2A0YA

Structure of human purine nucleoside phosphorylase h257d mutant
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
b'NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANDEEVLAAGKQAAQKLEQFVSILMASIPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Neighboring group participation in the transition state of human purine nucleoside phosphorylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a0yA00
2RJ3A 1PR1A 1C3XA 2IQ5A 1Y1TA 2I4TA 2I8AA 4JOSA 4BMYA 3C74A 5KB3A 1U1DA 1CG6A 1RYZA 1JP7A 5K1ZA 4QEZA 1Y6QA 1K3FA 1PR6A 3UAZA 4BMXA 1RFGE 1RCTE 3MB8A 2Q7OE 4R2WA 1Z5OA 1RXUA 1JE0A 1Z38A 2A0XA 1YQUA 4U2KA 1YRYE 4L5AA 4M7WA 3K8QA 1V48A 5I3CA 3QPBA 4DA8A 1T8YA 1Z39A 1RR6A 3U40A 2AC7A 1V4NA 4L0MA 1YQQA 3LA8A 1JDVA 1PF7E 3PHCA 1B8OA 5ETJA 1OUMA 3OOHA 3SCZA 1PBNA 3NBQA 1JDUA 4G89A 4QAQA 4TXJA 2HSWA 5F73A 3UT6A 1CB0A 1T0UA 4OGLA 1OU4A 1RXSA 2A8YA 2GUWA 3D1VA 3FAZA 1M73E 4D9HA 1V2HE 2BSXA 4K6OA 4QARA 3KVVA 3OOEA 4TXNA 3LBAA 4E1VA 4RJ2A 1U1FA 3INYA 3ODGA 4TS3A 1SD2A 4R2XA 3BL6A 4NY1A 1SQ6A 2H8GA 4QFBA 2ON6A 4YNBA 3EUFA 4LDNA 3OZDA 1SJ9A 4I2VA 3O6VA 2A0WA 4H1TA 3F8WA 1VMKA 1JE1A 5B7GA 3DDOA 4F2PA 4GMHA 4TS9A 1U1EA 5CXSA 3PNSA 1ODIA 2P4SA 4YJKA 3T94A 4BMZA 4DARA 5F7XA 1T8WA 3UAYA 2OXFA 1Z34A 4DANA 4EARA 3BJEA 3KHSA 1A9PA 1Y1SA 3DJFA 2OECA 3BSFA 2HWUA 3ENZA 3E9RA 5EUBA 1Z5PA 1ZOSA 1QE5A 3UAWA 1JYSA 2QTGA 1NC1A 1TCVA 4M1EA 3KVRA 3FOWA 3OZEA 4L6IA 4WKOA 3GGSA 4F3CA 1K9SA 2HRDA 3EUEA 3KUKA 4NSNA 2OC9A 3ONVA 2OC4A 5EFOA 3K8OE 4TTJA 4OEHA 1YR3A 1VHWA 1PR4A 1V41E 4DA0A 1A9OA 2AI2A 3MMSA 1ECPA 1OTXA 4WKCA 4DA7A 4TYMA 4M3NA 3FWPA 5F7OA 4TXLA 1NC3A 4TXMA 2AI1A 1Z37A 4PR3A 1PK9A 3PHBE 2ISCA 2XRFA 1PR2A 5F77A 5CYGA 1ULAA 1PR5A 4YMLA 1T8SA 1G2OA 1ULBA 4NS1A 1ODKA 1I80A 5F76A 2B94A 5B7NA 3FNQA 3OPVA 4D8YA 1TGVA 1SD1A 1Y1QA 4TTAA 1PKEA 4D8VA 1Z5NA 4UC0A 4F3KA 3OF3A 1ODLA 4WKBA 5IFKA 1RXYA 4TTIA 1U1CA 1Y1RA 3P0FA 3DP9A 1VFNA 4D8XA 1A9QA 4OF4A 5F7JA 4OGKA 2QPLA 1FXUA 1A9SA 1JPVA 1V45E 1VHJA 4LNAA 1XE3A 3DF9A 3EMVA 3EEIA 1K27A 1N3IA 3LGSA 4JP5A 4MCHA 3DPSA 5JPCA 4ECEA 1A9TA 1PWYE 1LV8A 4EB8A 4DA6A 4KN5A 4MCIA 4YO8A 3IEXA 1PR0A 4BN0A 5F78A 4F1WA 4PNPA 3UAVA 3KVYA 4FFSA 1Z36A 3E0QA 2AI3A 1Q1GA 4WKNA 1OV6A 1Y6RA 3NM6B 1ODJA 4LNHA 4JWTA 4P54A 5C80A 4R31A 4GKAA 4QATA 1RT9A 3GB9A 3NM5A 3IOMA 2QSUA 1Z35A 4QASA 5F7ZA 1OVGA 5B7QA 4OJTA 4GLFA 1TGYA 4L5CA 4X24A 1ZL2A 3O4VA 5CCDA 5CXQA 1TD1A 4G8JA 1JDTA 4LKRA 1LX7A 5EPUA 3OZBA 4GLJA 5CCEA 1U1GA 3FUCA 1RSZA 1OTYA 3UAXA 4DABA 4WKPA 4OY3A 1T8RA 4D98A 1A69A 3PNPA 1WTAA 3BGSA 3TL6A 4F2WA 3P0EA 1LVUA 2QDKA 4L5YA 4LZWA 1V3QE 1YBFA 5IU6A 1PK7A 1TCUA 5B7PA 5DK6A 1PW7A 1A9RA 1JDZA 4MARA 5FAKA 2A0YA 3OZCA 2HN9A 1JDSA 4G41A 5CYFA 1Z33A 3E9ZA 1RXCA 4DAEA 4IP0A 1B8NA 3OCCA 2PGAA 4DAOA 1NW4A 2QTTA 3NM4A 3KU4A 3FB1A 4TXHA
chains in the Genus database with same CATH superfamily
2PUCA 3HCEA 1BCRB 1DIGA 1NN3A 3GMIA 4MW0A 4RWEA 4Q48A 2CUNA 1XQXA 2OCGA 3DS8A 3TOSA 4XR4A 3PGKA 2EBUA 2HPZA 3TZCA 1U2QA 1G8FA 1S2GA 2IYFA 1TQDA 1N5RA 3CLSD 3OD1A 4J6EA 4OSPA 1HDOA 1M72A 4ZAZA 4Z6KA 1KI7A 2WYUA 3RREA 1F5NA 2ATVA 4UFNA 3BF8A 2OYSA 3RSCA 2TECE 4REQB 1L5MA 2GBCA 5LDDC 3L8EA 1Y4AE 4HQFA 1CJBA 4ENPA 3L1IA 1UOEA 3P0JA 1HY3A 1F0YA 3BMCA 2QUKA 3L6UA 3OTHA 1QP8A 1SOUA 4URUR 4UMVA 5JD6A 1A04A 5JO9A 4W7SA 1PO7A 4DSZA 4YECA 1HBJA 4GIBA 3TMYA 2RI6A 1N6KA 4NS4A 2HHHB 1MOPA 4N6OA 4OP3A 3WB0A 2WSLA 2FHSA 1MJ5A 3AEQA 2CK3A 1B4DA 1HDYA 1CJVC 1I4LD 1RFGE 4KAXA 5JAZA 4GX1A 3O3NB 4JUCA 1OZ0A 3Q5EA 4UM7A 3DG9A 3OZFA 1DEOA 5J1SB 4OHKA 2VDWA 4PRZA 4QL3A 4UHBA 2HLPA 1W29A 5KKAA 1CP3A 2WMOB 1WA5A 3ES9A 1LBEA 2JK0A 4L5AA 1O2DA 1E2MA 4JEUA 4PQEA 1XDSA 1NPTO 3FETA 3VMFA 2PWPA 3G8YA 3JPYA 4HVTA 4H3VA 2GN1A 4R9RA 4GU5A 3QPBA 1SHJA 1YB4A 4HJXA 3I6MA 2C58A 3NTXA 2NU9A 1IHYA 2ZTHA 3JQ9A 1RPTA 2OVFA 4DG8A 3N53A 2VQEB 1FW6A 1LBSA 1U0BB 1A9XB 5JSKA 5E2BA 5IXJA 2AC7A 4D9GA 3B6MA 4J7AA 3H87A 4X3CA 5JTTA 2C3OA 9GPBA 5AK0A 5C81A 3TQIA 1ZG3A 1V4NA 1XV5A 2AA3A 3AU9A 3HKBB 1CW2B 4TKUB 1QH0A 1AUVA 5JFGA 3H65A 3HBAA 4AS3A 4DV2B 3R3XA 3FRJA 2ZU0C 4DF3A 1M8JA 3PNLA 1NLYA 3P5BA 4TWRA 4UU0A 4TTVA 3WSVA 3FSEA 3L6CA 3RQSA 1M8PA 1EGHA 1RMYA 2YNMC 3FVQA 1I7NA 1P5JA 3WL8A 1O5OA 4JLPA 4QGBA 1SQ0A 1ZZGA 3QUQA 1JMVA 4NH4A 3MGGA 3I9KA 2R6HA 2IFTA 2Q5JA 2ZPTX 3PI7A 2FFBA 4F72A 3UCEA 1I7DA 1D8TA 2HBQA 3AIMA 3D1LA 4GLOA 2X8AA 4HDRA 2P9ZA 4JR0A 1BH2A 1A8IA 5HKKD 2J0SA 4B3SB 2Z5GA 3I6IA 3EOZA 2NTVA 1W36D 3UYKA 3RV4A 4DBLE 1I10A 1AOXA 1NA5A 1PQPA 2X8WA 2HFJA 2Y9PB 1JHXA 1FLDA 1KU0A 1KPGA 3EY4A 3F97A 3HE3A 4COKA 3TZBA 1MRZA 4BAUA 3BDVA 2WIAA 2BSXA 3L7AA 5G0TA 3W0LB 2VQFB 1P9LA 1DBQA 2ZB2A 1KR5A 2V0GA 2IBMA 1F6DA 3T4XA 3OP1A 3PJDA 1JFLA 2BHLA 4RA9A 4IOMA 1XKLA 4MKIA 4HDSB 1XMXA 2FFQA 3HN2A 4LRXA 2R6AA 2FWIA 2H54A 1RU3A 4NYIR 4EI9A 2KWIA 3JVUA 2ZVPX 4I50B 1EP2B 5JAIA 3TLGA 1VBNA 4A2CA 1QGUA 4HT3B 3OFSA 1X7YB 3OOSA 1KDPA 4PX3A 5EFZA 4W5HA 4ZJYA 1K8QA 1CPYA 2BI4A 3DZKA 2XUPA 4B3XA 3DVLA 1E7RA 1H66A 2B6HA 3QHPA 4HPJB 3U7HB 1K0UA 4OP2A 5HF5A 4DHWA 4JB3A 3LWDA 5JCJA 2AQHA 3EUFA 4LDNA 4HWPA 3W2GA 2BR3A 2WJVA 3UPDA 1UBCA 3B1YA 2R44A 5BWCA 2RBKA 5CFOA 2OBYA 4HDNB 4Z3DA 3DWIA 3WAGA 3X1JA 4WLUA 3NHSA 2C3PA 1JSZA 2W6JA 1WBDA 1USVA 3ORQA 2NUTA 3FCOA 1TYCA 2PGDA 3FPFA 3I9FA 1DKMA 4RQTA 4UBKA 1SUFA 4Y2JA 4Y8VA 2WJYA 4HF7A 3T7TA 4P31A 1RPAA 1ZM4A 3CQ9A 3OO1A 4CU5A 3VNRA 4L8YA 2GBIA 4J29A 2JJ2A 5EE5B 1Q7GA 4JU9A 3O8BA 3E70C 1JLSA 4ML3A 4DN6A 3PVZA 5BW5A 1ODSA 4HK4A 2E7ZA 2HW8A 1TZJA 3NHLA 1USKA 3C8ZA 1GZDA 4XX1A 2FQWA 2OOKA 2OD7A 2G0NA 1YF3A 2VJMB 4J6FA 3Q12A 5A3JA 1YVEI 5JJ5A 3VKHA 5BNIA 3T12A 3TZLA 2REBA 4QDUA 4U7WA 5H82A 4ZDWA 5A7GA 1O0CA 4FLMA 3DT6A 2D5CA 2VDNB 4NLLA 1ST3A 4Q7EA 4WN9A 1GFZA 4E5NA 2V9PA 1E9DA 4L51A 2EQ5A 5CP8A 5T7BA 1CRQA 2HLDA 3U4DA 1CSEE 1E1CB 3AY3A 1QONA 1J4AA 4GI3A 4KXUA 3BUSA 3QUSA 3AM3A 4WXRA 3C24A 2ANBA 3EQ9A 4BO0A 3TW4A 2OO5A 5DO9A 1ZW6A 1BGXT 4CI0B 1G5QA 4LUCA 2E82A 2ODNA 3IUMA 1Y8CA 4OL0A 1SG6A 1U8EA 3N07A 1N2XA 1QE5A 2VP3A 5EKUA 3ZJ4A 2HIAA 3UAWA 1J07A 4ESVA 1DELA 1Y9AA 1Q16A 4GPD1 4MGHA 2ZIEA 1WQ1R 1W87A 5J4YA 1O57A 1UIMA 1AB5A 1WZNA 4WVFA 4QTUB 4DB2A 2A14A 4H0CA 4LSZA 5FUMA 4OLJA 4W99A 1SG0A 1TJPB 3M6VA 4L8LA 4RC9A 2FVXA 3MS2A 4RESA 1M7GA 4KVGA 1LSOA 3SQDA 3C3PA 4GXTA 1XEWX 2RKOA 4U6SA 1JQDA 1WLSA 4J7XA 1WCV1 4MJXA 3RW9A 1E3DA 3MT9A 2P9FA 4INZA 4CTNA 1ZC4A 4X8OA 2XMQA 1LW7A 5LD2B 1KP9A 4ZEMA 1TTPB 2GETA 3QMWA 5JEEA 5JQGF 1SUCA 2NTNA 3IQFA 4HNTA 3NDBB 3IDZA 4OD0A 4CGZA 1S3IA 2HMTA 1LTQA 2Z4RA 3DCYA 5KWVA 3ROFA 3VV3A 4FC7A 1ONOA 1Y7TA 3ZHOA 5JNUA 1T9HA 1UMCB 2CJFA 3BIOA 5HM8A 2SKDA 3DM5A 1UAGA 2FR0A 3MJFA 3MM4A 4OHZA 1E1MA 1ZICA 2QRUA 1UJ6A 3A28A 3MMSA 2BBOA 3ON5A 4YROA 1ECPA 3WJ7A 2X5OA 3LK7A 4TMXA 2DUNA 1WUKS 4CQJA 3N0WA 5J5AA 4DV5B 1POWA 4TYMA 4HOYA 1FDWA 1Q12A 2PMFA 1N0WA 3L7IA 2F8SA 3CEJA 2WK1A 4B33A 4C03A 4QT4A 2A5JA 4C7XA 4DSTA 3K0CA 3Q7QA 3J81k 5SYNA 1MAVA 4QU5A 1RJ9A 3RF7A 4WZAB 4BE4A 5I8PA 4WJLA 4R2IA 1UXKA 4GE0A 2ZI9A 2Z8XA 5AUQA 4BX0A 1JDNA 5FYDA 4TL9A 3AM5A 2I8LA 2YY5A 4EY8A 3G79A 1XDDA 5LQCA 1AGNA 3I61A 3LMKA 5FIUA 3CX8A 5IAJA 4BVKA 5CBKA 2ZWMA 4P3YA 5JZVA 1K4KA 1CQIA 4K9QA 2LXNA 3ZWWA 3NCHA 4JBGA 1T43A 2FMIA 5LWQA 3G0CA 3REQA 1DP4A 1ULBA 3R5JA 5EP3A 3DE2X 3SS7X 5C32A 3T1HB 1GQOA 16PKA 3CONA 4I99A 1H69A 4RY2A 1R0LA 2EZTA 4HDKB 5NULA 3EX7C 2WZDA 1M2HA 2NSHA 2XUKA 5ESDA 1VJ5A 2HMUA 2WV9A 2WU3A 2PX6A 2WUFA 2QVGA 1HQKA 3C3EA 3JQEA 2VDJA 1ZVVA 1MHTA 1V7QA 2IBSA 2FPWA 3FUVA 1Z47A 3LSTA 1ZCFA 3W8NA 3ICEA 1F4VA 2QYHA 4A2QA 3ZWMA 1BTOA 4GYJA 1VJCA 1YZFA 3LYLA 1J22A 1T15A 1OFGA 3FRIA 4G4SP 3W2HA 5BN5A 2A9QA 1WD7A 4MW4A 2O23A 5A02A 4UC0A 2YNMD 5DMHA 2RAPA 1J5PA 3K15A 4BNGA 1QHNA 1VECA 3NUGA 1Y8QB 5FPKA 3DBRB 1H4TA 2BFBB 3M1YA 5AW5A 3R74A 4GR4A 4PLFA 4BX2A 1SC9A 1LF0A 1PQUA 2R2AA 3OUZA 4OGFA 2XZOA 1ZK3A 1E9AA 4KNVA 1PGNA 2E37A 5AVYA 2XVZA 2FPOA 4G86A 1J2EA 2CVPA 4NP6A 5EJ2A 5AXAA 2WG1A 4W1QA 2PRYA 4F06A 2J5KA 1Q19A 2YUTA 4DLNA 5KNCD 2QQ0A 1H4VB 5CIYA 3DLHA 3WLJA 4LXUA 3FTFA 1E6UA 3NWJA 3PNKA 2H0RA 1LJUA 3A70A 3ML1A 4S2EA 4E5DA 5MN6A 4GX5A 3Q3CA 2Q5LA 4BLVA 3IO3A 2DLCX 2Y8EA 4MYHA 1DTWB 3DT9A 3KHTA 2DH6A 4ECEA 1D3AA 3G0HA 1EDBA 1NG1A 2R62A 1V26A 1CZRA 3Q0EA 3VPHA 2CNWA 1VE9A 1HYHA 3HKDB 3ANTA 1J5EB 5K0TA 1SKYE 4Y9TA 3ZNQA 1JFSA 1E6MA 3AHIA 1AKVA 2PANA 1V95A 3QYAA 3RV3A 3QXHA 3ICPA 4NK5A 4C6HA 4INPA 3HCAA 2FA9A 4OHCA 3ETEA 4IVPA 4MHTA 4EDHA 1I4OA 2AQIA 1ZD8A 4QUKA 4N03A 1MRNA 4QDKA 3V80A 4HRAA 4FS8A 1PLJA 5AXBA 5CHEA 4ZVTA 3V3TA 4LY3A 5CCXA 4E70A 2XTMA 3ZG6A 1DIHA 3A6EA 3EG9A 4Q16A 1M33A 4R5MA 4BNTA 4OHVA 4G84A 1RLJA 4Q02A 4XLLA 3X1WA 1VA4A 1RWMA 1ZUWA 3DF7A 1KEUA 5CDTA 3DE5X 2GNOA 3L1KA 1Y63A 4OHPA 4I08A 5FWXB 2IV3A 2SKCA 3WK4A 2YVAA 1VCHA 4IUBS 2AJ8A 4HB0A 4BATA 4ZCPA 1YO6A 1Z35A 1ZWLA 5FI3A 2FU5C 1O6CA 3I8XA 3UT5A 1FU8A 1Z5WA 1ZUNA 1YJ5A 1FCJA 2P78A 3S2YA 5CURA 4B7UA 3VJRA 1W4RA 2FCRA 3T9EA 3U26A 3DLTA 3EA4A 2XQVA 2HH9A 1KOLA 3Q7RA 3JYNA 1FTQA 2GZRA 1C9YA 1XVUA 1ZUD1 5JDCA 3AF4A 3U1VA 5EA2A 1HV8A 4FQ8A 1ULZA 1V9SA 2O48X 3HNRA 2J0EA 4RH0A 4U2DA 2WT4A 4C6TB 2WB2A 4IFBA 4FHFA 1QIHA 5BV7A 2J3MA 2D8MA 1SZPA 2V58A 3LHFA 3PXXA 4NI5A 3TAXA 4Z1OA 4LQLA 3CRVA 4WXPA 2Q46A 4WASA 3ZKAA 2ZT7A 3EOBI 1BMTA 1NG9A 4PTZA 4KTVE 2V6JA 4IQ0A 4RMHA 1VPTA 2XF2A 4JYZA 1G6HA 3BK7A 4JI1B 3BL5A 1G1MA 5EQFA 4BC1A 1H1LA 3OT1B 2QENA 1MENA 4PS1A 4H31A 1HTWA 4K9PA 3TVDA 1E5LA 2QR2A 5KWEA 1KO7A 2BGRA 2P2YA 3E1SA 3U31A 4DR4B 3CM0A 1IJKA 5E2IA 1HH4A 1I3KA 3NQ41 1RCUA 3C3XA 3HL0A 4HWKA 4V0MA 5SY9A 2ABWA 2VF8A 2GMWA 1VE7A 3D7RA 4DL9A 4LFCB 4HV4A 5K0ZA 2UU9B 1A69A 3W06A 1F0NA 2DKFA 3BFKA 4WE3A 5IWCA 2X14A 2ZUWA 3DLPX 3N2NA 4YAOA 3AO0B 1MABB 3L8CA 3STYA 3AF3A 4RX1A 5J5CA 3DEJA 3EAQA 4M9CA 3GCGA 1ZRNA 2PJUA 1BHSA 2IY8A 3PE6A 1O9GA 4K3VA 4BQFA 2GF2A 2ZBRA 5E1OA 3NH6A 4IJUA 2PA3A 3SHVA 4X1YA 3E7DA 5ALDA 2QVLA 5AO9A 4DRXA 3KBBA 5L6MB 1Y6GA 1UKAA 1H2BA 1NLZA 2BR4A 3LLVA 4DRZA 3AVXA 4W82A 3VR5H 5K3SA 4B48A 1JB1A 4ZAXA 5LU9A 1GN8A 1V3TA 2RH8A 1HDXA 2HQSA 3HQ4O 1CUXA 3LBIA 4FCVA 3L18A 4PE5B 3H2JA 3IAAA 3WKEA 2XKKA 2HLHA 5EPEA 1X70A 2JC3A 4GI1A 1QGAA 1BX1A 1BU8A 4WY8A 1SFRA 1NVVQ 3IUPA 4UEJA 4BV9A 3CVWA 1XCOA 2CYCA 2JIZD 2KHZA 4GM4A 3U48A 3ACCA 1ND6A 2XNHA 2BLLA 3G5MA 3OE1A 3FNIA 4Y0AA 3W7AA 1RLMA 3MWLA 4C4XA 4R3UC 1SKAA 2PO5A 4MVXA 3O84A 1CB7A 1IY9A 2PKCA 1TMGE 3E22A 3H1BA 1E2DA 1KDRA 4YWJA 4M8KA 1Y33E 1JWLA 1O4WA 4CIVA 1YHZA 1V11A 1RVV1 3C3MA 3W8RA 1B1CA 4BLPA 4I50F 1LX6A 4MLDA 2FLKA 3ONWA 2VJCA 4KE6A 3L05A 3IULA 2H1RA 1JKJA 4LHVA 4WOKA 1D2HA 3BMOA 2CT8A 3VR2A 4JEMA 1EUZA 2BMVA 4Y2TA 1I01A 1R1DA 3IMFA 4FFMA 4QOJA 3R9WA 1L9KA 2XNDA 3MC1A 4YV1A 1Q22A 1MFPA 1ZSNA 3B89A 3G0DA 1OILA 4KQCA 4B31A 2H0AA 1X8JA 1GQ2A 2VT2A 1ZN9A 1G20E 1QP4A 1RWVA 1N6NA 2HF8A 3H3FA 2FSUA 1P1HA 2HPHA 4Z0TA 4DNQA 4DTCA 1OR8A 1BAPA 3I01M 4ZRMA 3A6HA 3GH1A 1Y48E 3GRFA 3FYSA 1D6MA 4LF5B 5REQA 2HA2A 1FTSA 1V8ZA 2DPHA 4CGYA 3W05A 2G82A 4TWAA 4QVIA 3CRZA 6ADHA 5CVDA 5FPYA 1IEWA 4QOSA 1TEHA 2MMGA 4OPMA 3TOVA 1GT6A 2I7DA 4S35A 3LF1A 3F71A 4G81A 4UARA 3SKXA 4XDZA 3UKDA 4Y6LA 3P9ZA 5IAEA 5BOSB 2RGNC 4NCAA 4MUAA 3IUNA 1SULA 1NDQA 2MOKA 2DFTA 2JLAA 4CM5A 4POOA 3VU1A 4UBOA 1Z5OA 2YWJA 3HEBA 1DRWA 3TOCA 3PLNA 2I2WA 4DQUA 3G2LA 4RVNA 1FYXA 4PVCA 5JMWA 1WCWA 3P97A 3WYBA 4FZ3A 2X7HA 3L02A 4FQ5A 3IKLA 1HQYE 1C7RA 1WW8A 2FZKA 3OIDA 4JC4A 5T4FA 3WKCA 5CCBA 3TFWA 1GTZA 2XBMA 2HMSA 1QVWA 4X8HA 5I4CA 5LNK6 3SP1A 1Z45A 5BNTA 4JSYA 4I5EA 5ULLA 5JNTA 2CLLB 2NZYA 5KJ1A 1YRWA 5DV9A 2O8FB 4DWOA 1QU3A 4DMKA 1Z8DA 4QE3A 4RK6A 3EARA 3O8QB 3GRRA 1BWRA 2DFVA 2OCKA 2VLBA 4L0MA 1SVNA 5EIAA 2ONJA 5B64A 5K3FA 2NO6A 3IXLA 3H1GA 1G6KA 1LSUA 3GLKA 5B37A 7MHTA 1VOTA 4BFVA 4BECA 1G291 4JGIA 1ZK2A 3GLGA 3TSWA 2PBRA 2VRCA 3IAFA 4LRUA 1M8KA 3FRHA 2QTVB 1EFHA 4A8TA 4JBXA 2Q1UA 4PIVA 5ALJA 1PJ4A 3PI6A 4A5SA 2K7FA 5I45A 1U99A 5FTKA 5AW7A 3C41J 1PBNA 2VAPA 4QO8A 1HDCA 5EHIA 5HDQA 1YIOA 3WMFA 1NW8A 5FKJA 4YT8A 3BEOA 4PGGA 4WN3A 4OKSA 3MGAA 3AW8A 2O59A 5K09A 1YE5A 3FPSA 4O4IB 3AFMA 4GM0A 4II7A 3N58A 3K9WA 1W0KA 1R27A 4OUDB 4OGLA 5J4KA 3AZPA 4FIZA 2OXCA 4JP2A 3T3NA 4C76A 2Y1EA 3S99A 4EA7A 3WWZA 1IWOA 1WQ3A 3D8TA 4BX8A 1KYQA 1NQAO 3KSDO 4YXWA 1HE1C 1FLAA 1IATA 3A1EA 3KPYA 1DQNA 3SEFA 1JR3E 3JW8A 1TFRA 4E7PA 4P3XA 1JH8A 1WDLA 4LJ4A 4MICA 3UJAA 2IYZA 3OIUA 3W90A 2OCBA 3K1JA 3H9EO 1G0OA 3U13A 5KWIA 1ZI9A 2OLEA 4HGPA 4HRYA 5EZYB 4KGZA 4XYBA 1P0IA 1GPAA 2QIPA 1QMPA 4Q34A 3I58A 3V1MA 5BV8A 1X9IA 3W9UA 1U1FA 2EW2A 3OUUA 2V7PA 3GRVA 4IQ8A 4PPNA 3QBJA 4WA8A 5DWDA 1VIYA 4O4JA 2GBLC 4JHLA 4CCWA 1JGTA 3I5UA 3GA7A 2W6ZA 3JALA 4DYVA 1SXJE 3URMA 4FDMA 2FJ0A 5C35A 1RRMA 1CVRA 1SQ6A 2H8GA 2CJXA 4ZO7A 4CG0A 5BOVA 4ZARA 3H17A 1S89A 5TJ9A 4J0HA 3K1AB 4YJ3B 3JS5A 2RHRA 5J2TB 3CRRA 1VPVA 3ESZA 4HQOA 4J9UE 2XR1A 3K1TA 2EG9A 4OYLA 3CUYA 5FFMA 3UHAA 1O77A 3IAM6 4ZALA 4WEQA 1BXKA 3QSYA 4MQFA 2ZKLA 3BZBA 1QS0A 3QVWA 1RQRA 3E58A 4K86A 1N2CA 4MPPA 1P7YA 1JXQA 1YUMA 3BN3A 1ZU4A 2HWKA 1BMFD 2O8NA 3AV3A 3UK7A 1DADA 4ZZ2A 4C4OA 3PDUA 5DHTA 5JY1A 2VQ3A 5JXGA 4DJDC 4OFXA 4X00A 1ODTC 3U5TA 2O2GA 3CPSA 4GVLA 4RADA 3C6MA 2XDWA 3NUZA 5K0JA 2W2KA 4MJLA 4MV9A 4E2WA 2P6UA 5A2GA 4BGUA 4ESEA 5HJ5A 1HQCA 3JQGB 3KWFA 4ENVA 1G9TA 1PT7A 2BFAA 1QLJA 2NWQA 3PR3A 3WQRA 4P2BA 2BZSA 3UHOA 5IUKC 2PUAA 3DCJA 2VCYA 1CXZA 1NXSA 2QRKA 3RJ5A 4B4OA 4AY3A 1Y34E 4J0QA 2H1SA 5KPDA 5JVDB 3MWJA 1AG9A 1Y89A 1XRNA 1JKXA 3AEUB 5H3HA 3ZH2A 1A9PA 2ZUFA 4NYIQ 3TCXB 3OBIA 2W6QA 3HCFA 1CHNA 2EDAA 2BFWA 4OATA 1SQFA 2GD1O 4H77A 3U7EB 3LHSA 4I9UA 4K9LA 2A33A 5EUBA 2G5PA 4IDPA 4P4TA 1ZOSA 2X0FA 1AQJA 4HYQA 3K0SA 2FPRA 5LD2C 4OI4A 3RVJA 1MOSA 2EKBA 3R3WA 1T0PA 2I4MA 3Q5DA 4AXBA 2ZJBA 2G63A 3HO6A 4ETIA 4MDHA 3TLGB 1ZVJA 4QTZA 5C7YA 4KXXA 4GRDA 2C5SA 2IEAA 4BZZA 1PWZA 4PLZA 3WADA 4FFPA 4EJSB 4HMQA 3LAWA 1FFBA 1C4KA 2DP4E 3MFQA 5G3ZA 1A71A 1QIKA 2ZKIA 3COZA 2AFIA 2AD5A 3GGGA 1ZH8A 2XJ9A 4I0WB 3SLGA 2TS1A 3BFJA 2FMFA 2G25A 4B82A 4YRNA 4PICA 4KN6A 4W8HA 3HJRA 3Q72A 1HSOA 3N5CA 4LMPA 4L73A 1IOVA 4QXRA 3QLTA 5AJYA 1NW7A 4KITB 2H1OA 4TM8A 3KM0A 2OC4A 2VDQB 3EGDB 4HLDA 9ATCA 1T8UA 3RRYA 5ICMA 1MUUA 1B1AA 2O6HA 1QIGA 4G36A 1A4IA 2WVHA 2VXBA 5G0VA 1AMOA 3V1LA 1BDIA 5KOYA 2M6KA 3VV2A 3FCXA 2Z8ZA 5EERA 3TR6A 3AVPA 3IR6A 4EELA 1QRUA 1SVIA 1U63A 1YIAA 2GBPA 1WKCA 5ALOA 4KE7A 1M1NA 1SU8A 2BEUA 1G64A 1ZRHA 2IXDA 3QEOA 3WIDA 1ZR4A 1R4NB 2P5UA 4XR9A 2O1XA 1LLCA 3UHFA 2R7NA 4IZHA 4EY6A 3QYFA 1RYBA 2B1QA 4HXFB 1VMAA 4LE1A 1Z4IA 3PQ2A 3NFRA 4JA2A 4MGYR 2ZIXA 3R6GA 5A6SA 3AEZA 1FX0B 1T1IA 3GMTA 3GVPA 3IFSA 3A4LA 2ID9A 1OU0A 3LSYA 4FOPA 2I2DA 4KIJA 4Z4CA 5F9HA 2I6SA 3O74A 4UAGA 4X54A 4QDOA 2PH1A 3RROA 4JQCA 2TMYA 2GXUA 4D79A 3A31A 2Y9MB 3NP7A 1XQ9A 2VHCA 2ZRAA 4TQ9A 2X9GA 5FDFA 2QYTA 5DYWA 4N6NA 2Z6VA 3KTOA 1CJMA 3QVVA 4KREA 3SN6A 1Z6TA 2IPNA 1TTQB 1G6OA 2Z95A 3FM9A 3H99A 3LNTA 4FOSA 4JBHA 4QXPA 2DH5A 3NHRA 5JT1A 2Y99A 3NOVA 4U5QA 4NJEA 5HKLA 4KDFA 1OKKA 2HJGA 4JUBA 1G2OA 1CQXA 1VSUA 1IN6A 2QGNA 4BU1A 3EPHA 1EESA 3CF6R 3RQIA 3GEMA 2G7ZA 2PS9A 2CNNA 2F1RA 2PCLA 2JRCA 2GZ3A 3EFEA 3N75A 1GCOA 3EIHA 1H5UA 4PXAA 1KGSA 5KVQA 1SC3A 4MI3A 2GYYA 1YFJA 2DBZA 3CT4A 3H9BA 3LQQA 3RRMA 3W2IA 1IJFA 4EWLA 5BNWA 1KQNA 3H2HA 5DCLA 2WICA 3PIIA 3O7MA 5K05A 4N0QA 5JNVA 2JCGA 4DIFA 5BN3A 2CLMB 3MUFA 3ZD7A 1PKEA 3H84A 2EFCB 3AV0B 1X0XA 2FDCA 1L5SA 3NJ4A 1T0BA 2QX8A 1R0CA 4KWTA 3B7PA 3TLAA 2VI5A 4E4TA 5A6VA 1JYFA 1NAIA 2H00A 2RHCA 3GJ4A 2RGXA 4DYDA 2QY6A 1HG1A 2B30A 5A9RA 3GLUA 5KDDA 1W2WB 4TRMA 3RSOA 1ZN2A 2F9MA 3ORRA 4MGKR 2O1EA 4AYXA 4OAQA 4F2HA 4XIJA 2BMFA 5CLGA 1WSBA 1JHUA 4X7PA 3ZU2A 1BYIA 4IICA 3VSCA 2Z9DA 4CMBA 4EGQA 5DX1A 3KQNA 3L8DA 2N3ZA 1DIBA 2FN4A 3CRW1 4B5LA 4OXQA 1GZ3A 1N6IA 1Z17A 2V3WA 3FWKA 4L4ZA 4AN1A 2BH9A 1NX6A 3T7RA 3CB4A 3UK1A 4NCBA 1O1YA 2P11A 3PLRA 1T6YA 3ZZUA 4C08A 1EXWA 2N1MA 2NAPA 1O94A 1VLLA 5HM6A 1H42A 4CQMA 1EXDA 2Z9CA 4F7DA 5HOQA 1IQPA 1JAZA 2ZYAA 5D85A 1E4VA 3ROQA 3ZHXA 1N9ZA 4CCYA 3HDGA 3B7GA 5K0CA 3IXQA 3PYXA 4PRKA 1RHMA 2BHTA 4JL6A 3E4DA 3MAGA 1IIRA 3EYAA 3CJQA 3OO0A 4WA7A 3CH5A 3M82A 4ZRDA 4G5SA 5B55A 2WUVA 1MX5A 3FHLA 2H7XA 3ROPA 2Q6TA 5KNBA 4IVNA 5EMLA 1FU4A 1TK2A 5LJIA 5K0BA 2YCBA 3HXTA 4N7JA 4HDAA 1NBHA 3DV0A 2C2HA 3PF8A 1PRYA 5DP2A 1J23A 3RU9A 3USCS 3ZIAD 1B15A 5HZMA 1STOA 3BG5A 3CLHA 4MQ5A 1FRNA 5ITZA 1RAGA 2JGLA 3GLHA 3LBHA 4P7KA 1C9DB 4BGDA 3B82A 4CL2A 4EAQA 2GPYA 2WJJA 2X0IA 2VIIA 1TM3E 1U4SA 2F4NA 2G1AA 2AMJA 3DW1X 5C5EA 1ODJA 1A27A 1T2FA 1SHUX 2VF5X 4QATA 1KI3A 1P5FA 3PQ3A 5K8UA 2ZXUA 1V6CA 1P29A 4L4XA 2DKNA 2ZCVA 3PBKA 4BZPA 2BMWA 3TB6A 2SCUB 2DPMA 3WRYC 4QZVA 2ZBGA 4QEDA 4HX2A 3L01A 3HU3A 1YJAA 4LTDA 5HK9A 1XLTC 3UJ6A 4KBFA 1U4OA 5LQSA 2A5DA 2ZT5A 3U4MA 3FGOA 3D6NB 1M2VB 4I55F 4OL9A 2EKZA 4PINA 3EIQA 2QT9A 2IZ6A 3S2SA 3WOHA 5DBOA 3I2JA 2H08A 3Q7SA 2Z4TA 3LQRA 3RYIB 1GNRA 1JZSA 4GICA 1K68A 1UAYA 4UJ5A 3P7MA 3P0HA 5AJXA 1II8B 2X8LA 3BSWA 4RE6A 4JYMA 1NUTA 3GN2A 1NTOA 4QXOA 1NUSA 1RW4A 4U63A 2HPVA 4Z9XA 1QDUA 3A9TA 1OY1A 4G4GA 4GL4A 4UTRA 4JJEA 3VAZA 2QRVA 3WGMA 2ZZMA 3OTWA 5CIWA 2ZRNA 1RRFA 4LRWA 3O8OA 3T8YA 3U7FB 5CCEA 5IKOA 1QFMA 5I4IA 1WB6A 1YGYA 1FFWA 2QYSA 3CN9A 3HNPA 3OA0A 2IYTA 3PC8A 5THQA 3TX6A 3TSYA 1H65A 1L5RA 1TKAA 2YC2C 4KQEA 1NKTA 1QG2A 1GNVA 3ZOKA 4B71A 3KPJA 4QDJA 4GMDA 1FFEA 3GZNB 1GN9A 3RS0A 3SS9X 1ISMA 1OFHA 1NP7A 5K3OA 5CYFA 1DJMA 2QRMA 1JX6A 1Q83A 4QRDA 1ZPDA 5FTNA 4GMXA 3GHHA 3RHTA 1A1SA 5D5HA 1JH9A 4Q9NA 4QRIA 5JRJA 4R9SA 1X80B 2BPOA 1FJXA 4CZ2A 1O97C 3ZE1B 2X8JA 3WNQA 2NO0A 3TXAA 1O5TA 3A2LA 3BGSA 4UAJA 1SA0A 2ZR0A 3TL6A 3UATA 4D9JA 2UZ4A 5TVGA 1AMUA 3THWB 5JWHA 2BEWB 1QGDA 1R4MB 3F6PA 4UHFA 2XOKA 1RJWA 4ETWA 4FD3A 1MX3A 1W52X 3HJAA 2IYWA 4JOCA 1VQ1A 3BJRA 1GZ4A 4AF7A 3TPCA 2OT3B 2ATIA 2BOVA 1C29B 1VIDA 3ONDA 4QGHA 4EA6A 4TV9B 3RB8A 3U39A 4O4IF 4MUYA 4YH1A 4F21A 2WUWE 4C3OB 3B1VA 3RKSA 1SK8A 5CVEA 2JGEA 2EXXA 3GFPA 2QD1A 1E2PA 5DEOA 1RYYA 1V0JA 1DXQA 2BDTA 2GNAA 3A6JA 3M4YA 4G41A 4M88A 3R9KA 1DHRA 1PZMA 1WE2A 2CD7A 2D5LA 1GZSA 1HYEA 2OFPA 3BHIA 3CXUA 4Y2PA 2I3AA 4URZR 3OFND 4KCGA 1PU2A 2BEKA 5EKTA 5IJAA 3TGWA 1E1QA 2PUEA 5F98A 2IYPA 3ZXXA 3L41A 1M6VB 1FVXA 3D0RA 5TSDA 4GPIB 1NW4A 3IP8A 3ZK7A 5EZYF 3C87A 3S2EA 3Q9NA 1UJ4A 3T3DA 4TWZA 2Q8PA 3CB2A 3A9UA 4R0MA 4M99A 1U98A 1J0EA 3PGXA 1TZMA 2O8BB 3OQPA 5DULA 1D7AA 1ZXLA 1AD2A 2PPLA 4KNWA 4JUDX 3P2KA 3LCRA 4Y6SA 1TT5B 3HUUA 1RQXA 4MHSA 3OE4A 3SX4A 2PUDA 2YYAA 5GPBA 1QO0A 1I94B 2ODBA 1T4MA 4YJGA 1JJBA 4YJ3F 2X58A 3V7FA 1FSGA 5CA1A 5EMNA 4JFAA 5DI3B 5CGQB 5J2TF 4E3WA 4JVLA 4ER0A 1JHAA 4O1IA 5D2CA 3O5AA 4M8IA 5ARDA 2V5AA 3DOFA 3BQNB 3VC7A 4CM9A 1VE3A 1Q0RA 3UOAB 4E22A 4Z7OB 3STUA 8ATCA 4LHYA 3CRNA 2WU8A 2H7YA 5BMVB 3M1AA 3OLCX 1H0SA 5FUXA 2OD2A 4M9SA 1NUAA 3HO1A 4BN4A 4ZJZA 2ZYVX 2YXPX 4QYSA 3DB2A 1DG1G 5CU7A 1I7LA 4ZQCB 4WLFA 3DXFA 1I3NA 3K0KA 4FYMA 1TUIA 3L6BA 1DWQA 1U8UA 3RUPA 4JC5A 1G59A 1QTQA 3GZTB 5DXFA 1ZGGA 2WM3A 3FLMA 2G4VA 2IHJA 2NO9A 4ZO8A 1RWNA 1NJSA 1SCNE 2V7VA 1LA2A 1XPUA 2NUPA 4F71A 2OUKA 1YQUA 3QKSB 3KXDA 3HL4A 1GU7A 2J6BA 1T4BA 1DKRA 3E8MA 4C7OA 3DMPA 3L1UA 3M3HA 1D0VA 2EX0A 2DFDA 2XSZD 3BXGA 3LPCA 4LWPA 5DI3A 5BPHA 4C4TA 4M1WA 3C7KA 4MV1A 4W9NA 5JVDF 2HMVA 3DMNA 3OIYA 2ZPAA 4P22A 2BIFA 3BIFA 5FBVB 1QJ4A 4ZIRA 5ESRA 4M49A 4MRPA 1W30A 2XRMA 4LRYA 4MVJG 2BYTA 2FKNA 3CT6A 3OY7A 2PZEA 4QICA 4IWYA 4BNNA 5EMKA 1KO4A 1T9DA 5JSZB 4EABA 4ZQHA 2K6GA 4LC0A 5FUQA 2FFHA 4HWTA 3JX9A 4JJ7A 5I7VA 2X4IA 2AN9A 2WLSA 2X1LA 3CEAA 3JQFA 3EEOA 1IY8A 4LZLA 4O2AB 4HP8A 2W0MA 3D8HA 4RY8A 1OGYA 2OG1A 4L0CA 4NPHA 5JU6A 1HGXA 2HREA 1UBHS 3GOQA 3U0VA 1QBKC 1W47A 3A1WA 1NJGA 4Q66C 1B26A 3FKJA 4D4MA 4EPYA 4RTOA 1GTRA 2FX2A 2XX3A 1CY7A 3AY7A 4LYHA 3E5MA 3IA7A 2FY8A 3D4NA 2Y0BA 4GOND 5EKSA 2ZR8A 4RIFA 3ZCVA 5F73A 4CEJA 1J0BA 3HXOA 1LXCA 1TCBA 2A8YA 3BJIC 1PT5A 3D0QA 1WVIA 4RCYA 4BIMA 4LGVA 1KPHA 6REQB 1ZRSA 2EQBA 4RF5A 4IMIB 4D9HA 1GD1O 4F5EA 7GPBA 3U6KA 2VDPB 1PJSA 4RVGA 3L7DA 2AGVA 3BIJA 3JQPA 3MJTA 3TTTA 2RBGA 2XOEA 3LXUX 2Q3MA 2Z1MA 4CIXA 4E5YA 3JQCA 5H5JA 2ZFUA 2IEYA 4MWZA 2HL6A 3L8MA 4LYEA 4EHKA 3EUAA 5D5QA 5FPTA 4ZDIA 5AVTA 1EQAA 2X41A 2YVUA 4YAEA 6LDHA 2X22A 3R3ZA 3TNYA 1P75A 1PUJA 5IVKA 2CEAA 1KYIA 3E5HA 4TXNA 4YDRA 4M86A 1H6AA 2ZP1A 4NAVA 5HX7A 4AVYA 5E8RA 3NT4A 4YUXA 2O3QA 4FGWA 2VHVA 1U28A 3HUEA 3J80A 1ENOA 1L4KA 1RDFA 3HKCB 1YAHA 2JBWA 5G4LA 1SZJG 2ATXA 1XLVA 3NORA 4CVNA 1XTBA 2FSVC 3V1UA 2IY7A 2FH5B 2MYPA 1AKNA 4MCJA 3G8BA 3V55A 2GH1A 4DWJA 4C0QC 4HVCA 4FDTA 4YPVA 1WHTA 3K4PA 1MQSA 3PHHA 3OAAD 1SBZA 3M6LA 1UXOA 2VRBA 1KNXA 5LR6A 3U4IA 3H2IA 1YMQA 2NZUG 3T54A 2FPXA 4KK3A 4ZOLF 1KEWA 4FFWA 4Q7QA 5JRDS 1AQYA 3TCKA 5JANA 1T1JA 1W5SA 2JA2A 1N2SA 3H04A 4JL5A 4OBXA 3GW8A 2J45A 1OSNA 4Q7JB 1JTVA 5GJWC 4Y7DA 2Z2KA 4INAA 3L7BA 1JEDA 2LRHA 3X2FA 3WXBA 4DUPA 1CZUA 1NF8A 3B9PA 4AZVA 4NBVA 2UYCA 3A2MA 2FN8A 3PNSA 3WDSA 2ATEA 3QVGB 4M89A 4MVJD 3TSOA 1JQ5A 2WD9A 3FYCA 2X3YA 2F6RA 3UNXA 1E3MA 2I7TA 1Z7EA 3GEHA 4UNIA 4U0JA 1WPQA 2QVZX 4LJ7A 4BB5A 3JASB 3UCFA 3QUBA 4R71A 4U3JA 3ZK8A 1L4NA 1OI4A 4MA4A 1Z4MA 3MOIA 4IJ6A 5C8VA 3RSFA 4EJSC 1O97D 5FD8A 1AUOA 2GRJA 4DANA 4C2AA 4DYHA 1OBVA 1MA0A 1SCKA 2HDOA 2SNIE 1CQJB 2AE1A 1NMSA 5G4KA 1VJ0A 4HI0E 2FF5A 4X64B 2A86A 4QJ5A 1G66A 5LYJB 1KYZA 1PS8A 3GFRA 4KVFA 2I54A 4UUNA 2Q07A 2WAXA 4COOA 4XD7A 5GAJA 4BNDA 4HQ0A 2YWXA 1FE8A 1KIAA 1XXLA 4PSVA 1AV7A 2C8JA 2HHJA 1GGFA 3FFWA 4RD4A 4NFYA 1HDEA 2YL2A 4P53A 1P9RA 5L6LB 3V4RA 4FBMA 3L7MA 2FMUA 2REXB 3OZXA 3QBTA 4PX2A 3RH0A 3ZV6A 5DN6A 1TM5E 1H2XA 1XRJA 2OUIA 1CUFA 1YUNA 3BRQA 5HE8A 2ZI5A 1NBWB 3T3MB 1EUQA 2V4ZA 1Z7WA 2QRQA 1V7CA 1RYEA 4ER5A 3QJ5A 1P5HA 2I2AA 2GLUA 3I3OA 5EE3A 3ZD9A 1WX1A 1QH1B 2VTKA 4FJ0A 3KZMA 2C9ZA 1EFRD 2QQGA 2PH7A 4MIOA 4PZZA 1UJCA 2I1WA 3VR3A 4BEWA 4F4HA 2JL1A 2YXLA 4MLCA 5I8ZA 3JQ6A 5IH3A 5D1NA 1Z5GA 3ISTA 3KEFA 1PJAA 4Q4AA 3ZDCA 3MT0A 4GBMA 3H5TA 4HN9A 4MXDA 1YDMA 1P6UA 3UWSA 3KZNA 1XMVA 2DOKA 5IXYA 2BKVA 1PNRA 2ZE5A 2CDCA 3ACBA 4I4IA 4LOAA 1MEEA 4GR9A 2YJZA 2AEFA 4HO1X 1TVMA 2P2SA 3CLTC 3IAS1 5HPYB 4D9NA 1UKCA 4PSAA 1ESNA 3RC3A 2BHNA 4F7WA 4MHOA 1PZFA 3IAHA 1V41E 1VKRA 2JG3A 4OVKA 3A1TA 3GU3A 3WGQA 5IC4A 1EUYA 2YFQA 4MLZA 5AVSA 3MLAA 2TMDA 4RD3A 1E2KA 4BCBA 1X7ZA 1GP2A 2FZGA 5C9ZA 1P1CA 1TC1A 2WPDD 1FA9A 1YOVB 1XD2B 3M89A 1K8YB 1UCFA 2VK2A 3E9QA 4YRJA 4TLEA 1JZQA 1XYVA 1X7HA 3A37A 4PM4A 1G5IA 2A58A 1XU7A 5EYPA 4DA7A 1VPDA 3NBKA 2VPYA 3RVDA 3H9CA 1QO9A 2CGEA 2G9ZA 4Y1EA 3EXFB 4W63A 2BJVA 2OCLA 4YQYA 3QE3A 4P9NA 3D3WA 3V4ZA 3I9MA 5H59A 2R2GA 1RE1A 1YA8A 3RANA 3P20A 3KOOA 4P7BA 4QREA 2WZCA 3PHBE 2O2YA 1NVMB 2QOEA 1T1SA 4MI9A 2GK3A 1VJ1A 2A0UA 3F6RA 4LF6B 1KMMA 1QZ3A 1JN0A 3IPLA 3IRUA 3QBEA 3JYLA 5FL7A 3RS8A 5KO2A 4ZU1X 3P9PA 4TWJA 1V3UA 2C2ZA 4OQPA 2Q3CA 1OLOA 4LZJA 1VHTA 4HLNA 8ADHA 1PNQA 3K7EA 3O4RA 3GUYA 4KDRA 1N4AA 3E3AA 2GXSA 5ALMA 1ECBA 3ZZ1A 5A4AA 4AKHA 3C4JA 1X8XA 3L9WA 3LUCA 2VNHA 2GF9A 5KTMA 3CXRA 2PQMA 3UANA 1ID8A 3FR8A 3I62A 2GKGA 4MINA 4C2UA 2Z2JA 4D8YA 4EL0A 3F7TA 2VDOB 3OOJA 5LP6F 1E2HA 4BQNA 3Q3IA 3K05A 2XEDA 4TTAA 1CFJA 1UBNA 5DHFA 3WWPA 1C30A 1GADO 2AC4A 4CNBA 4DR7B 3KYDA 1YK1A 2HEGA 3R3YA 3QXJA 3AR4A 4KIFA 4KLCA 4QUJA 1DLIA 1RQNA 1ZJ6A 4K7JA 1JG3A 5LP1A 1O89A 1I6WA 4IZ6A 3WL5A 1WF3A 1KPIA 1B6GA 2IKQA 2C1ZA 4TLMB 3V6MA 4ISBA 2QROA 4OO3A 2RIRA 2OXTA 4CR7A 1RXYA 3FBTA 1JB9A 2B3DA 2HAEA 3QOWA 4V39A 1EIZA 1KEEB 3KU1A 5AVVA 3CZAA 4IZOA 4ZAVA 2EJBA 4O08A 1VYVA 1GPH1 4CTOA 1XVIA 2CLOB 2DE0X 2EHDA 4P6VF 2R8ZA 1X74A 3OE5A 4TV9F 3P9IA 2ZCJA 2F8MA 1YRBA 3EVCA 1OH6A 4IRMA 1Z2PX 2O0MA 2W11A 1XTJA 2JH3A 3HRKA 3NRCA 4AJPA 1CT9A 1T5DX 1UZLA 1TO2E 2PAFA 4FNGA 4G8CA 4JCOA 1VIMA 1WPGA 2Q3HA 2B4TO 3CF4G 3RBVA 4EP1A 1L5VA 5KSZA 1C3OA 1A1VA 3GEEA 2DWPA 1Q74A 4JX9A 4ND5A 4O4LB 3OZIA 1BE6A 2V6IA 4GBED 4NMLA 1I5OA 4C0BA 4AJEA 3VH3A 4RHEA 3DFUA 3S28A 2ZRFA 4IH4A 2QRLA 5G53C 2OO3A 3RTCA 2C9DA 3K9BA 3SC2B 2JVJA 4OUKX 1J49A 2ECFA 1RQ2A 5F52A 1K86A 3L1VA 1K5DA 4UZEA 4C7BA 2WSMA 1V7PC 2JAHA 4DM4A 4G24A 4UE2A 1HMYA 4UE6A 1BXRA 5HFNA 4ERXA 4DDUA 3NBMA 3O8CA 4Z99A 1XJ0A 4P54A 2OWEA 4RU1A 4ACBA 4ARZB 1ATIA 1YIDA 5KYTA 4J7UA 2YW2A 3AUYA 5IM5A 3T1VA 1Z4JA 2DWUA 1RT9A 3PCXA 1HE3A 3LM8A 1QIEA 3PL5A 4GDMA 2VBFA 4Q1BA 2IZOA 3RIMA 4ZI3A 2VJBA 4GD3Q 3FW1A 4HAWA 3MWEA 4MUIA 2V7EA 4RDIA 4QASA 4D3SA 2B61A 4F1JA 1JKFA 1CV2A 5TMEA 4JI7B 3R0XA 4F92B 5BR8B 1KH1A 3NYIA 4HAVA 2RGYA 3OHSX 4ANFA 4F86A 1I4WA 2HJWA 4GYYA 4UM5A 4RSRA 2FUG1 3DDZX 5BSMA 1DEAA 4JB2A 4RAQA 4XX0A 4HGRA 1S8AA 1YZGA 1VSQA 1FUEA 4EQ6B 3NGLA 2QRGA 3OQJA 2GERA 1VL0A 5FPHA 5BSTA 3EVGA 4TPKA 1A5BB 4RK0A 1X1EA 3C7CB 1FTWA 2XTZA 3NDJA 2OG2A 2PMKA 1N1DA 2IHZA 2WQZA 1YRHA 4BB0A 1Z0FA 3R3VA 1VLQA 3EY9A 3DVAA 3FF1A 4GLJA 5EPUA 5TQ2A 1NVBA 1TADA 5K51A 5IDVA 1GDTA 5JH7A 3U16A 4M1QA 5A0VA 4FK8A 4IX9A 5JC8A 4BMVA 1GVHA 4PF1A 4M2LA 4OLFA 3EH2A 4KHPB 3ABIA 4DWVA 3G23A 3QHAA 1ANKA 3COJA 4KXYA 4Y2GA 5F5LA 1T34A 2V8BA 5B1EA 4W1RA 3E0XA 5D1HA 3JQBA 4WNAB 4PLPA 4A82A 4Q4DA 4O2LA 1I6KA 1J8QA 1NVTA 3RBAA 3A6KA 4BMNA 5A4JA 4TS4A 2I1LA 1Z2NX 1K8XB 1FFSA 3UW3A 4G0ZA 5A0TA 2I7XA 4MB6A 3FX2A 1IDN1 3G85A 1IJBA 4FI3F 1H93A 3ESAA 5BWLA 3VJLA 5DHPA 5A03A 1TF7A 1ZINA 3H8WA 4FCCA 4IIJB 4TQAA 5AQEA 3ZE2B 5K7SA 5LZ8A 1PFWA 3VH2A 4CV3A 4L5YA 1U3WA 3QNMA 4G0NA 2RARA 4DC9A 1FRZA 4RDHA 3RADC 4WUTA 2X5NA 2HSDA 4ILKA 1FZTA 1TU3A 3ENKA 3BH7A 4JV5B 4NATA 4MYCA 1P7WA 3R7WB 4TV8B 3CSDA 3G8AA 5EC8A 1ZGBA 3QWBA 4B44A 3FTPA 1A9RA 4MRNA 4ISCA 2WUGA 4QDZA 4ZOBA 5AKXA 3AF6A 3CLTD 5CVCA 3ESQA 1UK6A 3EGOA 2JLWA 4QPCA 4LJ6A 4YIKA 2IYEA 2O7SA 1M2EA 5HKBA 5BNFA 4Z4QA 1QQ7A 3OKCA 5P21A 4IP0A 3KJIA 3RHSA 1IDOA 1N6OA 2RC6A 2E5WA 4EATA 3WR5A 4Q0MA 1TMOA 3TS1A 1IZ8A 2JFHA 1N2ZA 4O3FA 4I1SA 1NWHA 3BTUA 3R8FA 4FCTA 5AI5A 1HE5A 2ZVQX 3SBOA 2BFMA 4TXHA 4UM9B 5EP4A 5B4VA 2AJDA 5HQ3A 5AI9A 4TYWA 3RUDA 1OWOA 3F6BX 1Q95A 3W5CA 1U2DC 4H1VA 1QPBA 3UJNA 3Q0IA 1ZGZA 3D8UA 3FJYA 1L5NA 1IZZA 1VLMA 2XXJA 1CY1A 1RYDA 3ZWOA 4ESHA 2Q0XA 4G0PA 1JUDA 5H16A 4EG0A 2HU7A 3HU5A 3HB9A 3ERCA 2W2QA 2QAJA 3KALA 4KRFA 2VL7A 3AGPA 3DL2A 4RMNA 5AHRA 5I9IA 2J3LA 3QF4B 2JGRA 3EDYA 3SQNA 4RTLA 1JHYA 4FHEA 2ZWPA 4I66A 4PHTA 5K1ZA 4RA6B 3HM9A 3NW9A 3TW6A 1WXWA 1DL5A 2PD3A 2HWXA 1CUDA 1UEXC 3CZPA 1N33B 2I2XB 3AEKB 2IXTA 4DNXA 2D4HA 4IS3A 1XJWA 3ZZTA 4RSMA 1DUSA 3I5MA 2B0CA 2ZYSA 3WY9A 3WWYA 3I04M 1K7FB 3IVAA 5IKXA 4HUTA 3MILA 5KHAA 1ECFA 3TIVA 1FSZA 5AJVB 2O2IA 3TUIC 3Q1KA 5K6TA 1Q3HA 3WOVA 1J8VA 1CKEA 2FOXA 4NEHB 1RXUA 5K8JB 4FI3C 5AKIA 2F8LA 5AWFC 5BYAA 1IULA 2BTQA 3B52X 4IDDA 3JRNA 4XOIA 4MVWA 3GEGA 2I62A 3P4UA 3PE4A 5AOAA 2PD6A 5H80A 3G89A 5CAEB 2P79A 4OI0A 3RE1A 4I4TB 3ZU3A 1R0SA 2YIJA 1WHSA 3PXDA 3AXSA 2Q0QA 3TX2A 4DMRA 3BE5A 5LYJF 2XV1A 1Z39A 1E61A 2J0UA 3VPBA 3OJWA 2PGJA 3WRXC 4ED9A 5JD5A 4RMIA 1Z22A 1P3Y1 4TKZA 1TQ8A 3K4QA 1RI1A 4IOJA 3HYSA 4O59O 4RD0A 4I8IA 4EVSA 4CM8A 2QF7A 3KETA 1Y0BA 3FMFA 3LDUA 2IVZA 2GZAA 3GVHA 2R66A 4ZEXA 5LQDA 3D6TB 2WRZA 2NNLD 4B85A 2ZOSA 3C7TA 3QGMA 1YU6A 1V39A 2BGGA 3DHVA 4HAIA 3U3MA 4XIFA 2BGIA 2QUZA 4AJNA 4IJ5A 4BLQA 5ICFA 3LIPA 5TF4A 2ORYA 4MS4A 1D1SA 3U9LA 2WD7A 4BNZA 3NBQA 4IDAA 3K0FA 1HR0B 2DBQA 2JLCA 4XDYA 1QRAA 3G2JA 4YC7A 4WFIA 3IEPA 5DTIA 1M2KA 4JI8B 3HCCA 5TQ0A 1DFHA 2IP4A 2QIOA 2L42A 5HW0A 2R5FA 3ZDRA 1X1RA 4AD8A 1EK5A 2KW5A 4A26A 3ICQB 1KMHA 1KI2A 3LT5A 1Y4DE 3A3YA 3SX2A 1C7JA 1XA0A 1ZSVA 3T34A 1OLSA 3CR3C 3NV9A 2B9EA 2X76A 3KKNA 2CJWA 3C6ZA 4GM1A 3ZQUA 5HR5A 1OAKA 3HMQA 1VMIA 2CWWA 1LLQA 2CXTA 3KLBA 4B3GA 1WXGA 4RH3A 2RKBA 5TXGA 4K6OA 3IX7A 3F3SA 3OX1A 4OB7A 4RGBA 1AZSC 2GA9A 1UMBA 3TYXA 3UMBA 2H65A 3QZUA 1S2MA 1CS4C 1K0FA 1MIOA 3AKCA 1KVQA 2Q6VA 1SPXA 2JBAB 4A0QA 1I33A 2OESA 3I01A 4W1SA 5ALIA 1X2BA 4GGPA 4W6ZA 4XIGS 4YMIA 3R7FA 4J76A 5L3QA 1E0SA 6NULA 2F64A 2OAGA 4ZVLA 2QP3A 4FLEA 5FPSA 4EUSA 1MX1A 4TS3A 3I6ZA 4R2XA 1BU5A 5HZGA 3O2JA 1CUZA 3TZEA 4XJXA 1RD4A 2XKBA 3S0JA 4CODB 4G5FA 3T41A 2RGWA 3NALA 5HMLA 3OLQA 1NAHA 5DIZA 3F4LA 1PG5A 1SCBA 1YDEA 5JISA 4J3JA 1EK1A 1G8YA 2PRZA 2ZYHA 3L0YA 1NPYA 3F5SA 2NU8B 2UZ1B 2WUEA 1R0ZA 2B4RO 3JVVA 3MMXA 1NF2A 4GFDA 1QDLB 2NU6A 4RMJA 2Q7XA 3OURA 1MQ9A 4Z0HO 5FUBA 1JHOA 1C2TA 1GIAA 1Z6PA 1GA4A 3SOZA 3IQXA 2HMAA 3K5IA 1SZCA 3H1TA 4D25A 4ZI7B 3L0PA 4PX9A 4BQRA 4CDMA 1WZUA 4CT0A 5C3MA 1FLNA 1Z5VA 2AR9A 2KSQA 4YPFA 1YR1A 2GQ0A 1AF7A 4L7VA 3TQRA 3IJPA 4CIBA 1H3EA 3N2GA 4GMHA 1U1EA 5KYXA 2UAGA 1A7UA 3O4FA 1TUBB 2DYKA 3UKJA 1KH2A 1NDHA 1CRZA 5IVPA 4XQGA 1IZ0A 2X0EA 2WV7A 3IILA 2H7VA 2BFCB 1FDIA 3PT9A 5L3RA 2VN8A 1ESDA 1TLTA 1XA3A 1FDVA 4TVOA 5B57C 1RM4A 4PYNA 5C5DA 4MPDA 2E55A 4MQEA 3WHKA 4EG7A 1KFKB 1RZ3A 3O7WA 3I28A 3RAGA 4S1VA 2OQVA 3MRTA 5AVUA 3G5AA 3KHSA 2XA2A 4HBGA 4R7GA 4N6GA 4GOMD 2E2WA 3RFTA 1NVFA 2J59A 2OECA 5EHNA 3GT7A 5F5XA 1W0JD 4RTNA 5DP1A 1XF1A 3ENZA 5CH3A 5TPZD 3CJRA 3IPCA 2E4AA 5E1MA 2CUZA 3FYUB 4C4SA 1KIFA 1E8DA 3HLKA 1IQUA 4DR1B 2ZXFA 4YBZA 4R0NA 2X4LA 2EGHA 4MCAA 4ZEVA 2O19A 2Q5OA 1NC1A 1DCFA 3KVRA 1CZOA 3PQ8A 5DBGA 2Z2YA 2I87A 4X65B 2VBIA 1GUFA 2H4JA 5BSVA 2JB9A 5F9MA 1W59A 2OCAA 4F3CA 1AU9A 2Y1OA 4N3AA 1AA9A 1V71A 2EZ9A 4KPUA 4XLZA 1LS6A 3HA5A 1PJZA 2RBEA 4ZO6A 3ESYA 3SVZA 2O1WA 3WVNA 5FBZA 1ESMA 2F43A 2JI6A 1JDPA 3GJQA 4U9HS 1TKBA 3W6PA 3EF0A 3QITA 3AUXA 4CL0A 5K6AC 1GLGA 3O8DA 2WTUA 1ZHOA 3DBHB 4TTRA 3KZXA 3BSYA 3S2FA 1CCWA 1RHUA 2ACEA 5COQA 2FSPA 5KMGA 2C3UA 1ZIYA 1NT4A 4HQKA 3WBJA 3AUTA 5DOZA 3SS8A 4PC6A 4ZYZA 2BY4A 2C00A 4IVQA 2FG7C 2G77B 3PRJA 3TG2A 3OPNA 2IQIA 3EPPA 3GRCA 1N8SA 1Z74A 1LH0A 1T8TA 4ID3A 4KGDA 1JPUA 4JLNA 4M4SA 2P7IA 5HGJA 4YUVA 2XUIA 4BLTA 3X1DA 5CB8A 2DQSA 3HFRA 1THGA 1E3EA 2IY9A 1W49A 5D51S 5DVZA 4ZANA 1HLPA 2QL7A 1AKWA 1A9OA 2W70A 4B4WA 2R1VB 2VSFA 2O57A 1OXMA 2J3JA 4IDBA 4DLUA 3OQHA 4NVRA 5J2UB 4LMRA 1ECJA 1OTXA 1EXMA 1DQPA 4UAUA 3DUFA 1G19A 1SQ5A 2YNMA 3M1IA 2J7PA 2X3UA 1VM6A 3EVEA 3Q87B 4DLWA 2OA0A 2CKMA 2D59A 3DTYA 5AK5A 3WLTA 4MYSA 1ML4A 3T61A 1EK6A 3PTAA 3O8NA 3QJYA 4L2IA 3SYMA 1JAYA 1EDDA 1RYHA 3DLIA 3LHIA 4OH7A 3R40A 1VHLA 1ILEA 2XQJA 1ZEMA 4XWTA 4TKMA 2J85A 2VEOA 3ANYB 2B8JA 2Z30A 2H5LA 4G2TA 4LBWA 4P0QB 1RI4A 2B4QA 2LDXA 3ILVA 2V1XA 5FULA 3DXXA 5KNDD 1K3TA 1ORWA 3MA0A 5KNCA 1LBHA 4DJ5X 2WFMA 1CU1A 3AR5A 1XU9A 3D3NA 4CJXA 1DUIA 2I91A 2QAGA 3NKVA 2PZ8A 4DSNA 1H5NA 4UUQA 1YQ9A 5EWMB 4LCBA 2PK3A 1PVOA 1L4LA 2YXNA 3K5PA 1HE4A 3THSA 4NS1A 1NOKA 2W6MA 3WLQA 3MT7A 5B3JC 3KSZO 3P9CA 4U7HA 5I7RA 2JLUA 3PUWA 4DKXA 1IHXA 3DVSX 3EISA 3F8TA 4K6KA 3UJHA 2ZSIA 4QGAA 4HBZA 1FMFA 2WQ6A 4LHWA 4CTJA 2PFKA 2CFSA 2HT6A 3OM8A 4D42A 3B2EA 1DO8A 2DHDA 2ZAOA 1ZHFA 3AR9A 1RLOA 1CQWA 1JS1X 1FMLA 3QE0A 3HU2A 3MCUA 3UN1A 3RAPR 1E0JA 1D6SA 1M67A 2GD6A 3MQ2A 4ZI2A 4D98A 1UBSB 4IJVA 3FVWA 1BX0A 2E4XA 3GJ3A 1LPSA 4OU4A 3QVSA 1YZTA 1NQOA 3AI1A 3QFRA 4YP6A 3I5YA 1EX1A 2VJAA 1QHGA 2VPQA 2BGNA 4IIJF 5EIXA 4BP3A 1QB7A 2CXRA 1ISSA 2MINA 1WXEA 1QBGA 1YVDA 2XI4A 3E18A 1Y1RA 3LW8A 4KYUA 3ZV3A 3F9CA 1T3ZA 2Y66A 4LYGA 1BVUA 1KSJA 2A9RA 4XVQA 5HCUA 4D5GA 4ABYA 3VYSB 4R6XA 5EJ4A 3PCTA 4TV8F 4LDPA 4PYLA 1PFUA 1PFVA 3OCJA 2I7CA 3HI6A 5FOQA 3FDZB 4OSEA 4U7PB 1KJ8A 4ZT7A 1Y4UA 3VHXB 3M6XA 3UZUA 1KY4A 5CX1B 1A4XA 3H0EA 4RLSA 4EGFA 4P08A 4GMKA 1PWXA 1QQTA 2EG5A 4DLBA 1LV8A 4JLUA 4KXNA 1IU9A 5FBWB 1M8FA 1IN5A 3BWCA 1RJFA 2JCYA 4Q7MB 2DWOA 4JKOA 4P92A 3PS9A 4XWOA 4Z8YA 3I53A 1S7GA 1XI2A 3PQCA 3BRCA 3ZJUA 5KIAA 1XRRA 2C59A 4G01B 1O87A 4M9ZA 4JQZA 1MXHA 5JADA 3O82A 5GIOE 2P3SA 5BUZA 1G20A 1LPPA 5E7IA 3F9RA 4URWR 4NMMA 1X7DA 4WXHA 5FADA 4MR9B 4H35A 1N7JA 4M7PA 1Q1BA 1R5NA 3T3GA 3LOPA 4KDCA 1UWVA 1LJLA 4JWTA 2PYDA 5CD9A 3I2IA 1LPMA 1CJTC 5M2QA 3QENA 4IRUB 3VC1A 2O2JA 4HFNA 2X4GA 2SECE 2H4FA 3DDUA 1CR6A 4J0EA 4UE3S 3IOMA 8OHMA 4F96A 3NOXA 1P44A 4JZYA 4KSYA 3LWNA 2A9KA 2OL4A 2REQB 3ZS9A 2FQQA 3N5KA 4MDEA 3T7SA 4R2LA 4X7RA 1MAUA 1YQXA 1NL3A 3MTIA 1QGED 2IA5A 4Y2YA 5EWJB 4AX8A 4CKEB 1E0DA 5B30A 5DDIP 5DSZA 4GVPA 1FTYA 4YV0A 3LPNA 621PA 3KE8A 3DO5A 4R84A 4AZWA 1PKXA 3OFVA 3PZRA 5AKZA 1YXMA 2PL9A 3D1JA 4M7OA 5DHSA 3TBFA 3ME5A 9ABPA 1QVVA 3NXKA 4R1LA 2WB4A 1AK9A 2AUMA 1OBCA 1OHHD 3ENNA 4TMYA 4YP9A 3TFQA 1F8UA 3FMIA 4Y2RA 1IRXA 2PFGA 4J94A 3WYDA 4F04A 5KOIA 2GM9A 4KMOA 2C77A 2QA5A 2UZ3A 2Z8YM 3W5UA 3DUWA 3L2OB 3TR5A 3E15A 1GUYA 3EGCA 4PFKA 3SEZA 4K3UA 7YASA 1M2FA 1RRKA 1BW9A 2B82A 3I23A 3ZDFA 2DB3A 1ND5A 1EKXA 3DNFA 4I4TF 3UH0A 3D6AA 1UDCA 3WSTA 1OX6A 1YI0A 5JJKA 2Q5CA 1XVVA 3KB6A 4I4CA 2K7ZA 1GPDG 4PSUA 1OAOC 3KQVA 2RK3A 4ZYLA 4EJMA 1HZZC 5A04A 3QXCA 4GSKA 3AI2A 2COUA 4FFBA 1QHXA 2WU4A 4IMRA 3RRFA 1BCSB 2PBLA 3Q7TA 3SYRA 4RE5A 1WTAA 3OJ0A 1NRJB 3JRXA 4JGBA 4JKIA 4RJLA 2DQKA 3HVUA 1U3UA 1DNPA 1Q14A 2TRSB 5E4TA 1RHKA 4GMGA 3DL0A 4JUAA 4I14A 1PT9A 1UEIA 4Y9RA 3F4BA 2DM6A 3LWZA 3BQ9A 1GFIA 3L5OA 2QZSA 5DCYA 3BWYA 3V3KA 1KDYA 4YCNA 2DWQA 1U11A 5D3QA 4ZOEA 4KG7A 4FSXA 3WQQA 4B2IA 1JR3A 1ADFA 5DK6A 2QRNA 4GP9A 4OQMA 4R1TA 4UXJA 5BWNA 2D8AA 4HNRA 2FOIA 3QVUA 4M54A 1H9BA 3LC2O 1R9GA 1TD9A 3OMXA 1BVRA 2JJ1D 4K26A 4LZAA 2IX9A 3EAGA 3H3JA 3INNA 5IULC 1PWEA 1XZMA 2X0RA 4FFOA 4I8XA 3ZDQA 1JDSA 3WGJA 4JYCA 1Z2DA 1NIPA 1AO0A 4EEXA 2ASEA 1B0PA 4X93A 3GJXC 5ENZA 3V8RA 4M6WA 2JAPA 1DAIA 1SXJA 2RK6A 3WICA 1K06A 1VG1A 1W5FA 3TKYA 4DMCA 1DAEA 1ZESA 3ZHYA 3KQKA 1KMNA 4OYRA 3S5UA 4DCGA 1I3MA 3O93A 2G83A 3ND6A 2A9VA 2QXTA 4XTRA 2CLDX 1HURA 3JWIA 3MELA 3WBBA 4JI4B 4FSHA 4LISA 2Q6LA 3KAKA 3SSAA 3MFYA 3S29A 3ETLA 2JLVA 1FYDA 1HYQA 2G36A 2ZUCA 4Y0NA 2G9RA 2IYVA 2Y1LA 3EZ2A 1ZR2A 3QJGA 2PZBA 2VDKB 2HI0A 1Y3HA 3M8KA 4G0OA 3VPFA 3KDAA 2E4WA 5GJBA 4QM7A 5BSEA 1F2UB 1QHIA 2HA6A 2I6GA 1DBIA 4OQXA 4EG8A 5ALUA 1TT7A 4RS3A 5FI0B 5JQGA 3EZFA 1U7HA 4P4SB 3KOXA 1Z0UA 3V4FA 5EJGA 4CIWA 4BJHB 2XEXA 4JY7A 1SWVA 4YYEA 3VHRA 1U0GA 4G1MB 1BHO1 3D4PA 1CG6A 1RYZA 3KZOA 3DE7X 3M5CA 4ERNA 4N3CA 1V43A 1M7HA 2CXXA 2PIAA 3RHFA 2M6RA 4ZI7F 4F85A 1QLHA 3LUJA 3QNWA 1SUDA 2C5LA 1NVKA 1A95A 1OYOA 1VL2A 2C7VA 3PA6A 4QYMA 4BMXA 4IW3B 5HUQA 2DCMA 3DP7A 3NT2A 5H9WA 2JHFA 1ZK0A 3RYTC 1CUJA 5TMBA 3UWDA 4FR0A 1Z15A 3CUTA 1IQ0A 1Z75A 1YUBA 3DDCA 5EJFA 1LBIA 5DE3A 4DMLA 2BM1A 4EKNB 2C2WA 2QE7A 4JR2A 4TUYF 5FORA 3GJ7A 3WKAA 5HKOA 4KO4S 3CG4A 1R0WA 1WDMA 4YDQA 4XDGA 3WLSA 4QWMA 1Y5MA 4G6ZA 4I46A 5F3RA 2PX8A 1F8YA 1RWOA 2WILA 3LFHA 3H13A 5E6UB 1QRSA 3ADBA 1XXHB 2I8CA 3D8NA 2PX0A 4DCOA 3R7LA 1SGWA 4DJFC 4ZYVA 4YIHA 3CZ5A 1TW2A 4CDNA 1PSZA 5KDLA 3E2IA 3EVBA 2O1SA 2ODTX 2H7CA 3CWCA 4UMDA 3AKEA 4ASUA 1LRKA 4RPJA 5IAGA 3U40A 4EBBA 1KAMA 4LQDA 4MPRA 2ZBQA 4RV5A 1ZDMA 2HDWA 1Y8RB 4E21A 5E0OA 2G1UA 4P5PA 3P45A 3TXXA 2RG7A 4C2TA 2GSWA 3LA8A 3G9ZA 4WACA 4XSVA 3SGLA 2FK8A 2PKRA 4QPZA 3RSLA 3IP6A 4KZPA 4DC1A 1M6YA 2A88A 3PHCA 4PSKA 2JIBA 4MWOA 2UYHA 3DLCA 3ITNA 4H17A 5AQ1A 3EJWA 1RWWA 3EC7A 3HJBA 1VG9B 4YMWA 1HNWB 3TDMA 4EGSA 3ECCA 2IUSA 3SAJA 3JYPA 1RWBA 3IOCA 2VTEA 3UJ7A 4MKZA 3FZEA 5LBUA 2QN6A 2JK1A 2Q2NA 3GCWA 1XCPA 1MD9A 4G89A 4M8NE 4UKDA 3GDFA 3OX4A 4RK4A 3DYBA 4TXJA 3G2MA 5EP2A 2CLHB 1TF5A 4ZV7A 5T3UA 1GU1A 5E7JA 1TIPA 1RXSA 2PRKA 3I42A 2DPGA 2BEVB 2E3JA 3D1VA 3CLRC 1CF2O 1P0FA 1ZCBA 4UTVA 2ZJ0A 3IMEA 4M87A 5C8YB 1SU4A 1ZEJA 1TIKA 1DOHA 1E7SA 4FD2A 2FF7A 2W2NA 2W90A 3HA3A 3OTGA 2V7WA 1ZJ5A 1G42A 2XZDA 3UT0A 5KJFA 4V1CB 4FXPA 3OC6A 1NRWA 2WWTA 5EGSA 3OM1A 4CXMA 3CW9A 5CD1A 2NP6A 2V7TA 3H18A 4B34A 5C7OO 2E5LB 2R4TA 4Y6PA 1IEVA 4TMTA 3MCTA 4OU5A 5J2UF 3E7FA 1N2BA 1ZXXA 2PLNA 4QTXA 2XUQA 3HH8A 4ZMBA 3LY7A 2KYRA 1NUUA 1P4JA 2GVNA 1E9VA 3GEIA 3H1EA 4I6EA 4CLDA 3SQMA 1R0XA 4HGYA 3KKZA 1P45A 4O2AF 2XYHA 3LD9A 1USIA 2P1ZA 4KI0A 2O0KA 1N5OX 3W2TA 3ZV7A 1Q44A 1SVLA 2DFNA 2NIPA 2PJDA 1SOVA 4CTKA 4KGXA 6YASA 1U5BB 1EVEA 5KCMA 3SXUA 1SIOA 1SKUA 2J6HA 4HUQA 1Y5LA 2H57A 1XZAA 4B6GA 1I2MA 3A6LA 5EIBC 3GH3A 1RZRD 3U9SA 1SG9A 4IKOA 1X1BA 1JU3A 4GT1A 1IM5A 3W3AA 4R51A 4YRRA 2ONZA 3RNLA 3T9AA 4BXOB 2CXSA 2Z58A 4IIHA 3W6UA 1BDBA 4UBMA 1UP6A 3AESB 5E6SA 4GO1A 3JWEA 2FGJA 3M6UA 2YJ6A 4TZ6A 1OB2A 1RJEA 3T3PB 3PUKA 3QHQA 1JEYA 3AF1A 4NFLA 1XK7A 5HDBB 4AY2A 4HNAB 2BAGA 2PBZA 1L8QA 1QPGA 5B58T 4ALKA 2EKQA 4RLHA 3FYUC 2P4SA 2EIHA 4FJ2A 3LCVB 4CNQA 4CRWB 3T94A 5GY7A 7ABPA 5ES4B 2XCQA 1E4EA 5TX7A 5FFFA 3ROGA 2J8ZA 3EXAA 3M6IA 1K63A 3KOUA 2RMKA 3OLZA 2OV3A 2GCPA 4DMFA 4MQMA 4FW8A 3OLWA 2XVAA 3CYFA 5D84A 4B43A 3A3PA 3OCXA 4QBKA 4KO2S 2J32A 3WYAA 4CPDA 5FH9A 3NBUA 2DY1A 1X1AA 2ZSBA 4L76A 1YFZA 4NAUA 1J5XA 2RHMA 2XY4A 3R0VA 2EC5A 1V6AA 4LN1A 4UREA 4WZBB 2PS1A 4XVRA 4DHEA 2PFSA 4KLNA 2QKYA 4C43A 4RM2A 2CXNA 1GZUA 4ZQBA 1DJQA 3IOYA 4MUXA 1RQPA 2OLJA 1JIXA 3KDSE 4MVJP 1P17A 2A4KA 2A78A 3LY8A 4UNSA 5G0WA 4P4UA 1HLGA 4QOIA 4UM9D 1L5HA 3JAWA 3N70A 5AJHA 1ZBQA 4DVJA 3BWXA 3GQBB 1K7CA 3JR7A 1N5IA 1NYRA 4U00A 3T7JA 4DCTA 1G21E 5EJ5A 2ZBDA 1GRVA 1TCVA 2E1RA 4RSHA 1UDAA 1U2RA 5DHRA 5LMZA 4EJ6A 2H4WA 4RL4A 1ZHHA 1Y8ZA 1VI6A 1W1UA 4GBJA 3FTCA 1G8MA 4AKGA 2J08A 3ZWXA 3RDPA 3GGSA 3HKBA 4TKUA 3EIWA 4DLSA 2Y1KA 3N05A 1D5WA 4WXEA 6CHYA 3MCVA 1L7XA 1JHPA 2PX3A 3EZ7A 4IM7A 3CISA 5EWLA 3W7BA 4BQEA 5JI2E 4UHHA 4X85A 1BDHA 1DTEA 3W9YA 1PL7A 1TF2A 3KZKA 2H59A 4PAMA 3ZS8A 3FPGA 3D0OA 3IUYA 3QW2A 4NSNA 2WKSA 3C1OA 4NZNA 2VZ9A 4JJ6A 3O90A 3A10A 2CMGA 2CNDA 3GGPA 4LDZA 4EI2A 821PA 3THXA 3VZBA 1EG2A 4IGAA 4G2NA 4LY0A 4C21A 1U7TA 2BKLA 3C1AA 4YACA 4MIEA 1FSPA 2RGCA 3HU1A 5LA6F 4N40A 1AQ6A 1QE3A 2W6ID 2VYNA 1B6RA 1OMOA 2I2BA 3GJRA 4IHJB 4QXAA 5L53A 1UMKA 721PA 3UMRA 3DGEC 3H6GA 3FFBA 3QUAA 4HQLA 3JD4A 2W42A 4TMKA 4W7IA 3SOPA 1RRPA 1LDEA 3PQ6A 4IZIA 1S6YA 4X94A 3E5NA 1T9CA 2P27A 3LVRE 3SZRA 4MWEA 3NVMB 2QTMA 4GX2A 2P4EA 3SSOA 1KS9A 3F2VA 3EIFA 2VF2A 2Q0HA 4A3SA 2QK4A 3CO0S 2PXHA 1WQ4A 3ZU6A 1K88A 1EQ2A 1E2LA 2J3IA 3A9WA 4HDSA 4OOEA 4QFDA 5GM2A 4CKCA 5K0FA 2PGLA 1HDIA 1YULA 3GJ5A 4P98A 3VA7A 3AI3A 3PPIA 4WFJA 4Y67A 2VNJA 3QX9A 2XCSB 4J2OA 1FTGA 2AI1A 4FE4A 2DPXA 4I50A 4NU5A 3BFPA 4PR3A 2HUNA 4ND3A 1FZQA 5LZ9A 4MTLA 3R6TA 2CV1A 1GQQA 4RVOA 3VYRB 5G0SA 2HDNB 3L4BC 2JBHA 3CEPB 4MVJH 3R6DA 5HIAA 2A67A 4WY5A 4E88A 1WZ2A 1T8SA 4YUAA 2ZSUA 4HB3A 3RO7A 2XUHA 2QRZA 2Q27A 3Q6IA 3AM1A 4CLRA 3PRKE 1GL6A 1GPJA 4X9XA 1KXZA 1N9KA 4HDNA 4QX6A 1T3GA 2J0VA 2VZEA 4B3FX 2AHRA 4AG6A 1TRHA 2ZYUX 4RKQA 3GA0A 4E5UA 3DE0X 2C04A 2EVWX 3TO5A 1Y82A 2ST1A 4GEGA 4QC2A 2DLDA 2QMHA 2FFRA 2WYOA 2ECQA 5J4VA 3ORYA 3K6SB 5KTYA 2ODWA 4RZUA 1JR6A 4F11A 1G5RA 2VA9A 1J0CA 2HA4A 4AJIA 3QPAA 1CEYA 4RTKA 1RXEA 5FHRA 3L4JA 3CV3A 2NQTA 3B3GA 3NHKA 4BTLA 3FH0A 4HNSA 3REGA 4S24A 4DQLA 2FZEA 3LVFO 2QG9A 5KSPA 4CQNA 5SZJA 4N65A 5KQMA 1TMKA 2Q2QA 3B2QA 3GZ4A 3JQQA 4UEWA 3SFZA 3V1KA 1U7WA 5C5CA 3Q98A 1BDJA 3GG9A 2LKCA 2VR1A 2WBLC 2AK2A 1ZOPA 1S02A 4KODA 4F5DA 3ED5A 3GC6A 3FG9A 3P0FA 1YCDA 4ND8B 4U4AA 2AFRA 4E0BA 4MV4A 4NZPA 1G63A 1SBQA 3FWZA 1A9ZA 2O2SA 1NZFA 2MSLA 5F7JA 3CLRD 4N47A 3TOXA 5AVXA 3AVVA 1GILA 2BM8A 2PPVA 1XPRA 1E2GA 1EPUA 4AX4A 3SNHA 5EXTA 3EULA 1JT9A 1I2CA 1OWNA 3TINA 3OJOA 3MHTA 3U17A 4D45A 4CV0A 2Y6VA 2WG2A 4QHTA 4CKWA 5HUHA 2PA0A 3DCIA 2H29A 2JGNA 2PMWB 2QY9A 2OORA 2R8YA 4QG7A 1P7VA 3DONA 5J40A 3E27A 2F9LA 4KACA 5LCXA 1NONA 1VPWA 2Z4SA 4F4JA 5GINE 3IIIA 4WAUA 4ZK2A 1WXXA 3LP5A 4F8JA 1ZNWA 2HXGA 3NHYA 5ALRA 1AKRA 1E3QA 2UVPB 1C8LA 2XZTA 3DVRX 4YA6A 1GY8A 4KR0A 4MP6A 5HMMA 1A76A 3DH0A 3DMRA 3FHJA 4CLXA 3MF4A 5A1JA 4MWTA 3AGQA 4C0XA 3AB8A 1P33A 5LNK1 4PHFA 1YNSA 2W7TA 4BNFA 1WU7A 1SBYA 3ZZ0A 1NUQA 5BQOA 1OV6A 5KJCA 3UMMA 3QU2A 4ALNA 4C1NA 3LKZA 3RVRA 3PYMA 5JCOC 4ZPJA 1X8LA 2EATA 5EIBD 3HJNA 4G67A 3CUKA 2PD4A 1N0VC 1AC5A 4OI2A 5FWYB 3MMZA 5CGZA 3ELYA 3WMXA 1U2GC 4RYLA 1H05A 4FMDF 4GQAA 4WMLA 4F9TA 1VJDA 1UMCA 3E3OA 5CXXA 3THYA 3GWZA 4F5YA 3HV0A 1WCIB 5B7QA 5M34A 3O1LA 3D2LA 1OIVA 2DHEA 2P6PA 1P8AA 4QBHA 4X8LA 4XQ0A 5JSFA 5LB4A 4JL8A 1VXRA 4DIKA 2FW6A 3E9YA 1OBOA 1P2GA 3QXSA 4P86A 4R81A 4A23A 2ACKA 3M6MD 4UTZA 2NT4A 4WJKB 1EQUA 1JJFA 4XGIA 3ZJVA 2I3ZA 4G8JA 1P62B 4WOBA 3ZLBA 3CA8A 3RVQA 5IZCA 4WZAA 1I1OA 2EAUA 1EE9A 2R1ZA 2YHIB 1IZYA 4IGKA 4KTTE 4KIWA 4LECA 3I83A 3SJCA 1W76A 3R3HA 4L50A 5CMLA 4AP9A 1THZA 2X0NA 4HZUB 5LQKA 4J9VA 1P3JA 3MJ4A 3JWGA 1LZLA 2V7UA 1EGMB 4NBKA 1SCUB 4LSMA 1TZ2A 3LK6A 4NRDA 2X7JA 4JS0A 4N8SA 4G1CA 1DI0A 4QOEA 5ADUS 4WKPA 3MD0A 2NADA 3G59A 2PMBA 4YLEA 2I6UA 4CEHA 1NRIA 1IE3A 1PTJC 221PA 2PUVA 1T2DA 4HDKA 5HCIA 2ZQYA 4WXMA 5BQPA 1F4PA 4D4KA 1CE8B 1RC0A 4ZHQF 2WTXA 1DMSA 3OKAA 1EUDB 2V96A 3WK6A 5FFNA 1MIHA 1EWKA 4V0LA 4PC7A 1RRVA 3NOOA 3RVKA 4ER7A 4DPMA 1TQ2A 5HS4A 2AZXA 3CZ9A 1L8OA 4PCLA 4M0FA 1RKQA 4LMAA 5ECGC 2CE7A 3K9LA 1FF9A 1O95C 3WGZA 2D7CA 3N0RA 4V0OA 3W5VA 1MA3A 1TCUA 5GONB 4LCEA 4IAOA 5ITVA 1FNSA 2PS3A 3WI7A 1Y8QA 3TB4A 3W5JA 3DBRA 1G8KA 2BFBA 2HIHA 2ZR7A 4OMUA 1L7MA 4KQ1A 1N78A 1J21A 1C7IA 2JAOA 1FNMA 1YHNA 3PWKA 3AG5A 1L7OA 2BC9A 1U2ZA 1L1RA 5DRTA 5E9AA 4UXIA 4AQDA 4YRCA 4DJTA 1DFIA 4J1QA 4N76A 1R5JA 1H3FA 3L4SO 3KJXA 4N3BA 4BS9A 5IC6A 4ZKEA 3TNFA 2ZI6A 3DZBA 1TZKA 3RU3A 1ZS9A 2CL0X 2RD2A 1RXCA 1TVKB 2QR5A 2JLSA 2V65A 2J9FA 2YJ5A 5EZQA 3UVEA 3VH1A 2YOGA 4C6RA 1T9KA 5ES3A 2P7HA 1OVMA 2DFKB 2NW6A 2K2WA 5FTMA 3RR2A 1EWVA 3B53