4DRZA 3UCFA 4IXNA 4DW8A 4EO9A 4QATA 4O63O 4ZO8A 5NULA 1CJBA 2IZ7A 5FOQA 5B7NA 1PWEA 1OZ0A 1TT7A 3CEMA 5A1JA 5CB4A 1E4EB 2FE1A 2IW3A 5E1OA 4I66A 4CV0A 4A36A 4PWZA 4LV5B 2B7CA 3VHLB 1HE2A 4NCKA 1SKAA 2YH2A 1TMYA 3AOEA 4MZDA 2ODWA 4U7FA 4CF4A 3H8VA 1PNQA 2EG5A 4AW9A 4M53A 3FPSA 1M83A 5EG5A 4GYKA 3SIXA 1Y81A 1C1XB 1XZGA 1OFIA 4OV6B 2PZ8A 4YRPA 3D3WA 3BGIA 4MB0A 3KTDA 4V2UA 1MQSA 2ZSFA 3JVVA 4YJHB 1I2ZA 4XD7A 1U2QA 3M6FA 2BJWA 2I7VA 4IIYA 3UGKA 3AINA 1NQWA 1BAPA 3IEKA 4ND2A 1U8ZA 2OPHA 3U49A 1P45A 2M2IA 3G0CA 1R15A 2RGRA 2PXAA 2WSIA 4MWGA 4Y0AA 2ZM6B 2JRLA 4LY3A 1XR3A 1J9EA 2GK7A 3HCPA 4WXEA 2G04A 2B1RA 1I9CA 3OJCA 1JKXA 3JZDA 1IUPA 1BCRB 2QLLA 2Z4RA 2P7IA 1H6BA 5IS2A 4DDKA 1O7JA 3L7YA 1PR1A 3W4JA 2H5LA 2NUAA 4RPCA 4OB7A 4GDMA 5KNCD 1HDZA 3AM4A 2IIVA 1FDTA 1UDAA 4E11A 1COWD 2V8OA 4IGAA 4YY3B 3U60B 4YP7A 3P96A 4HS9A 1M0TA 5FA6A 3QOWA 2ODBA 1A98A 4EJ6A 4X20A 5JCJA 2R3SA 1Y80A 2H85A 4TRRA 3QLVA 4ZFNA 5AK5A 1UP7A 3M33A 5M34A 1JAXA 5HX7A 4K46A 3TPFA 1JVNA 1UANA 2RHLA 3GJ3A 5HIJA 2Q41A 3B60A 4XDGA 8GPBA 3FWPA 2F4NA 2MR5A 1R66A 3GP5A 2W6ZA 4D4HA 3RFUA 4KQEA 1JH8A 4EPVA 5CNIA 1KBOA 4EY7A 3RFTA 1QYCA 3OEHA 1EDBA 4ZCMA 1X80B 2OZLA 1LDYA 1U5AA 4B0PA 2ACWA 3E15A 1HT3A 3C8MA 3ZJ4A 2BFNA 1SCUB 1ZK4A 3L41A 2Z1NA 3H9UA 3QUQA 3S6JA 4DADA 1E96A 4MQ6A 4D9GA 4RL6A 5IKXA 5D7NA 2O5EA 2WB4A 4EW1A 2DBYA 4MUYA 3UC9A 5HBRA 5C7YA 1QHSA 2HZBA 1A76A 4O59O 2J6HA 2DY0A 3IJRA 1ICIA 3TH5A 2Q4RA 4B8ZA 3SKXA 4QIHA 1MAWA 5J5CA 4HXEB 4EX7A 5AM5A 1I4TD 1UPAA 1E6KA 3I9NA 4AL4A 1FTNA 1A69A 2GZDA 4GPBA 3WSVA 2EQ5A 1QO0D 2XX3A 3PDIB 2A9VA 2H1IA 1VL8A 3G7NA 4HWGA 5FBLB 3B1FA 3CZMA 4ML3A 1Y6FA 4EO7A 4UUOA 4S05A 1MOZA 3PC7A 2OCBA 1J00A 1E4YA 3BFPA 3P9PA 1MQ9A 4J9UE 1DWOA 1JBEA 1ZPDA 2FMKA 3MGAA 1F8UA 1MXHA 2AZDA 4BEVA 3G5MA 4D9JA 4E03A 3ROPA 2O8DA 2RIRA 4Z4FA 1UBLS 4IVNA 3UC5A 3NYRA 5G0TA 4B5KA 1NBMD 3T5CA 5B57C 2CDAA 1TCVA 3D8SA 4X24A 4BQSA 3T15A 4D80A 3CYFA 1GZDA 2WF5A 2D59A 1W5SA 3K72B 5AVQA 2PMBA 4OQFA 4ZK2A 1OLUB 3IEMA 1B6TA 4X1KB 2OBYA 4CRWB 3LF1A 3PJRA 1D0SA 2C9OA 1V8BA 1U8UA 1PQPA 2R4UA 3UFXA 4IS3A 1W52X 2ZB2A 2ZPUA 5GINE 3BQ9A 3C5HA 1WU7A 2AJDA 2VXBA 4B4VA 3RS9A 5K99A 2OBLA 3RJ9A 3K05A 3LT5A 5AXAA 1PTKA 1XRQA 5IVDA 3WGYA 3PTLA 4DLTA 6REQA 3HDQA 4G89A 4DRXB 2Z2XA 4PTLA 3HVJA 5EMHA 4X6LA 5KREA 1O97D 1LCIA 4BMNA 3TZ6A 1FX0A 4MQFA 2GF9A 4LK2A 3RB8A 4G56A 2PKQO 3NIBA 4BMPB 1REQB 1JECA 1PW5A 1XTZA 3CS3A 2ZAMA 2IUFA 2YMLA 3DNFA 3EVCA 2I6SA 3MTQA 4E6EA 2CYAA 1MFZA 1DC7A 2ZFUA 1Z75A 4Q7MB 4Z0NA 1Y9EA 3BWXA 4C6TA 2EHDA 1TAUA 2O4UX 3NEAA 1EAMA 1WPGA 5HE8A 2X3UA 1D0VA 3N2EA 1NN1A 2J0UA 1S6YA 1GAEO 4FEEA 3VR4H 4BHTA 5LD2B 1J39A 1YZVA 1P0QA 4ERNA 1HDYA 4PPQA 2ECPA 3VJLA 4RTOA 2CEKA 2OSVA 1NKSA 3HDGA 4BO9A 1XJ5A 2IVFA 4ZCSA 2IUSA 3KKPA 4LYHA 1T8UA 4MRNA 3SVLA 3MTJA 4KBGA 2B78A 3TOVA 2HQSA 4YJFB 2IYOA 4ZDWA 1KZ1A 4YUAA 4RK6A 4ALMA 4AUMA 1LWOA 1AV7A 9LDBA 4H7DA 1IZZA 3L8CA 1X7GA 1I3MA 3DKPA 1F5NA 2PNFA 1JU4A 4JP5A 4TMTA 4TVBA 2IPOA 2AHRA 2WK1A 4REMA 1ZD5A 1QORA 1RBYA 3S29A 5BVGB 4RQUA 4AP6A 2AMFA 1SM4A 3B89A 4FEAA 4FUQA 4G63A 4LJ4A 4DREA 1GJRA 3D7LA 3ZY5A 3IIEA 1W25A 1OXKB 1Y3AA 2I76A 5BSEA 1XVAA 2QD4A 2XE7A 4DIMA 2WA2A 4BQRA 1Z2AA 1UC4B 2YINC 1G60A 1FTYA 2AG5A 3DV0B 1KYYA 3SE7A 1N3IA 1EG7A 2W43A 4NXNB 1G21E 4BFTA 5C5CA 4KWIA 3ISTA 1LI4A 3DAHA 1U65A 1B41A 1LPSA 3CISA 3W05A 3G9ZA 3GAZA 1YHNA 2CFIA 2I4IA 2OV8A 4W9NA 1J0DA 2VPPA 3AB8A 4NL4H 3SC6A 5IKEA 4QELA 2QTVB 3IIJA 3QW4B 1LPPA 4DY6A 2HSGA 4EL5A 2ZRJA 4UARA 3O9ZA 4P7BA 3ROFA 2JLUA 2DGDA 4S0ZA 2DMRA 3OPXA 3TDKA 4G6ZA 4BQNA 3FTPA 3ET5A 1QX4A 2J6CA 1ORRA 1SXJD 1OFGA 3EY4A 4GKBA 5CA0F 2CVFA 2ZR8A 1SRQA 3CRVA 2JIMA 4K26A 3CNEA 5FL7A 3SMVA 3HNOA 4M46A 1ODTC 2IQIA 1PVDA 1S7CA 3JW8A 4AKIA 1LX7A 4WXMA 5AJUA 3EZFA 1RQPA 1ZUWA 1K6MA 1M2OB 2V3VA 3UHFA 2JC3A 3VUFA 1NX6A 3E7FA 3TDNA 2XY4A 2AG1A 2C84A 1LVUA 3RFXA 4DE5A 1I7LA 3FDZA 5NLLA 3A06A 4W9NC 2CJXA 2XYVA 3AB7A 3TIFA 1W36B 1G6KA 1X1AA 1Y98A 1JIUA 3DV2A 1QGUA 2XVAA 4Q4AA 2OYSA 5ALEA 4O29A 2RGEA 3W77A 2EBHX 3O31A 1IXZA 1RWMA 1P73A 1THMA 3R4CA 3UJ6A 3NO4A 4ZQIA 2D74A 5U4QA 3WXMA 3MWLA 4E08A 3G0GA 4KWHA 4V0QA 2Q7XA 1PFYA 3RADC 1SUIA 3G2QA 1WSAA 5BNFA 4CHGA 4H4CA 1CSEE 3SFTA 1TCAA 3QEAZ 2WWHA 1YZHA 1NHGA 2Q0HA 3BMCA 4BV3A 4KMMA 5A3SA 1XZ8A 2Z98A 2E4VA 5AW8A 5I4BA 3HZOA 3RC9A 3KDSE 4BO7A 1FRNA 3SM9A 4YRCA 4FB5A 4ZYYA 5EFZA 5E9AA 3DL2A 2C7VA 3S1AA 4CODB 1UFOA 1YQGA 1H4TA 3ZX4A 1A2OA 2R97A 1N34B 3HWSA 4A0QA 3O8NA 1NF9A 1PK7A 1T91A 5FV7A 4J91A 1Q74A 3H97A 2TMGA 2A2ZA 2RC5A 2A88A 3B12A 1T3LA 1RYMA 1PSZA 4FS8A 2X3YA 2BFEB 3HV2A 4IHQA 2VRNA 5CVJA 4LFAB 1Z17A 1D8AA 4UPEA 5JS1A 1Z6QA 4HNVA 3QBVA 4RCYA 5T41A 1ISSA 5LKAA 4FHGA 3O74A 3DYBA 3MW8A 4WY8A 3WMFA 3ESBA 1ECPA 5DNAA 3A3KA 3AEQB 3ZZMA 1N5OX 1IN8A 3Q1LA 1XZEA 4QJ4A 3SXUB 2PSHA 2IFTA 3CKLA 4WT7A 4HNTA 1HNXB 1GAWA 2XWQA 3FWKA 1MO3A 1PJ3A 4UTXA 1G8HA 3E3AA 4OO3A 3TB4A 1BCRA 3GA0A 4ARVA 4IJ6A 3HDVA 2GUGA 3L92A 2R7LA 4ND8B 1G9TA 4NJOA 5ARCA 3UGJA 5EUQB 1P80A 1C14A 2R68A 4P38A 1CD5A 3RSGA 3WMWA 2G06A 4LF9B 2CLHB 4HNSA 2Z5FA 3AX6A 3ODPA 4ZYZA 5J3JA 1XZCA 1ZGHA 1RJGA 3PU6A 5IJ0B 3MC1A 5EPUA 4C5AA 2HQBA 4LF8B 1YUNA 3L0IB 1FDIA 1XZMA 1X38A 4C6HA 1E1RD 4G0VA 3R7FA 2BHRA 3ADOA 4OATA 1WCWA 1XBTA 3H5VA 4BU1A 1N7GA 3QJ5A 2VPXA 4PTZA 2VRCA 5C1IA 1GZ7A 2QDXA 3RUPA 2IYFA 3VTAA 1B15A 4ZICA 1H5UA 4N18A 3V8RA 4TTSA 2A5JA 5FULA 1FLVA 1SCUA 3A9VA 3CFYA 1R0SA 1L4EA 3CCFA 3A0UA 5COBA 4UTOA 3CRW1 3ZCQA 1U2SA 1NVKA 3FNFA 4BECA 1U0NA 4QUGA 4MQ5A 3GCGA 3ONDA 4RPKA 2G40A 4ZYXA 1R0WA 4F97A 5K6TA 3T06B 1L7DA 3EVAA 4K9QA 5AW1A 3T9FA 5IT4A 3AERB 2REBA 3GGCA 2UXBB 1ENOA 3FPHA 2BZ0A 4L75A 2R7AA 2AJ8A 4IRUB 1NM5A 3PDIA 1RIIA 2BGRA 1Z0DA 1XB2A 4CLHA 3I9OA 2OHFA 3P9RA 4EENA 3O26A 3R7AA 1E1YA 3TM5A 1LPMA 3FWZA 3MJSA 5PGMA 4BNYA 2ZIZA 2PSEA 2VHZA 3GGPA 3W3AH 1L9XA 3D8HA 2ZG6A 4MYUA 1ZD3A 4I1YA 2BYTA 4ILEA 1BDIA 4Z3KA 1A50B 2BGLA 2ZWOA 2ZT5A 3L7JA 1G6HA 3DOCA 5ALUA 5EJ7A 1RZRD 5DT9A 3DM9B 3PC4A 4N5IX 5H3LA 1ZA1A 2H2HA 4TTIA 2EFCB 4GAEA 4YJ3B 4D9BA 2AXQA 4GPTA 2PX4A 2DLCX 1JAYA 4Q4DA 2B94A 3FROA 1FP7A 4LHYA 2JIOA 1KA9H 2AJCA 3NDIA 4YJDA 3SGLA 1QFSA 2YMPA 1C3VA 1OLUA 4X1KA 3RVJA 3K9NA 2IY9A 4QG3A 1Y4SA 1VGRA 3EBLA 2QW1A 4TGLA 5EXDA 2QJOA 3ZHZA 5FQNA 2I8CA 1NVEA 2DPGA 3JAWB 2ENUA 4CUKA 2C77A 2XCQA 1KHHA 3FMPB 5EZ6B 3FPFA 2AG0A 2YDXA 5ALLA 3F6EX 3F1KA 1ZN8A 2VTBA 3KOZA 4JL6A 2EQAA 5JCPA 1J49A 1D4ZA 1Z28A 2RE8A 1I3OA 4OJYA 3VV3A 1VTKA 1HOTA 1QDLB 2YNMA 3AM5A 4JMLA 4B33A 4C4XA 3GPLA 1Y6GA 3GO4A 4GBED 4RK1A 4E2FA 1YUBA 4KTVE 1ETUA 3I1JA 4XTRA 4HJRA 4P3YA 2ADOA 2I9PA 4MRMB 2PX8A 4N5LA 3B1VA 3UJ9A 4F04A 5AOCA 4IZHA 3TPZA 2GCPA 1J33A 1G55A 1BKSB 1BYIA 2VNJA 4D8TA 5B6JA 2QL9A 2DTEA 1UIRA 3QEKA 1U31A 3LP5A 3T9CA 3UW3A 1ZIXA 3VZCA 5J2TF 1DAIA 3LBFA 3SXPA 1F12A 5C81A 4LECA 3OZAA 4FSDA 1ZHFA 4CGZA 4I4CA 2GN6A 3K0KA 1OASA 4J29A 4YJFA 1D6NA 3TRKA 2CNBA 4J2TA 2QR2A 2RD2A 5KKNB 1YB4A 3KALA 1XWWA 1Z63A 3KXDA 2NWQA 4PO8A 1I7QB 2AUNA 3BZBA 2RGGA 3KVOA 4TMVA 1DT5A 2O1EA 3MAGA 3RROA 5IDWA 3BE8A 3O0DA 5ELMA 1FOEB 2NZUG 4D8UA 5JLAA 2IEYA 4QYIA 1E5QA 5BVGA 1MGPA 1DIBA 1WUJS 3BF8A 4RMJA 3NHAA 3D1LA 3HCAA 4B2YA 1I36A 1PHPA 4IIBA 1YZQA 4EHKA 5J4VA 4B7UA 4A0FA 2HYDA 1KFBB 4QJ3A 4MB2A 1N9GB 1VL2A 3A4LA 3UK0A 7ADHA 1UBJS 1USUA 4FQ8A 4QSHA 4IMRA 2AF4C 1Q5PA 3PI6A 4MGHA 3R74A 1GUAA 1GQQA 4XIYA 4DPKA 3KKLA 2QTVA 1ZL0A 1A9TA 3DAYA 2H17A 4G41A 3VR6A 4HAXA 1WXEA 3L4BC 4TYMA 2W2NA 3E9NA 3RBXA 5EIHA 4JUBA 1Z25A 3DEAA 5FUWA 4JLUA 4B2LA 4LVOA 4BTEA 1X9GA 3OJOA 5I7VA 4N82A 2ZRFA 3GFRA 4PZYA 4YMWA 1Y1LA 2P0YA 4PSCA 2XUJA 4RLQA 3V4RA 5J4YA 1RU3A 3PRKE 3RWOA 4YV2A 1N0WA 2EKZA 1T13A 5K0SA 1CB7A 1JTVA 1SVNA 1PJRA 2AOUB 3BH0A 4X90A 1SUPA 1TQ6A 2H4XA 3V00A 1UKAA 3JYPA 1NMXA 3GAMA 2CL6X 5EY5B 3T7TA 3AP2A 4LSWA 4H7FA 2CMDA 2Z2YA 4DA8A 2HRRA 2Y9PB 1JZQA 5ICCA 5F77A 5WRFA 1SBZA 3FSGA 1N3BA 1Q15A 1PWXA 4R9UC 3ZHQA 1N7IA 2ZIXB 2O20A 4M7RA 3Q2IA 4X1IB 2QG6A 4DJAA 2IEZA 2VJYA 4LWZA 3OICA 5EHZA 5CNJA 3KKOA 3I6MA 5IJXA 2VP3A 3VNQA 2Q6OA 5HM8A 1J0CA 4QGAA 3SVZA 1LNSA 4KFSA 4DR1B 1PS0A 1Z47A 2RH8A 4TRMA 1SXJB 2P2NA 4RZXA 1CDZA 2XHZA 3UT5B 5JYDA 2W6ID 2ECOA 2C4HA 2HLHA 4QDOA 2B83A 3CVVA 1OXMA 1ZCFA 4OHWA 2OTCA 3NNDA 2WKPA 3E05A 5JVDA 3I37X 2Z04A 1V9CA 1V3VA 4AZWA 1K0UA 2X0RA 4KE7A 2AG8A 3Q7PA 1QGYA 2P75A 3AFIA 3JYQA 4IOJA 5E1MA 2DUWA 3VVMA 3S7ZA 4DMGA 3MBOA 5HCIA 2YIJA 4Q9HA 4QLBA 2CZQA 4GOLD 2BFEA 3G7UA 3IILA 1PYDA 1L5LA 1FPMA 3S28A 2PHZA 3I3OA 4C87A 3H9JA 4F6RB 1S3SA 2GHTA 3EXHC 1JZTA 1FFAA 3L1UA 2BBOA 1QHHB 2V5AA 4NF2A 4ECEA 1YZNA 1Q57A 2E18A 2VUSA 3AEQA 4F9TA 3SXUA 2V9ZA 4RH3A 1PNRA 5J5AA 5IVHA 1QP0A 4HOYA 1GY8A 1NI5A 2FV8A 1U8FO 1I2MA 2AI1A 2CLLB 3SEQA 4BZZA 3MS7A 5HRAA 5EE0A 4ARAA 4ND8A 3SS7X 1G7CA 4ZCPA 3LP8A 5ESWA 5LWQA 3BGWA 3DDZX 3R0IA 1KYXA 1H2FA 1T2FA 2XNJA 3TVYA 1XZIA 4AJLA 4V1CI 4YHBA 3T0IA 2AI2A 4IKOA 4TROA 5A5DA 1OAOA 5ALMA 5KTOA 3A1DA 3OFJA 4Q66C 4WNIA 5KYYB 4K6CA 2FPIB 2QL7A 3R0JA 5DHSA 3SHVA 4A0GA 5MN5A 3LLUA 4Y9RA 3FBWA 3RHSA 1Y8RB 1EXVA 4OOEA 2VDRB 3P2EA 5AKEA 1UMKA 5LLSA 1GD1O 1RXWA 2XUIA 4MIKA 4F38A 1BD4A 4FGLA 1IJFA 3O1JC 3BREA 1P9NA 3KDAA 1P2DA 3Q3GE 1VMIA 4QBTA 3P45A 4WWHA 3ZVRA 4ZTUB 2C2OA 4UBMA 2CXXA 4D9CA 5JAHA 1MA3A 1C4KA 1CZKA 1Z6TA 4D9EA 2HHHB 1OW3B 2CLMB 1N4AA 4WXYB 2VAXA 4M9UA 4MVJM 3OVMA 1ZMOA 2GK4A 1G64A 1JSCA 3GJ0A 4JNCA 4B82A 2XKKA 1TECE 3CPSA 3NGXA 1OU0A 4TSRA 1I10A 2V4MA 4R2MA 3TN7A 3EGOA 5H59A 3FFBA 1RXCA 4ER0A 2PH3A 1M2FA 4B32A 5ITSA 1T5HX 4MPTA 5F5LA 4BDSA 4P6VF 4P0PB 2OZVA 5T67A 1QAQA 3ZZ0A 3C24A 5KNCA 2V5VA 1H5NA 1QSGA 4GZ6A 1COWA 4N0QA 2WZDA 1Y4ZA 2FEXA 4L02A 5CYGA 2E21A 4UUPA 3NIDB 5ESDA 1X1BA 1FU7A 4QEDA 4MQEB 2AIRA 3HSYA 4KO2S 2BF7A 2BFDB 5BNIA 5CH8A 5KNLA 1HTWA 5BUCA 2ZQZA 1FSZA 4PX3A 5CM2Z 4X93A 4UEWA 4RXMA 2XEDA 2RJNA 1L7QA 5FKJA 3GLGB 1NXTA 1T25A 1ZO8A 4H6PA 1PHRA 2HWYA 3AR7A 3LDGA 1VI5A 4S1OA 3D6JA 1UXJA 4NPAA 4DV3B 4CG1A 3KVYA 4JSYA 4X1YB 3WB0A 2WTXA 3SR0A 1GAXA 1RKQA 1E58A 1MOQA 2XUGA 4YJ3A 4BIIA 3V4SA 4UAJA 1VHTA 4NEQA 4O1HA 3H1EA 4IDEA 4RD4A 5GONF 3A6LA 4LK3A 3RCBA 2ACVA 2GKSA 3L8MA 1YZUA 1NWCA 2FW8A 3PV0A 4R8LA 3VAYA 1N0VC 1AXGA 4XPZA 1Q1GA 3JQQA 2B2CA 2PZBA 1NA5A 1I33A 3ORHA 1DBPA 3V8VA 1U3TA 1MPTA 3TINA 1GGNA 1LDEA 5DHAA 3ENKA 5IDXA 3LZ6A 2J9RA 4FB4A 1Q7GA 3NAQA 4BNGA 3PNMA 3JAWA 2GX6A 3K71B 1NJ5A 1GTJ1 2AMLA 1C9EA 2IPXA 2O2HA 2I6FA 4ZRNA 5FFMA 4LJ6A 3NH6A 4LVNA 4NVRA 1SZCA 2NU9B 1QO0A 4U9HS 1R4NB 2DWUA 2JZNA 2PO7A 3EQ8A 5FAXA 2FTKE 4PVCA 4IJMA 2X9LA 4OJKA 2CD7A 5K3BA 5DB4A 1XAJA 3HMQA 3FCEA 2BDEA 2FN3A 3ABZA 4FD3A 1WPXA 1WCXA 4QD3A 3IKMB 1JEYB 3LECA 3GK3A 5JS2A 4MAAA 1V39A 1X87A 1JFLA 1NBMA 2D5BA 1EK5A 1GFSA 1G4UR 3K0BA 4KO8A 4MRMA 4NCIA 5CFNA 3EAQA 4PCVA 4Q1VA 4F11A 1I30A 4YUWA 3VYRB 4DNOA 5EL0A 4B74A 1L5YA 1D2NA 1WG8A 3A8TA 2XGJA 5EQDA 1FMFA 1U7OA 4C7OB 2VC2B 3UMJA 2AUMA 421PA 3CHYA 1DVRA 2G07A 2FRXA 4Z9YA 3IIIA 1ATZA 4X8OA 1VSUA 4IGEA 3MQ2A 1OH8A 4HUQB 2FPGB 3CGWA 3QEJA 4G4GA 4AY2A 4RVNA 1G63A 1LK7A 3KWMA 5CDFE 3OZFA 1JR3D 3SJUA 3IQXA 2OAP1 5JDCA 3LW7A 1MEEA 2DPYA 2JFYA 2YICA 5KHOC 1IBKB 4Q1EA 2Z5GA 1E9RA 4EOGA 1JXQA 3S2IA 1FFDA 2A59A 2OWDA 3KVRA 2XHEA 1K7EB 2AYZA 4EDHA 1Q84A 1QRRA 5IN5A 3K92A 1NMYA 4LW8A 4EVQA 3FMVA 2CKMA 2XCUA 4GM1A 1KARA 4DAEA 5JAPA 4TLMB 5HP4A 4LF7B 1Q1AA 5CJJA 2XKBA 4R01A 4EG7A 4CKBB 2GBPA 2YJNA 1SPXA 4L6AA 2PBLA 4OD0A 3UTCA 4ETNA 3DMRA 3NDJA 4Q9KA 3PTZA 4YHHB 3KB1A 4DM4A 2E37A 5EIBD 3S2SA 5KJFA 4MEJA 1P5HA 2YZGA 4IXMA 3STHA 2GILA 3NHUA 1JVSA 4QHTA 4DLNA 1QOZA 3S2ZA 3DOHA 3TCKA 2HHCA 1I3CA 2D0OB 5JAIA 7REQB 5K01A 1UKZA 3DE0X 1HMPA 5HF8A 3CR8A 3QUAA 4YRDA 5A4JA 1XG5A 1A8UA 3UH1A 4DQDA 4OQNA 1ND5A 2UDPA 3RRFA 4J4BA 2X6QA 2YRFA 1W19A 3GLQA 1YAHA 2GWHA 3WXBA 4TWIA 3HJHA 3PQ4A 4KQXA 3IPXA 3SFZA 3L1HA 3L77A 2C9DA 2I7TA 3H7AA 3VDRA 4A73A 2G25A 5IAAA 2QUAA 2XCRB 3TSYA 4W4TA 1RJEA 5JNVA 1TK2A 1YQUA 4AS1A 5CXSA 3RKRA 2ZBPA 2AOUA 4BJ1A 5MDHA 2B8EA 2CGEA 5GZ3A 3MT8A 3DB1A 5HTOA 1CEYA 4PHCA 5T7BA 2YXPX 3VR5D 3MK31 4HLUA 4INPA 2JCXA 3U37A 1CNEA 3FRIA 4JMPA 1EVJA 2WT9A 4UZEA 4EHHA 3PXCX 1N9KA 4P5PA 5HS4A 3FZNA 1XXLA 2V6FA 1SUWA 4RTKA 4ROSA 2RI1A 2ZIXA 4JBGA 1BOOA 5HKOA 1UMBB 4X1IA 2RHMA 3HH8A 3JY6A 3NBFA 1W49A 2Z2JA 1V48A 3HPRA 1CZOA 2Q8NA 1VC2A 4A6DA 4BFLA 3T1QA 1QVRA 1T0JB 5DLQC 1ZUD1 3Q88A 1X1EA 2LCIA 1JQBA 1JUDA 1PW7A 3FPEA 4GI7A 4D8YA 2KX7A 1SXJA 3D7KA 4YA6A 2VT3A 2Z1DA 3UT5A 3QIVA 3E27A 1RHQA 3RVPA 1YL5A 3ECCA 4QDKA 3UJ3X 3NG1A 3OPMA 3VOSA 4BBPA 4W5NA 3NOXA 1L7OA 4CLOB 3R5FA 2QY6A 2C3YA 1QZ3A 1TD1A 1TMOA 4S0XA 1IG3A 3T1VA 4A27A 1P44A 3FZEA 2FN8A 2R6AA 1GUDA 1SHTX 3A25A 3O4HA 1SIWA 4WCFC 2WB2A 2C3MA 5AXBA 5IBRA 1CY8A 4X85A 5E0OA 1M6VB 1ZGGA 4XUGB 5CITA 2VJPA 3WQRA 4AN0A 4ZJPA 4Q00A 4NJEB 2EGUA 2YWJA 1P0IA 3INTA 4Q3CA 1XSEA 1PT9A 1ZWKA 3KOWA 3L7KA 4IDNA 4TTRA 3SAJA 4MVJD 1PZEA 3JWHA 5BQ5A 2JFHA 4BC1A 1QHHA 2E4AA 1C9KA 5K0EA 2R2GA 4N3CA 3HKEB 2CYCA 2UKDA 1NBIA 2VP0A 3C3YA 2W2XA 2VBIA 3B1YA 3INYA 3PUKA 1I5OA 1FC0A 3AI2A 4GX2A 1JIXA 4AKTA 1QXSA 4PLTA 5KVAA 3TEJA 4JLBA 1B0PA 3GFVA 2C4VA 2HQRA 2RGBA 2Y0PA 3MOGA 3IVMA 2X5NA 1TF7A 3F4BA 3KZOA 3L7AA 4LVCA 1UF9A 2JK0A 3QIAA 4EQ6B 1R18A 1XV5A 3QI7A 4NYJR 3DOUA 4TV9B 1HZZC 4YTEA 3O4FA 1UP4A 2IEGA 4M9RA 4EEZA 3DHVA 1GZ3A 4CLEA 5IZ4A 4M1QA 1M1YB 1RE0A 2DFTA 2DZDA 3LBHA 4MGEA 4QT0A 2FPIA 3I5UA 4HATA 3C7DB 4QRIA 5EIAA 4CIDA 2QG9A 2X5OA 1I94B 2P62A 3T3IA 1NXOA 1BJTA 3NEPX 4ICIA 5A4MS 3NWBA 3FPLA 1QFYA 2C7GA 1YTLA 1ST3A 2I6GA 4HWKA 4JEIA 2DB3A 1V6SA 1G8YA 3BJZA 4HAYA 1BVRA 2YXDA 3PQDA 4QUKA 5DULA 1HNWB 4I5EA 3UAVA 1VPLA 5THXA 4BU0A 1WUHS 3TW4A 3TLBA 4MTLA 2CJWB 2OXFA 4YCLA 1R0KA 3IO5A 3AG5A 4OAPA 5LB2A 9MHTA 1G20E 5C3UA 2AN1A 2X40A 3HUDA 4LDRA 3RQSA 4NBRA 2NAPA 2PIDA 1W96A 1IUOA 3D8UA 1MT3A 2K4MA 1WXDA 4X45A 5EA2A 2IYAA 5ALNA 4MCIA 1EG2A 2GDZA 4UDNA 3D43A 2GZMA 2XT6A 5JATA 2NOAA 2WIFA 2X9QA 1ZMRA 3HCWA 1LW6E 3FGZA 1UZAA 2XAAA 3F49S 8ADHA 3NU1A 4CQMD 1P8JA 1VMAA 1IBLB 5CHYA 1EXWA 3DBVO 4AJNA 5JD5A 3WX0A 2C82A 3S68A 4MQEA 1JJFA 4GKVA 3DWEX 3EC2A 3EFHA 1YRBA 5LQSA 4XX0B 1N2XA 2PVPA 1ODFA 1FK8A 3LH5A 1KVRA 3JATA 4FW9A 4KQWA 3ZC3A 4CF5A 5EZSA 3HJTA 1FXWA 2XYHA 2RKBA 1WUKS 1E8NA 4O4HB 2ZYIA 1JVBA 4OP1A 2IP4A 3GLGA 3UK7A 2DBVO 4UVDA 1JIQA 3WS7A 4B4OA 1YDGA 4PG4A 4BVFA 4N1AA 1ECFA 2I62A 5SY6A 4HDCA 1IIRA 3SF0A 3G0OA 3MHTA 2QR3A 3IYLW 4X1YA 1NMZA 3PFHA 4G1VA 4ND7A 4YRQA 5IXSA 3GJ4A 3WVNA 2QTCA 1IMJA 1QG2A 2IRWA 2Q5EA 1LQUA 2Y27A 3IBCA 3JV7A 4UBJA 2N3ZA 2Y1FA 3CKYA 1IBCA 3J7AC 2AC4A 3UBMA 2R1VB 3TTWA 2X5KO 4WNYA 3GRUA 3ELYA 3N07A 1IU9A 2RBKA 3PXDA 3BWEA 4GX1A 4LJSA 1ZRSA 5CJ2A 2IIPA 3KFXA 3ESDA 5HUJA 4POOA 3BVPA 3L6OO 2B4RO 4PN3A 3R2JA 2R6CA 1XJQA 1CRZA 1XKLA 2NPIA 5T4EA 4D3XA 3RBAA 4FI3F 1Y0BA 1UM8A 4A8TA 4IVRA 4DBLC 1VKRA 1AX9A 4GI3A 2ONYA 1ULZA 4H4EA 3TQHA 2NU9A 3EZLA 3EX7C 1R4NA 2PK3A 5E2IA 4C2AA 3JRNA 4CV3A 4AWXA 1OT5A 3WA7A 1VMDA 4RYLA 5F3RA 2KMLA 2BWJA 4DR5B 4AB1A 4IO0A 5DN9A 3U6KA 5GJBA 3C98A 3ROEA 1FQKA 2CHUA 1PJ2A 3FETA 3OLYA 5TLSA 1JEYA 4RTQA 4BMSA 1RZRA 2Q1XA 3HG7A 3FTNA 2J0VA 3FB1A 3ZIAD 3WSTA 2C54A 4ENVA 2JAHA 2QRPA 3IALA 4ITUA 4ZU1X 5LXTB 2BZGA 1FRFS 1XEFA 3ZE0B 4NNOA 2CWWA 5T57A 4EECA 3H04A 4CQLB 3RHTA 2QUIA 3GXOA 1JMVA 1WZIA 3X1JA 2V7TA 2F1IA 5KYUB 1DFGA 1KC1A 3SZUA 3D8BA 4HUQA 2FPGA 4DQVA 4G5YA 4V3BA 1E2GA 1NQOA 2X2PA 3PCXA 3CLHA 2WU0A 3TGWA 4UTPA 1WE2A 4Y6OA 3W9SA 1U3VA 1L1EA 2GHQA 2EFGA 2FFQA 4PYMA 4JEUA 1QQBA 2DTDA 4K0KB 3K6JA 4MSUA 2X0JA 3ESXA 4U0KA 4HTFB 2ILVA 3MCUA 1O6ZA 5G4LA 2DWQA 3GW8A 3SE0A 1LC3A 2QEQA 1E1NA 1YS4A 4TMKA 3GDFA 1AG9A 1L8XA 4JITA 1NJGA 2QROA 5K51A 3BMXA 4P4UA 3RG2A 4D6PA 3ROTA 5ALDA 4D8VA 5FH9A 1JDUA 2IW1A 2H1LA 2WMDA 5JSQA 3IP7A 1IHYA 1U90A 5HKLA 3T1OA 2QTHA 5HQJA 4M8IA 1G5TA 1SCJA 4M9ZA 2NSJA 4AKGA 1A3CA 5KYGA 2J6IA 3PFFA 1ZMBA 3UWPA 1NVTA 1ZRNA 1T24A 3K9CA 3COYA 5DSTA 4NENB 3K30A 3V55A 1WBJB 1XDUA 4K28A 2JFUA 4Y7CA 3UG7A 3WNDA 1KWKA 3K0AB 2H4WA 3OQ6A 4RKWA 5CB0A 1XCBA 3ICPA 5IPFA 1T9KA 3W90A 3JYNA 1C9YA 3X1XA 5F7ZA 1BDMA 3GFOA 5FTKA 4WBSA 3F6PA 2L0XA 2ASVA 3NORA 4D9KA 2BDUA 4RWZA 4TLBA 3KXLA 3L4SO 4HN9A 1R7RA 4F3RA 5AHKA 1Q2XA 1ZZGA 3DTVB 3G2LA 4PM4A 3VNUA 1I0LA 1EWVA 2ZAOA 1H0RA 2AN9A 4M0PA 3KWFA 5BRNA 3TLYA 4RK5A 3AI7A 3MT9A 4D0SA 4MK4A 2FW9A 4NCHA 4OU5A 3W5AA 3B36A 3MGCA 4LCBA 3QEBZ 3AOGA 1OBCA 1Z9BA 2JW5A 1OQAA 4HP8A 3FXAA 3NB0A 4OBWA 4EMTA 2G9VA 5JSZB 1Y82A 3KUUA 4HYYA 4XVQA 1ZNWA 2VWHA 1XDGA 3UYKA 1N4DA 3F3MA 1KJIA 3KKEA 1KYIA 4HVTA 4JBXA 4MIOA 4J43A 4JI6B 3OPYI 5TT1A 1P5FA 1GTVA 4NJMB 1XMVA 5A2GA 3I2HA 3OQIB 1PFWA 1OU4A 2NZ2A 3EGIA 3PKZA 4KKXB 2D6FA 2HMTA 2LDBA 2WOOA 1VBKA 1UMBA 5D51S 4BB0A 1NQ5A 1U81A 5HKKD 1UWCA 1FP2A 2FG6C 4QGBA 3KK0A 2EATA 2YMMA 1R16A 1G17A 5BQFA 5DTJA 3KSZO 3KJNA 4F84A 3PYLA 5JI3E 2RHTA 2G83A 4LEIA 2IZ6A 3N2GB 3NJ8A 3QFCA 4BS9A 1V43A 1KYTA 2O5VA 4QFBA 3L49A 5ITZB 2AQHA 4N03A 3DP7A 3JAKB 3R6LA 1G41A 2IDMA 4HLNA 5FTNA 3TD6A 3V1YA 3WK5A 4MIEA 5LMCA 3I92A 4DL9A 4CLOA 3DZDA 3L7CA 2Z2ZA 4LF5B 2H5IA 1TYEB 1JG3A 1AY0A 1JXMA 1ZLXA 4L9SA 4BVJA 3ED5A 2WZBA 4PRKA 4KFUA 3T3DA 3ICCA 4L4RA 4RKEA 2MSLA 2P9CA 2VYND 3GUHA 4PANA 3NALA 3BERA 4MGZR 3NOVA 1Z4LA 3T95A 2JHFA 2NIPA 2OP1A 1AB5A 2QI9F 2VXYA 4WCDA 3DUFB 3DV9A 4NJEA 5EPOA 3NNSA 4BQQA 4N3GA 4NMLA 1R3UA 3U5ZB 5BUQA 3PGA1 1OY1A 4NZOA 4PAWA 4E4RA 4NU0A 5EUBA 3MMZA 2QT1A 3D6NB 4B73A 3PDUA 3S99A 2JAUA 1CTQA 4J7UA 5LLTA 2XWBF 3CUSA 1F0YA 3L8ZA 2PLWA 3ES9A 4CF7A 1DHRA 3LFTA 1AGPA 3HJGA 4HH4A 1JQEA 4LRTB 3UZUA 2Q4EA 1IZYA 2JHCA 1GZ4A 2H0RA 3F8TA 3GMIA 3I5MA 5DJ5A 4ZMRA 2NXCA 2E6KA 3AZOA 2W6IA 2ZRCA 3MWJA 2JAOA 4O4LF 4YRKA 3GLFB 3T3NA 2J3KA 5HF6A 4UW9A 4EQ6A 3UJ8A 1H9CA 1YZTA 3FHOA 2FZEA 4TV9A 1XFAA 3JQAD 4HY3A 4J4TA 4KLRA 4OKIA 5BUSA 1AZSC 1B74A 2IY8A 3HEMA 3NT5A 2DKOA 5MFZA 3TD9A 1TLFA 3AUFA 3CTPA 1M1YA 4K88A 5AYVA 3Q7EA 2XDQA 5ILOA 5TMBA 2YJ5A 5AJHA 4PS1A 2PX0A 3BKXA 3PD0A 1Y3CE 1G2QA 1GQFA 2I6XA 1ISGA 2FR0A 1Z12A 3NUZA 2ZJZA 2Z6AA 4K2HA 1Y1KE 5IAJA 5FWXB 4M38A 3EHEA 4PBSA 1AO0A 4GVXA 3EK2A 1AQNA 2P4SA 4BE9A 4A8HA 3P7MA 2XVZA 2CJWA 1S0UA 1YE5A 3I9MA 4M8NE 1PUIA 5AI6A 5SICE 4Q0MA 4CM7A 1GU0A 3B85A 4UBKA 1V8PA 3FJOA 2Q2NA 3FNRA 4P2GA 2QY9A 1NP6A 4RF3A 3SHQA 3W6UA 4N54A 4F6LA 5KPDA 1A8HA 4P81A 4MEBA 1CQJB 2XVMA 2YS6A 1XRJA 2Q45A 1R6TA 2DYKA 4HD8A 3EISA 1WD5A 1FYEA 1SUEA 3L7BA 4OSEA 4QBIA 5MN4A 1W6RA 1H4QA 1VJ0A 5JT1A 4ALNA 4Q02A 2HGSA 2NG1A 1TPYA 4JJFA 5HKAA 1P1KA 3U44B 4MUEA 3Q8MA 2CLFB 2EARA 3IE0A 2ZIGA 4V0KA 5AVYA 1UBTS 4HAVA 1XZKA 1Q19A 1Z6AA 4IH9A 3O93A 4DPMA 1OBHA 3WRXC 3HVHA 3DKVA 1ZGZA 3QVMA 1UEIA 3CO5A 4LGMA 4YAUA 3ETNA 3TZKA 1NTRA 3DWGA 2G1KA 2WUDA 1DJOA 5DBEX 4R2LA 2Q50A 3M6IA 1DEOA 2BHLA 2KW5A 2YHBA 4U7JA 5KTNA 1NJFA 1ZQ1A 1XZAA 4PV7A 4YRJA 1TLLA 1NF2A 2PBFA 5BSUA 1HMYA 3TEMA 2NSDA 3QNMA 1TZBA 1U0TA 1B42A 1DC6A 3PX7A 3C6BA 1JI0A 2JFOA 1LJLA 1BVYF 2R1VA 4LZWA 5DOVA 3G9UA 2MR6A 1N7JA 4FCCA 1RR6A 4PXAA 3U17A 4AMZA 5BQXA 2GJ8A 2QE6A 3IAFA 4RVUA 1S9DA 4WNCA 5K0ZA 1QE0A 5LBUA 4CU5A 2OHVA 5AVWA 4YRNA 1EVKA 2DR3A 2J6BA 4JLOA 2A84A 2DCMA 3OLZA 5J1TB 5LKRA 2E9SA 2ZJ1A 1MOPA 3OTOB 4CQMB 3FNBA 3D1JA 3HU3A 2J9YB 4ND5A 1ZI9A 1HYQA 2C2BA 2HT1A 1YU9A 2H2FA 4H59A 4LHXA 1AKUA 1LS6A 2V74B 5HEKA 2HI0A 3GEPA 4IX9A 1UCFA 3H0KA 1O58A 4Z3OA 1ZESA 3HRHA 1N2IA 4MUKA 3V1NA 1P4JA 1SCAA 1HLDA 4KR0A 5DFAA 1V0JA 4KQ9A 1M8PA 2CHEA 4X7MA 4U7HA 2HDNB 4HMOA 3R9IA 3NONA 3UV6A 5KNDD 2J0QA 1E64A 3QLUA 3AW9A 2NQ2C 2L17A 4M0UA 4S04A 3FAZA 2X6RA 4Q7JB 3SEZA 2GZRA 2QBYA 3T3GA 1BS9A 3FYUC 3LPDA 4OMCA 4EPXA 1Y7TA 5LXTA 1H1TA 4IPTA 3GNLA 2GAOA 3IR6A 3O4JA 5CPFA 1HR0B 1R8XA 3BRSA 1JMKC 5KYVA 3NVAA 3CRQA 4CQLA 5H4GA 1Z7GA 2X1LA 1T0UA 1WV1A 1G3QA 2BM0A 2FSSA 2NXWA 2QTWB 3HU5A 4GOXA 4JIMA 3K9LA 3GPBA 4MMXB 1AJEA 2ON6A 2W4IA 4EJSB 2HEGA 1X7DA 1E32A 3AEKB 3E53A 3IPRA 4Y1RA 4FU0A 1YACA 3BWVA 3OX2A 2AXPA 3UMVA 4K81B 4NTZA 5KQGA 3STWA 1KK2A 2FSPA 4BFUA 4W7IA 4GMGA 3WLTA 3MXTA 1NT4A 3KOXA 1KJZA 1A9QA 1MORA 4QQRA 3B6KA 4X0EA 2VT7A 1J2RA 3BE6A 3E2PA 1M8JA 2Q2WA 3QENA 3IEXA 3O4RA 3HYLA 2A5DA 2JI9A 4R4JA 5TEVA 3WLHA 1UOQA 4LY0A 4UTZA 4F12A 4V0MA 3NCTA 1OFVA 3O3CA 1F4PA 2C2YA 4HDKB 2UZAA 3IC5A 3L06A 3BILA 2V6GA 4TTPA 3M6LA 1HE4A 2IOYA 1JW9B 1K6EA 3MB8A 2CDCA 3M4YA 3ND8A 2DBRA 2DPMA 2IZ0A 1N0IA 1D3AA 3A9CA 1L4UA 5AI5A 4FD2A 4NENA 3UICA 1ZCAA 4G1EB 5BYBA 3ZDFA 4OHXA 2YY7A 3HYCA 3K0AA 4UXIA 5EJ2A 1E79D 3CEPB 4D43A 1FVXA 1VCIA 1VYHA 1H0HA 4I1RA 4TVOA 4B31A 3EVTA 4D0GA 4DZZA 1Z33A 1BDJA 2V54A 4UU1A 5TE9A 5FHRA 4URYR 4BNHA 1NXWA 4TQGA 5CCEA 4MDEA 4DCJA 1DQPA 1XVUA 5IABA 2GZSA 1NG9A 4Y6SA 1JJVA 1EM6A 1NJSA 2GASA 1NXVA 3A2MA 3HLYA 4IDGA 4NV0A 3RU2A 1JR3A 1H1DA 1T6BY 1X1TA 4RKQA 1V1RA 2UU9B 5CT6A 3T9EA 3K15A 4HBGA 2UAGA 1N5IA 1PGQA 1WDMA 2HY7A 3EMDA 4FZ5A 4UEJA 5HGXA 4O25A 4MV9A 3F9CA 2Q5LA 3DB2A 3EIFA 3GCXA 2FKNA 4LYAA 5EP1A 1OSNA 4DMFA 4LXGA 5JSZA 1I5EA 5FFNA 3RANA 5KNBH 3FJYA 1U2PA 4DC0A 4XQ0A 4ZIRB 1NRIA 4OI1A 1FJHA 1R9GA 5K4AA 3VPHA 4S2UA 1IDOA 4DDHA 1EVYA 1ZFNA 1K3FA 3IAHA 3OUUA 4E1BA 2FQWA 4NJMA 1QGDA 2B82A 3OQIA 4M4SA 4A15A 1MO2A 3THSA 4MW1A 3OTGA 4QA9A 1R6AA 4I6GA 1ISPA 2OCKA 2QTGA 4DCSA 3INRA 1F7UA 1S8NA 4Q7KA 1B26A 2ZR9A 4YO8A 3SXJA 3VXKA 3RFCA 4S1VA 1WB6A 1M76A 4UMEA 1PNTA 3RRMA 4EHJA 1I7DA 4O3MA 3K5IA 3BB4A 3UJCA 1H8ED 2B4TO 2ZU0C 2Q1UA 1TTPB 1KU6A 1E7QA 1T4MA 3N2GA 3OD5A 3F96A 3BT7A 5EPEA 5CLIA 2Q5CA 2GN9A 5A3VA 4EJ2A 1SOVA 1NQTA 2FWAA 2GXUA 3IO3A 4R71A 4G5OA 1M74A 4BUZA 4BX9A 3CN7A 4GLJA 1GG2A 4TM8A 3SJCA 5I7RA 5HR5A 2BE9A 1JT9A 3M4ZA 3NI2A 4E5DA 3V4LA 2Y1CA 5J58A 3D4BA 3F7MA 1IAQA 3FDJA 4FGWA 3UT6A 5LBIA 1G59A 2QL6A 3VR5A 5B1YA 5J1SB 3B13B 3HR4A 4GBMA 4IS2A 4MQ4A 5CEFA 2RHJA 3KLNA 3RWBA 3BIJA 4RZIA 4MICA 3QMPA 1Z2NX 2AFVA 3MSCA 3QUCA 3LC0A 4O0LA 5F7JA 3ZNPA 2PX2A 3OOWA 3B3QA 3QKTA 3QZUA 1BMTA 1HI9A 3MYYA 3ABRB 1UDWA 1UP6A 3N3BC 3P5BA 4ZT3A 2EJTA 3Q85A 2NQTA 3D7RA 1Y4AE 3F3YA 1KI7A 2FX2A 2P79A 3AJEA 3KOMA 3ZIDA 1D6MA 1UKCA 5DGDA 4NI5A 4BRUA 2PEYA 3HP1A 3H19A 4IQ4A 4L50A 4A82A 4B4UA 1FXSA 5JE8A 1C0PA 1CB0A 3RLIA 1RPTA 5DTEA 2JGLA 2VJAA 5JMPA 1EP3B 1G2IA 3REOA 1GTSA 1BN7A 2GGSA 1H9AA 2Z09A 3GLFA 4Q4JB 2OENG 4DCTA 4GE0A 5HE9A 3MF4A 3IL2A 2O1XA 2GZ2A 3PX2A 4G8BA 4GQIA 1IC6A 2EXXA 1K7CA 1ZDMA 3UMFA 1GT6A 4TLAA 3WWYA 4DMUB 4DR2B 1E1QA 3O90A 5BSTA 1DX4A 3QPDA 4M0LA 1H65A 4F1KA 2R6ZA 4A0SA 3EEBA 4JWKA 3GFSA 4ZAGA 3QSYA 1R0RE 1SQSA 2Z9DA 3KEGA 3OOHA 4DFDA 2BGIA 3WADA 5E9WA 4XM0A 5EE5B 1J20A 1VLVA 1BKDR 1N2BA 3FVQA 3AJRA 3GROA 4MVJA 4N8SA 3WMXA 2PGAA 4F3NA 4GRIA 1QB7A 2OLEA 3DEJA 4ZD6A 3HS3A 5FUVA 3SNKA 5HXAA 5HDBB 4Y2UA 2LUOA 1LH0A 4G5RA 4C5BA 1GYPA 2DX7A 5EGNA 3LPMA 3H2IA 2GD2A 2OCYC 2Q3BA 4JR0A 4NH4A 4JJ4A 4RPJA 2ONKA 5DWQA 5AMXA 4EI9A 3DQZA 3AHEA 2GSDA 2M9MA 3VU1A 1KF0A 4GUAA 1NVAA 3B3AA 5EXXA 2D1QA 3RVNA 2BUCA 3MB5A 4Z0TA 2ZVDA 5KTYA 2K2WA 1U0EA 2V45A 1SUFA 3KSAC 1YF3A 1O08A 3AHJA 3VX4A 1DBIA 2QRZA 3U44A 3CG0A 4G9EA 2G6TA 4QJBA 4G07A 2NVWA 2Z08A 1W88B 3O8BA 2AXEA 4KACA 3A1TA 1RQ2A 4DEVA 2X8JB 2AFHB 1C0LA 2XE4A 3G1TA 2YUTA 4PHFA 1GXSB 3SEFA 3R0QA 2Q3FA 3SHTA 5IJ9A 1TM2A 3EGEA 3GRCA 4F21A 1XDSA 3L1JA 1NIPA 4GR9A 1QH9A 3BMQB 1KQOA 1W9HA 4O2AB 2PNJA 3AVVA 2ERXA 1JWBB 1AQ6A 1G21B 3OECA 2ZE8A 4MW2A 5KCMA 3UB3A 4ZVMA 3PK0A 3R77A 2CFRA 4TMZA 1GG5A 1T3HA 2PH7A 1ESNA 1YULA 4I4TF 2P5YA 4PS0A 5TY0A 1M1ZA 3D4IA 3EG9B 4XXHA 3KV1A 3N0WA 2CKDA 3ICOA 3I2KA 2YFKA 2GJSA 1V3TA 2Q1WA 3DMDA 4REOA 3AL0C 2H9IA 2BH2A 4M0DA 4P2BA 4XRRA 3CRMA 2ZJ0A 3L1VA 4AKEA 3NAMA 4R51A 5JD3A 5TVGA 2JLYA 3NHJA 2VJOA 3S8EA 2VSOA 4QFMA 5DE3A 5FQOA 2GM4A 3QMWA 1D4OA 1FYDA 1GLNA 2ZROA 2H08A 4AIRA 4CQMA 3JPWA 3VSBA 3PFBA 3ZDBA 1EE2A 1LTHR 2CL0X 3LV8A 4UOQA 3I73A 3FUCA 2YJ6A 3L46A 4XWOA 5K20A 4B40A 1R9NA 1WXIA 4FDMA 4G0OA 3AEUB 4LC9A 4H3KB 1MEOA 3AF5A 2C5AA 1SBQA 1OGIA 3L6CA 3QPBA 4ZQBA 2OXRA 1EX9A 4M3NA 3UBTA 5JSHA 3OWOA 4D4LA 3DD1A 1MO6A 2WU1A 3ZV4A 1D7OA 3LUJA 2B98A 3URKA 1FMLA 4R7ZA 3HI6A 3F73A 4LX8A 3FPJA 1PFQA 2V3WA 4TXHA 1IXSB 1IBSA 2EDAA 2UZ3A 2QJRA 3B9BA 1XMJA 3PUJA 2JDID 1AA9A 2P5SA 2YVKA 4IKPA 2JRCA 4AMBA 3TG8A 3OP1A 4EYKA 3EMBA 4LJYA 4EJSA 1OLOA 2WUEA 3AEKA 3TYXA 4TSKA 1C3LA 5BW4A 1XFDA 4GEKA 4IW3B 5CM9C 1I2AA 1SOAA 4KGDA 1ONPA 3P71T 3CNNA 3HXLA 1T9GS 4JQCA 4DGQA 2QPAA 4LV8B 2G3YA 4EHBA 1V1MB 2WVGA 3ETCA 5T3UA 2ZJ3A 3ILXA 2QZSA 2AK3A 2OR3A 4YQYA 3VKWA 5KU1A 2AL7A 2PGLA 2ZRNA 4H7JA 4UQLA 4CL2A 2NAFA 4RFSA 5G4KA 1VP3A 2GAIA 4BGEA 4BVGA 2P6RA 4LJRA 2IUYA 2WF9A 4LHZA 4D4KA 4PNPA 2XQIA 3H11A 1E60A 2WT8A 3E9CA 4HDKA 3U13A 3ZIAA 1VHJA 3AF3A 3PNOA 1OYYA 1TO2E 4MIYA 3ZI0A 2PIAA 2DVMA 3I2FA 4A3SA 3ETHA 5KAMA 3LX8A 2Z8YM 3OU2A 1K1EA 5AUNB 6ABPA 1Y9ZA 3GLSA 1F0NA 1IHUA 3LCVB 1NVGA 4QQ8A 5HILA 3EA0A 4OKNA 1XYVA 5TVKA 3N2LA 4F86A 5KHAA 1OTXA 3LBNA 1ZW1A 1H69A 4FIDA 4MS3A 4FWBA 5JNUA 2OFPA 1J0EA 1T1JA 4G0WA 2FN9A 4R1MA 4RORA 3I0NA 3SC3A 2GZHA 5G0WA 4LQLA 1I6LA 1RKUA 1VJGA 2XYQA 1NNEA 1JDZA 2DBZA 4QTTB 4P54A 4RJTA 3CVJA 5CJPA 1PX2A 3V4FA 4NMMA 3V3TA 1T9DA 5AK3A 2WQ6A 3D0OA 4CM4B 4FR0A 5DW0A 2G1JA 3E84A 1LTQA 1SN7A 3LPLA 1U6IA 1LW7A 3EMVA 5IVKA 1GFZA 4C04A 3Q11A 1GDTA 2GEUA 4ZIRA 2W00A 1P4SA 1UQUA 3UANA 2X1MA 5FTJA 2AUTA 3N05A 5IKOA 3WC4A 1O4WA 1T2DA 4ESVA 1W48A 4N0MA 3OQBA 4DV7B 1JGTA 1Y8ZA 4OHVA 2LRHA 4DG5A 2JEZA 4B6EA 2GLTA 4G5SA 1GN9A 5ADWA 4YH1A 1ITZA 1JNYA 2HH9A 2O1WA 5ANRB 4A91A 1IOLA 3PKIA 5T4FA 2HWXA 4R1TA 4F93B 3IP3A 3H4MA 1OB2A 1GNVA 3FDIA 3A6EA 3AJDA 1F0KA 3G7SA 3QE2A 3W9YA 1RQXA 3TAXA 3O8CA 4YRLA 3UENA 1W6UA 2JLSA 3TG2A 3H5IA 1BQ3A 2JGNA 4G4SO 1OIXA 4NMWA 5TDHA 4ALJA 1DU4A 5FLKA 3VKUA 2QAJA 4ILKA 1GZ6A 3IXQA 2ZAGA 1RHKA 4ARSA 4BKOA 5JVDF 2BY4A 4FN4A 4LGVA 5TS3A 5IW8A 3PVZA 1D4AA 3HB9A 3UA4A 1H85A 4IHKA 2DRIA 3ZY3A 1Q20A 3IURA 4HQRA 1VMKA 1Z4OA 2QVZX 5CPBA 3BTOA 3VOAA 3CUEF 4XM2A 1ULBA 2IKQA 5CNMA 1BH6A 1QP8A 2FX5A 4YP6A 2F4VB 1KVSA 1EFCA 1M2WA 2RBEA 4UVIA 4Y7DA 1KWGA 2Z6QA 2HX1A 3EEIA 3PCTA 2YBDA 2WG2A 3UO8B 4KITB 3HCNA 5HKKA 4RS4A 3EGCA 3Q98A 4D74A 1DX6A 3UMRA 1Q0HA 1HY3A 3EVEA 3S3TA 4QKQA 5LU9A 1OFUA 4GNKA 2PO5A 4FC6A 4N5DA 3ZHXA 4EW6A 4J16C 1RPAA 1DRVA 1CRLA 4S1NA 4JBLA 2G0TA 3UTDA 4D0RA 2YKGA 3OKAA 4Q4JA 5KJ1A 4XA8A 2W0MA 3MELA 4XVRA 4JEMA 1KJQA 2QIPA 4B75A 2RBGA 2FZVA 1OXVA 2OCPA 4JP3A 2CFTA 4PSUA 1AGXA 2ES4A 3HYTA 3ZDEA 1CIJA 3JWEA 5CP8A 2UZIR 4QOFA 2M6KA 4B3DA 5IF3A 2MINB 4KYUA 1BE0A 3MHPA 2ZUB