2A0YA

Structure of human purine nucleoside phosphorylase h257d mutant
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANDEEVLAAGKQAAQKLEQFVSILMASIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neighboring group participation in the transition state of human purine nucleoside phosphorylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 85
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a0yA00
5F77A 1RT9A 4DABA 3ENZA 5DK6A 2XRFA 1CG6A 1A9PA 3OZEA 3P0FA 1RYZA 4NY1A 4L5YA 5F78A 1A9QA 4GLFA 4F2WA 4PNPA 1V41E 1K27A 1PWYE 3KUKA 3PNPA 1A9RA 2OECA 1SD2A 2ISCA 3D1VA 2IQ5A 3UT6A 4LDNA 1V45E 1OU4A 3UAZA 5EPUA 2QDKA 1Y1QA 5CXSA 3BSFA 1ODIA 2GUWA 1RFGE 3IOMA 3FWPA 4DA7A 4OGLA 3QPBA 3TL6A 1JE1A 1Z37A 5F7JA 1VHWA 2A0WA 5B7PA 3MB8A 5F7XA 3OZDA 5F7ZA 3PHBE 1JPVA 1PK9A 1Z5PA 4GLJA 1A9OA 3DDOA 3ONVA 4WKNA 4H1TA 3T94A 5B7NA 1TD1A 3NM4A 4TXLA 1PR2A 4GKAA 4TXMA 1I80A 3OF3A 1Y1SA 1TGVA 1SQ6A 1VFNA 1YQUA 3K8OE 2QTGA 3UAVA 3K8QA 4JOSA 1T8YA 4R2WA 1LV8A 4TTAA 1Z39A 4F3KA 1JDSA 4QAQA 3OCCA 1PR4A 3O4VA 4M7WA 1ZOSA 1B8OA 1RSZA 2AI2A 1RXSA 4X24A 4LNAA 1Z33A 4M1EA 4EARA 2B94A 5C80A 4MARA 4MCIA 4EB8A 1SD1A 1N3IA 5CCEA 4YNBA 1Q1GA 2HRDA 3FOWA 1A69A 3KU4A 2OC9A 4DA8A 3UAWA 1U1CA 2P4SA 3KVRA 1T8WA 5F76A 4E1VA 1V2HE 3NBQA 1YBFA 1SJ9A 2PGAA 4U2KA 3GB9A 4BMXA 1YQQA 1RXCA 4DANA 1Z34A 1YRYE 4YMLA 4WKOA 1Y1TA 4OY3A 2I8AA 3OOEA 3PNSA 4L5CA 3U40A 1RXYA 3MMSA 1TGYA 1VHJA 4OGKA 4G89A 4UC0A 4DAOA 1VMKA 1PK7A 1Y6RA 5CYFA 1G2OA 1JDZA 4RJ2A 3C74A 2OC4A 4I2VA 3UAYA 4QATA 4TXNA 4NSNA 3E0QA 3FNQA 2I4TA 4QFBA 4FFSA 1RXUA 1ODJA 4L5AA 4D9HA 2QTTA 1V4NA 5EFOA 1PW7A 4P54A 1JDUA 3IEXA 1OTXA 1JE0A 4YO8A 4ECEA 1A9SA 1T8RA 3NM5A 2A8YA 1NC1A 1V3QE 1YR3A 1XE3A 3E9ZA 4BMZA 3PHCA 1JDTA 2Q7OE 1OUMA 2QSUA 5CYGA 1Z35A 1JYSA 1OTYA 4JWTA 4F1WA 3EMVA 3ODGA 5F7OA 4D8YA 1Y6QA 4GMHA 4G8JA 3FAZA 4YJKA 3E9RA 4DARA 1T8SA 1CB0A 5IFKA 1RR6A 2A0YA 4TXHA 4JP5A 1NW4A 2HWUA 3BGSA 3KHSA 3P0EA 1PF7E 2HSWA 1LVUA 4LZWA 4DA6A 5IU6A 1ECPA 3FUCA 3EUFA 1T0UA 5F73A 5CXQA 4LKRA 4D8XA 5ETJA 1OVGA 1ZL2A 1V48A 1U1DA 5K1ZA 3NM6B 4WKBA 4L0MA 4D8VA 1WTAA 1Z5OA 1PR6A 4M3NA 4R31A 3BL6A 4TYMA 4NS1A 3DF9A 3F8WA 3DP9A 2OXFA 3EUEA 3DPSA 1C3XA 3DJFA 1U1EA 4DA0A 4IP0A 3INYA 2AI3A 3KVYA 1Z36A 4BMYA 4QARA 2H8GA 5EUBA 4DAEA 1PR0A 3OZBA 1FXUA 3EEIA 1JP7A 1LX7A 4TS9A 3SCZA 4QEZA 5JPCA 3FB1A 4LNHA 4L6IA 1PR1A 2ON6A 3LGSA 1RCTE 3BJEA 1A9TA 4BN0A 1TCUA 4QASA 4F2PA 4OEHA 3LBAA 4TXJA 3OOHA 1Y1RA 5I3CA 5CCDA 4K6OA 4TTIA 5FAKA 4TS3A 4D98A 1K3FA 3O6VA 1JDVA 1PKEA 2AI1A 1QE5A 3KVVA 1M73E 1K9SA 1ULAA 4TTJA 4PR3A 1NC3A 2QPLA 1ULBA 1B8NA 4F3CA 2RJ3A 3OZCA 2BSXA 4KN5A 2HN9A 4G41A 1U1FA 4MCHA 3GGSA 1U1GA 5B7GA 1Z5NA 1ODLA 1Z38A 5B7QA 4WKPA 2AC7A 4R2XA 1TCVA 3UAXA 1ODKA 1PR5A 2A0XA 5KB3A 1OV6A 1PBNA 3OPVA 4OF4A 4WKCA 3LA8A 4OJTA
chains in the Genus database with same CATH superfamily
1B0UA 1FFGA 2L0XA 3KZKA 5KBYA 2HEIA 1Y3DE 4MAAA 2QX7A 2XUFA 1TVMA 5F1OA 3RRFA 3QW4B 4Q4JB 3L4EA 1C9EA 2IQIA 3IP9A 3TK1A 1MB2A 3AP3A 1DNPA 3FYSA 1QGUA 2Q07A 2P0AA 2QVLA 2BL4A 1GTJ1 2XUQA 3NNNA 4UMDA 4OH1A 3COWA 3ZNOA 4HNUA 5GJWC 4FR2A 4Q3KA 4URWR 2MSKA 2PRKA 3WYNA 3D4OA 2NZ8A 3P2EA 4FIZA 5A7FA 1E5XA 1Z0JA 4ZOBA 1V71A 1Y4UA 5KQRA 4F2WA 2IDJA 2ZJZA 1QHNA 1X7ZB 2Q6IA 2IEGA 1X77A 4I5EA 4DQ0A 3CU5A 2BYTA 5HGJA 3MMZA 4V24A 5B6JA 1XJWA 2CFTA 1JPJA 1NUAA 1UDBA 1Z8FA 3OWOA 3VDRA 2G8NA 4TYPA 2Z5VA 4Q03A 4PR0A 5ITZA 1IWBB 1A9XB 1ONPA 1U02A 3DW1X 2LXNA 3Q7EA 3MWJA 4I0WB 3KNZA 4W9MC 3URKA 3CKLA 3KZNA 3NDRA 3RRNA 2RH5A 3QY0A 2DBYA 4P4NA 1YS7A 4TZKA 5JMPA 1Q0SA 4L75A 5K20A 5JCJA 5D5HA 3FWNA 2A3NA 1SHLA 1G7CA 1MQ8B 5HTKA 2HGZA 1KOGA 4QC2A 5EVJA 4B2LA 3GBPA 3WGVA 2IW3A 3VSBA 2W22A 3ENKA 3HG7A 3MA0A 4JX9A 1WD5A 1I1QB 4HCJA 3AR2A 4QJ5A 4Z4HA 1EXDA 2ETXA 1IBLB 2CNNA 1QCDA 2AR9A 5A0TA 3G1WA 3KCNA 1BQEA 2R60A 1ZXXA 2J6IA 2OYSA 3F5MA 3PDWA 2FG7C 3PDIA 1AE1A 3DYIA 4WOJA 1KNXA 3VDQA 3VU0A 5L9AA 1DRJA 4MWEA 4BNWA 4AJOA 3DOUA 4CM4B 4CKBA 1SRQA 1EM6A 4JEIA 4G2NA 4A8JC 2P6RA 1T2UA 1NVWQ 2X8LA 3STUA 1E3QA 3KQVA 3MUOA 3WYFA 4UBNA 2H57A 1E6UA 7MDHA 3HDQA 4UVDA 3D3JA 3V3KA 3GZ4A 4ZGGA 3WMXA 4DQVA 1Z25A 2CFRA 1NE7A 2LWIA 1Q0HA 1TZKA 4J76A 2O0MA 3EDMA 2ZRCA 4MW4A 1DCTA 4JAVC 4WKNA 4ZEXA 2X6RA 3TLZA 2XXBA 3KOXA 2OQVA 4Y2JA 6ADHA 1FP4B 3QEMA 3WL8A 4I50F 3FYTA 1KVRA 2H4YA 2QXYA 5CX1B 4CEHB 1R1DA 3E9NA 1EK5A 3ZD6A 1AGNA 5DB4A 1YK1A 3IULA 2Q5HA 3U3DA 3ET4A 4GI3A 1EFCA 2A1IA 3ML1A 2FPSA 4RABA 2ZWAA 4CG0A 2BDUA 3QITA 2GS9A 1TUIA 1HE4A 2BW0A 1XX6A 3GJ8A 2A30A 4HDAA 3IDQA 1SQ6A 1SQSA 2DVMA 1Z0AA 5TMBA 3TZEA 3EMDA 1TAGA 3STTA 2J3LA 1DKMA 3QWHA 2EBUA 3GRZA 1PYOA 1EEHA 1R2QA 3PT9A 2A5YB 2NU6A 2OGTA 1BDMA 4OQPA 4GOND 2ATEA 2KX7A 1JS1X 2YYAA 5ALSA 4BY9E 2JJ8A 5HFJA 1T0IA 5ALOA 3U7IA 1ZUHA 3CG0A 5EIFA 4EIWA 2JFFA 3DLPX 4YP5A 4F3KA 2EIHA 2XOXA 3HKBB 3ONEA 4ETIA 2I2WA 3GCZA 3GMTA 1U8TA 3RS5A 5A6SB 4O59O 3EPHA 3PZBA 3VR4D 2PUGA 1FFYA 1Y4DE 2J09A 1BEZA 2VCYA 4PVDA 4XQCA 3OY7A 4IQ4A 5A2GA 1OT3A 2BHLA 2Q7XA 3B1ZA 2C4TA 3BAFA 4FYWA 2D7DA 2BHNA 4LJ8A 3HA2A 3VZRA 1Y37A 1GKYA 4V39A 4AP5A 4MQFA 4UCFA 4IF4A 3S1SA 3K70D 3NUGA 3HWWA 3LO5A 1DG1G 1Q50A 3ZNNA 3RT7A 2FMXA 1R37A 1SELA 3I45A 3V6LA 1JFTA 2DFTA 4WOPA 3R4VA 4H1VA 1IL0A 1E4YA 3F4BA 1NYRA 4ENUA 3KSUA 4O5OA 2X40A 3RFCA 3UXYA 5JJIA 1SU8A 1ZOOA 3RR2A 4KC0A 4LC1A 1N3IA 4K81B 1D1SA 2ZYSA 3DXZA 3E3OA 4J2HA 2QRUA 4GRDA 3FOWA 3THXB 5LU8A 1EBBA 2ZRGA 3OLYA 4DA8A 3UMVA 3QE2A 1FMTA 1X7YA 2O52A 3IEUA 5F33A 5A6SA 4X6UA 2Z8ZA 4GGOA 3JAWA 3UWOA 3ZYZA 1C80A 3WSTA 2Z83A 4L0QA 1RBYA 2HWXA 3D81A 1I7PA 1PSDA 1WMBA 3B9RA 1TI7A 4QHTA 4RA9B 2NUTB 1UBCA 3MCWA 4ASUD 4CEJB 3U39A 4IOKA 4B3GA 1TVEA 3SSMA 1C4KA 2OCXA 1KZ6A 3BL8A 1OAOC 1JFRA 1EUDB 3VMFA 3T5GA 1FP2A 3MD9A 4DJTA 1AB6A 1C8VB 4ZVLA 1Z4LA 2GEDA 1OOEA 3LFHA 4Y30A 1W29A 5DHUA 3DO6A 3Q7QA 4C4XA 5AIBA 2JGDA 2ID9A 2XQJA 3A28A 3NBZC 4QSMA 1JEEA 4MJLA 3UAOA 3LRPA 5JARA 3E84A 3WGUA 1UJ4A 5DTEA 2YWEA 3IMFA 1CC1S 2OD7A 2FR1A 4Q1EA 4R83A 1FLDA 4AMYA 5EIWA 3BD8A 1RXYA 4PTYA 2DR3A 2HDWA 4XPZA 3SZGA 2FN4A 3SF8B 3Q3CA 3DB2A 1XZCA 4EI8A 1VHJA 3WLHA 3R3YA 3OKFA 4PCVA 2G80A 3R74A 3CSDA 1AKNA 3A4NA 4K9SA 2QVZX 1EZ4A 2PSDA 3LE8A 4TS1A 4WACA 4BCBA 1OH7A 1PJSA 4H31A 4A27A 2OO5A 2AMLA 1WSDA 5FH9A 2I5PO 1Q11A 1T1GA 3DONA 4M7RA 4IIFA 4CWAA 3CCFA 1NVVR 4D9NA 3QYPA 1JQLB 3T4XA 1SVKA 3FD8A 5B58T 1XMSA 3D6FA 3T99A 3UW3A 4BO5A 1FSFA 1RCUA 2EFYA 3WLRA 3FUVA 3UAYA 1R5OA 3O3OB 4R7ZA 1XZLA 2XB6A 3LBNA 1NBMD 5DNWA 4UTXA 4A82A 4YRNA 1L9XA 1QIJA 4AZVA 4CEIB 1WWKA 4WEOA 2RHBA 2PUHA 3BTOA 4W9RA 1Z17A 3WDKA 3DNMA 2XCUA 2O4UX 2QX8A 4HEQA 4M0MA 4D9HA 3A11A 1KS2A 3L82B 4FGWA 2ZSIA 1VCMA 4X84A 4F45A 3TIGA 2OBFA 2VUIB 4QTYA 1F8UA 1LFAA 3BB3A 3VR2A 3HSYA 2EFJA 2WU8A 3OE4A 3U4QA 2GBFA 1XSEA 2ZREA 1M6HA 3O47A 1XWIA 1FSZA 2ZSJA 5DW3A 5KOIA 3MB5A 4ZT3A 3ZGOA 4TYYA 1N5DA 2I33A 3WMRA 4CG3A 4K9RA 3IVXA 3RLFA 4EW1A 1N57A 4Z1MD 4MI1A 1L5VA 2EW2A 3QKUA 4JOBA 4RF5A 1ZJ5A 4W1PA 5FUXA 3UH0A 4RZXA 3V4LA 3KJFA 5THKA 3RSQA 1UKYA 1IZZA 1GZHB 1W5SA 1UFKA 3AM3A 1HKUA 3M33A 3HLKA 3QNMA 4LYYA 2DHCA 4YAEA 4YACA 1TK3A 3S81A 2BSQA 1QTQA 3NBAA 2BKXA 1NVXQ 1LUAA 1WPRA 3G49A 2R8XA 4R1OA 4C2AA 4Z3OA 2W5UA 2N0SA 1JH9A 3AFIA 2FPPA 4KN8A 4PG7A 1F0NA 1LNZA 2QRVB 3EXHA 3N3AC 4DNXA 4B6JA 2W2KA 1T43A 4N3AA 4JYMA 1YV9A 1XHLA 3KT3A 5F2OA 4GR9A 5ICSA 1K8QA 3N2IA 4HNAB 1CUJA 4OJMX 4XIYA 2PWAA 2E48A 2YWRA 4UVEA 4W1SA 1FB5A 3HU3A 3BHIA 4KK4A 2IITA 3PD0A 4X7BA 3ZD9A 2PDAA 2WM9B 3E9RA 1P1JA 2FB9A 4A0QA 5IHXA 2EDCA 1GEGA 3BVPA 3MS4A 2JH8A 2PUCA 1KO4A 1CB0A 2V4UA 3K1YA 3ZTWA 5JJ5A 2OL4A 1YJAA 3VPDA 3FW1A 2QUHA 2VDQB 1TEXA 2D00A 2IX9A 2XNKA 3PWSA 4FJ1A 5CW1A 4KVFA 4RY2A 4XTCS 1MC5A 4O0MA 1L7MA 2DKNA 5BRAA 1IBMB 3RGGA 1IOWA 1SXIA 5DNUA 5AVWA 4CMHA 4EJ0A 1USGA 1PF7E 2JAOA 1LVUA 3DE1X 3V1TC 1RFLA 4BB0A 1B3BA 1JHZA 1XD2A 3FPBA 4M1KA 3LWZA 4QUAA 2M6RA 4UARA 1WXDA 3BG5A 2QVBA 3CCBA 3EB9A 2X3FA 2I9KA 5J1TB 1KDRA 2EHDA 5DFAA 1W6RA 1Z6PA 1U3FA 3PGXA 2HCRA 1G8PA 4WJLA 3DPIA 5I5GA 1MENA 4J6FA 4NZ9A 3T7TA 1PDOA 1GGNA 2UKDA 3M4YA 1SXJE 3LD9A 3PRJA 3PCXA 2J9GA 3R6WA 3LDUA 4MCJA 2RONA 1A8UA 4CFSA 3G59A 1D2AA 4E4YA 4EJ2A 5K3EA 5JYEA 1GHTA 1RYNA 5FTKA 4CIBA 4EABA 3GEIA 1KSFX 2XB4A 5HRAA 1RRPA 3WL4A 1ZUIA 3OH8A 1DJOA 3LXMA 4BATA 2H2GA 5D87A 3QE0A 4D8VA 1JSXA 4LZLA 3N53A 2WAAA 2CJFA 3PYMA 4JVMA 1UAGA 4QQRA 1D1PA 1VFPA 3JVUA 4BLRA 1OTHA 3D59A 4IJQA 4N1AA 4ZFNA 1FRFS 3JVEA 1AK1A 2YHSA 4NI5A 3A6JA 2I2AA 5EESA 5FX2A 4YHHB 1A5TA 1BXRB 1B26A 1K1EA 4EYQA 1KVUA 1E2PA 1QQ5A 2VHXA 4CUZA 3EOZA 5IHPA 3LBFA 5H82A 1NATA 2JEZA 4XGQA 3SXUA 2RC6A 4NS1A 3J81A 1U11A 1ZD4A 2DFDA 2HBQA 1X3LA 2GZDA 2PRZA 2NYRA 3N8IA 3O0TA 4FQ5A 4OXIA 5CK4A 4M8LA 1ZOIA 4WZAB 3ZH2A 3C8UA 4AY5A 1ZIDA 4UEKA 4AF7A 1N5LA 2O57A 2GD0A 2I1QA 1Y7PA 2XD4A 3GT3A 3AUYA 4B33A 1P9NA 3FTQA 3LCMA 4Y0VA 5A4AA 2V6FA 3PB3A 4M36A 3KSBC 1ZCZA 3WNDA 1AA9A 3S0JA 3ITNA 4DLWA 5BSFA 1N0HA 4XOIA 4MTLA 2CHGA 3QELA 4BN5A 4BJ3A 2VKQA 1Z36A 3F78A 3M6LA 4J91A 2AB0A 3SN6A 5IVHA 3HJCA 1GRCA 3AR8A 2FNAA 4E03A 1E5LA 1M6VB 4EA6A 5KKAA 2QHXA 3VJKA 1S96A 2NSYA 4ZREA 3UG6A 2SECE 3P8ZA 3A2KA 3DOEA 4I2NA 2OHFA 3FLMA 4X8MA 4N03A 3EE6A 1ND5A 1EM8A 4QDKA 1E94E 4DIEA 1QH1A 1QOZA 2WWXA 5EIEA 1MJNA 1Z74A 3O8OA 1SBHA 2PUFA 2ID4A 3FB1A 4LS3A 2DAPA 3ZCRA 2XT0A 4EHLA 4HPXB 4YJFB 5TSDA 3DTVD 3IBCA 4L9SA 4DGQA 1O58A 3B1JA 3ESYA 3MRSA 4DLUA 4OMCA 4EA7A 1EGVB 3D3WB 3F8TA 1ZH8A 4D4LA 1QRSA 2YV1A 2FSVC 2A88A 2DFVA 4C9BA 3UT5A 4PSDA 3QUQA 2PD6A 2GYWA 1QYWA 3FOZA 1DIBA 3X1MA 3PVZA 4N7RA 2MR5A 3A4LA 5BN1A 3QZUA 2EKLA 2AC2A 1DWPA 2I3DA 2R5FA 4PU0A 2FP4B 5EKUA 4B48A 2PT5A 4AJKA 3E0XA 5E7IA 4MLDA 5JSHA 1GM5A 4POAA 1DARA 2VHWA 3ZWCA 2COUA 2NV6A 2VYVD 3MT8A 5IDQA 1SKQA 5LFAA 4DWOA 1THZA 4YUVA 1XBTA 4AO8A 4ZPJA 3AFOA 4O4HA 4OD0A 2XKJE 2O8NA 2GT1A 3B3QA 1VOTA 2VHVA 3JZFA 2QM0A 3UHPA 5FEUA 4RMHA 1CZNA 5IJAA 3JD1A 4NJEB 1OXTA 4YMSA 3I9V1 5F64A 4CLHA 5FTLA 2PBZA 2PEZA 3EG9B 5C34B 3W2GA 1W0JD 3BD7A 4HO1X 1ULBA 4IFIA 3LX5A 4PPGA 4W7SA 2KSQA 3KEGA 4FZJA 4BPRA 4ROSA 1VL5A 3O83A 3QVSA 2GZ3A 2ZE5A 4R1NA 4X6XA 2IXGA 5KX5F 4LHYA 5CT4A 3EAFA 3VVMA 4BS9A 4G41A 5EHQA 4DJFC 3Q41A 3ROMA 3QMMA 3O4JA 4RS4A 1F2TA 1TXGA 1T0PA 2ZCUA 1E9BA 4JLBA 1U5CA 4PBSA 3UKOA 3V1KA 2XVMA 3OOYA 4XYBA 1RJEA 2C7OA 2PLRA 2B21A 4JLPA 4GZLA 3ZHRA 3IO3A 1JKMA 1Q0RA 4EI9A 1P4SA 1BKSB 4I1RA 5AI9A 3TJRA 4DIMA 3QJYA 4EUEA 5BR7A 5A4MS 4WKPA 2ONYA 1XDDA 1LPAB 3LQ2A 4ZJUA 1A5ZA 1ZUD1 5BUSA 2BH9A 4DCJA 3W5AA 4QNNA 3WAKA 3K9QO 4OH7A 1QYXA 4F2DA 1NULA 2DH5A 3P45A 1I2BA 4Q05A 3I01M 3IKMB 4IAOA 4NMLA 5IYZA 4HP8A 2Y93A 3C1OA 3HA5A 3G3EA 3K0CA 4RSRA 4XCVA 3CFYA 3K30A 4HDKA 5ESDA 3U4QB 1NONA 3TIFA 3PPVA 4DMRA 1KDTA 3AH8A 4DABA 2O59A 3T1QA 3SZMA 3MWEA 4QGBA 3PWKA 3N86A 5DN6A 4U39A 5GM1A 3U7RA 1C4WA 2WVJA 5ECYA 2GBLC 3P5BA 1A72A 1MG0A 1B23P 2P9YA 4N0EA 1T2CA 3WQRA 3OUTA 5AI0A 2O0LA 4XDZA 3FNIA 1KJ9A 2Z4TA 3F71A 3O31A 1UBRS 1OLSA 1A9QA 4P31A 3BC1A 1P7WA 3DC2A 2F2TA 3EISA 2GN2A 5LKAA 1NX6A 5BT9A 1SVIA 3ZZTA 1JKJA 5ESWA 2HC9A 4GI5A 3U19A 3KJZA 3T3PB 5BR4A 2ZBPA 2HD4A 4Q00A 3CWZA 4U1RA 1QG6A 1K7XB 2XTMA 3B9BA 2ZBVA 3T35A 2I4NA 5TX7A 1YC5A 3QLUA 4B73A 3ZHTA 4BAGA 3QVVA 1TFUA 3HVJA 4DRXB 4ZAWA 4AZ0A 3MK31 4E4TA 1VHTA 4P0PB 1Z4QA 3U48A 4AQYB 4WXHA 4MDFA 4LJ6A 4EF4A 2KYRA 2RAPA 2ZUCA 3K96A 4EG0A 2PUTA 5KU1A 3O8CA 1FX0B 1TKBA 9MHTA 1NUUA 4RVHA 1V45E 1S7CA 3KZXA 4I36A 5LOVA 5CEEA 3AOGA 4GX0A 3RHTA 3OLCX 3P2YA 1WQ1R 3OKPA 3GPIA 1UBEA 5BWBA 3OM0A 1E5QA 4QEDA 1D2EA 2ZVDA 4RV9A 5EWJA 5CH3A 2CLEB 1QG4A 4JQZA 4G23A 4BLSA 521PA 1EJ6A 4CQLB 2E1RA 1KPHA 3KQMA 4ZO6A 3BSFA 2EJCA 1QMGA 2WE7A 3OCZA 4GECA 2YS7A 3OFJA 4IM7A 3FSRA 3HZZA 4LYGA 3S2GA 3ROEA 3SYNA 1OX4B 2ZBEA 3MS7A 3LM8A 7GPBA 2CE2X 4PC2A 2VPIA 5AW6A 5B3JA 3L6UA 5DU2A 1S8NA 2P6OA 3IP1A 1MRZA 3NFYA 4JMPA 4K3VA 3HY6A 1OZ0A 4BFUA 1VRVA 3TQHA 1VJCA 4MR9A 3HU2A 4I1PA 1JE1A 3MAJA 2QLNA 4R3WA 1VHWA 1AKVA 2QAJA 4CM5A 3O03A 2RCYA 2J0UB 1X2EA 1ZJ6A 3LT5A 1ORDA 1ABFA 3IPAA 4RJTA 3ORRA 1JKFA 2DM6A 1MX3A 3HABA 2TMGA 1ISHA 1GFWA 2PX0A 5BOSB 1DQNA 1E8MA 2SBTA 1KMIY 2GLXA 2X5KO 2AD1A 1NJ5A 2AGVA 2ST1A 3OEHA 4IVPA 3EIWA 3GXBA 2P4QA 1EJBA 1ONSA 5ALDA 1CSEE 3ZD7A 1EAMA 2WU1A 3D8UA 3MWKA 3VJMA 1GDTA 4RFVA 5JXJA 2GR9A 4FFDA 4ER7A 2IS4A 1JHPA 5FUQA 1OYYA 1XQVA 3OF3A 3WISA 4E5PA 1XWWA 3WKDA 2ZUFA 1Q19A 1QORA 1H2YA 3EQ9A 4PFJA 1CNMA 2O2SA 5F3DA 4GXTA 4CM4A 3H75A 1EU1A 3L07A 3OIUA 5JJBA 4AJ1A 2PL9A 2XKBA 3EEBA 3JSXA 1DCMA 4GZMA 4IDBA 4LOHA 5UKDA 4CM1A 1RZRA 4P3OA 4W5QA 3L1UA 2GHTA 4Y6QA 4RKWA 3UTDA 4Q7KA 2PJRA 1GZ3A 1KEUA 4IFTA 3ZI7A 1OBCA 3MQ2A 5G2OA 4E2YA 2VTBA 4EZBA 2REOA 4GC5A 1JFVA 4MUHA 4CKWA 1XZEA 4MP8A 2BFFB 1HLFA 2CXHA 1XCGB 2NU7A 2VBGA 3P9SA 2OB2A 3SX2A 1D6SA 3VHXB 1C30A 3PNQA 1SCJA 4QXMA 2FXIA 5B3LA 1VLHA 4WCFB 3HCNA 4GEGA 1WW3A 2H5EA 3RPEA 3UENA 1ZJWA 3HKBA 2CB0A 3UPTA 4NNJA 2RBGA 1XAGA 3RYFB 1K0UA 1VIVA 2X5NA 1QONA 1RSZA 4RPLA 3LQQA 3GC6A 5AQEA 3Q7TA 4I6EA 3FPJA 4P58A 4ARVA 3U17A 1MOQA 2KQUA 1TF7A 3ABOB 3H9BA 2JHCA 4R2JA 5AVKA 2HJSA 2HJHA 3DZGA 4D3ZA 4KBFA 2YJNA 5FT9A 3RJ9A 2G3YA 3MEQA 1D7OA 3BXEA 4W5HA 1C7FA 4I4TB 5TB5A 4KN9S 5T8KC 3ROTA 2HT6A 3OTQA 4HZIA 4XD7D 4EGSA 1WDWB 1XNQB 4AD8A 2PUBA 4NS4A 4CEHA 1Z18A 3R7WA 4L3VA 4B0PA 2YJGA 4B85A 2HA7A 4I50A 2O2XA 3ST7A 2UVQA 2BGLA 5G4LA 1U7OA 5EJ7A 3EEFA 3ND6A 4IYRA 1A69A 2AT1A 4ZODA 5A3VA 3S2FA 4A5SA 4I50B 5CB4A 4EELA 1LA2A 2I4MA 3RJ5A 2Y1EA 2GESA 4PIPA 4ZVTA 1ELOA 1RYMA 3KVRA 3NOVA 3PPXA 4RMIA 4YCSA 3OFVA 2XTAA 4NJMB 2OXRA 3C43A 4QYXA 4RQTA 1SKYB 3SIPA 1E2BA 4JB0A 3M1LA 3ZU6A 1FSSA 2RG1A 3WQSB 4E31A 4A2WA 5L4LA 1O94D 3FTNA 3WLLA 3OCWA 1AUVA 4JVNA 1ZSVA 3RV4A 4CTJA 3DO5A 1E7QA 2ZJ8A 3EGXB 2BOVA 1Y8RB 2BFBA 5KYGA 1SWVA 1J8FA 1QC5A 3ANNA 2C2ZA 3AEQB 5CXXA 4OFZA 3I53A 5T3YA 5GVRA 1MO4A 3HJTA 2FFRA 1WMSA 4WKOA 2GXUA 2I8AA 4LHSA 3OZTA 1OX5A 3LFUA 1O96A 2QRJA 3O4FA 5JAZA 2BGWA 4WV3A 4IIJA 1ZM4A 2F1HA 3SQWA 2WV7A 3ZHYA 5ALNA 2VDPB 1XHFA 2LVBA 1N75A 2O2GA 2QU7A 3BMNB 1H1TA 3F9RA 1HE3A 1L7QA 1YT5A 3AC0A 5D3MB 3WLQA 4EY6A 5KOHA 4XLLA 3M82A 1MV5A 1DIRA 2J48A 2XNCA 2W0MA 1NUPA 3MRXA 4K28A 2MR6A 2BIFA 3Q0TA 4Y2RA 4ZALA 4FBGA 1ZNZA 4UC0A 4QU5A 3VX4A 2QJFA 1QFYA 1Y6RA 4P7GA 1K8RA 4GBMA 1AK9A 2XF2A 3ZCVA 3TTXA 3COZA 4FZVA 3I4LA 3LH5A 2FEMA 421PA 1E0AA 3QVUA 9LDTA 3C7DB 1CTQA 1V25A 1YR6A 2AW3A 4RJ2A 1L6RA 1GZ7A 2VOJA 2G36A 4EUFA 3OOSA 5DGIA 5JDCC 2IXEA 3WB9A 4B6FA 2B1JA 2Z6UA 3S2UA 4EQZA 3ZV6A 2V98A 3PFHA 4FFSA 5FCDA 5EQTA 1Q74A 1BEUB 3HLYA 3BJMA 3D7KA 1E2QA 2FDRA 2YZMA 1E6KA 1XA0A 3H17A 4XWKA 3EFHA 1O4WA 2VF2A 1X9HA 4KQ9A 1HT1E 5HP4A 4PN7A 3PUWA 4F5WA 2DTXA 2RSLA 3EZNA 4BNUA 3F7MA 4GFDA 5IDXA 2V6BA 1U5BA 1D03A 1X9GA 4RQUA 3V97A 2AZXA 1C1HA 1RJ9B 1S89A 3DH0A 1VYTA 3FOBA 3H9GA 2JGDB 3OIDA 1M6EX 1RRFA 4OB8A 1YRQA 4HV4A 3D3QA 1G60A 2ETVA 3MT9A 4LPKA 2SCUA 1ZXLA 4K6FA 5L3SB 3B13B 1HZZC 2J9FA 3JWHA 3PA6A 1QV7A 3NPMA 4FYYA 4OSOA 4JGBA 3OQIA 5EWMA 2I2XB 4AXBA 3LGXA 1JDNA 1WUIS 2PAAA 3BOSA 1LTHR 1WE2A 2B4QA 1XJQA 1LXCA 1PL7A 2NUPA 4H0CA 4HADA 4HGPA 4CT4B 1FTGA 1XZQA 4ITVA 3LW7A 2P2SA 1OUMA 3BF7A 4EUSA 3DZ8A 3R7NA 4PF1A 5LJLA 3WR5A 1SHUX 4YPVA 1E2IA 2XCIA 4YUXA 3SI7A 4YMWA 2W2VA 1HO3A 4EJ6A 3TOVA 3EMVA 1DFGA 4HRXA 3ED5A 2APJA 3KB6A 4D8YA 5LXTB 2OYCA 1LQTA 3GMDA 4MGIR 4R3UC 1U7ZA 1L7AA 4OL9A 2R1UA 5IJ9B 2O50A 4RXTA 3ZLVA 2B7LA 2XX3A 3DOCA 2YFKA 1FFEA 4RHTA 5AUNB 2B0CA 4J0HA 1ESMA 3FYDA 4FC6A 4BHTA 1EE2A 5JH7B 3R3WA 4CF4A 1IAQA 1ZUNB 2HI0A 2I3ZA 3KD3A 3NYWA 3U4HA 5BNWA 1TM5E 4AECA 2VP2A 3N9IA 5LWQA 4TS4A 5K0FA 5G3YA 3PXBA 4DV6B 1BWSA 1JHAA 1ZMOA 2VR1A 4KFTA 1QDEA 1T5IA 4YYZA 3GUYA 2VYCA 2BUBA 4L76A 3O4IA 3KOZA 2BR5A 1AXGA 2HSWA 5LZ5A 5IT9A 1Q0PA 2CNWD 2V5UA 1FLAA 5FYQA 2ODAA 2R00C 3INRA 1ZR2A 3HXQA 1GLNA 2FSHA 2OY0A 2QD4A 2VAXA 1O95C 2ZIUB 3ZHVA 4CIVA 2DERA 2O8BA 4RULA 1P2VA 4AO7A 1Z68A 1IN5A 1KI1A 2XDQB 4WXMA 5AK6A 2VIIA 1GCAA 3CSSA 4X94A 4C05A 3NTXA 4EMSA 3II6X 1J2YA 5AH0A 5IX8A 5I7AA 1GKLA 3R0VA 2DF8A 1KJZA 2E2WA 4YDHB 4WI1A 1FYFA 1W2GA 2F00A 3KYIB 1GSIA 3PSHA 4KRXA 5EP1A 4LQDA 3NXKA 1N3LA 5CHEA 3VRHA 1XEFA 4X1YA 4D25A 2CMHA 4TMVA 4RHYA 2LUOA 4OUDB 4RV5A 5DHFA 3J80A 5ALIA 1K8YB 2XJ9A 4Q82A 1CE8A 5KYWB 2JIDA 2ORWA 2VCEA 4URZR 4AJIA 1IRIA 1RXWA 1VKOA 4EKGA 3BXXA 5CG1A 5KYWA 2HPAA 4NFHA 1SKUA 3OCJA 2FXVA 3Q0EA 5E7MA 4RH1A 2V45A 2G06A 3AVOA 3VO2A 4Z7OB 3L0CA 2I66A 1IWPB 1Z29A 4K8RB 2I2FA 4PANA 4D9EA 5KYXA 1PT7A 1IC6A 3D6UA 3IE0A 4FMDB 3V2GA 1MD9A 4EQ6A 4AS2A 5HZGA 1BZYA 1KFJB 5TE9A 2OFXA 1Z4OA 3GG2A 4W5RA 1A98A 4NXNB 2GM4A 1PL8A 5KQPA 1OGJA 3F8WA 3L8YA 3NIWA 3A9SA 3GL9A 3PHGA 4GOJA 4XXHA 2FFQA 3UMYA 2A1TS 5CDTA 2O7SA 3S1AA 4P38A 4LXIA 1KDYA 4HB4A 1L4KA 1C3XA 1DCFA 5MGBA 2LKDA 4EPXA 1ZK1A 5BNTA 3SC3A 5BRNA 4BLUA 2FPXA 3UJ6A 3L0YA 3G2KA 2ZG6A 5IFLA 4NABA 1FQKA 5D00A 4C4AA 2BEWB 5LMZA 3O8DA 3NHAA 1ZCAA 2H8GA 4KYUA 4QNMA 4L27A 4Z3DA 2JJ2A 1MC1A 3AIMA 5IT0A 1AQIA 2P2ZA 3RAEC 3W3AA 3FMOB 3L8DA 1EFVB 1WOMA 4D5GA 1ISRA 1D2NA 5ENDA 1FRNA 2J5KA 1FXUA 4M1WA 3EF0A 2DBQA 2VZLA 3ESZA 3WTCA 4V3CA 2HA0A 3DDHA 4LA4A 3OIYA 1JBEA 5GJCA 4W5TA 1QK5A 1E1NA 2P27A 1P7ZA 2JARA 3OP1A 4JVSB 2FDCA 3L84A 3SZRA 3DOJA 3VAYA 3AERA 3BERA 2IHUA 2GBPA 1I51A 2ZTMA 4G09A 5EZQA 2FYTA 3PE6A 5GJBA 4DCPA 4ZMRA 4O4HF 4B87A 4JLKA 2IY7A 3QTLA 2CE7A 5DTIA 3ZHBA 1TRHA 5EKXA 1R64A 1WCIA 3TMKA 4BN0A 4EP1A 2R7LA 2PM8A 1HOXA 1O7JA 2VTKA 4F2PA 1AURA 4ZCLA 2VJYA 5ENVA 3U6KA 1B15A 3B85A 5DOVA 2XYVA 1B3RA 3TRIA 2XXAA 2I22A 5AK3A 3SE7A 4EOGA 3HZOA 3HCCA 2O2CA 4Y8VA 2YV3A 3U62A 1HV8A 5FAKA 4TS3A 3KYCA 3M4XA 4B4UA 1A82A 1F06A 4R1UA 1PFGA 5IM5A 4DTCA 3AJAA 4PO3X 3RADC 1QGUB 2ZJAA 4I3FA 2XUPA 4PBRA 1NBEA 3TRKA 1HWYA 2C3YA 4WJKB 4AYTA 4QG3A 1WS6A 5LDDC 2XD9A 1U5AA 3DKPA 2ZYUX 3S1LA 1CYEA 2JGJA 1ZKMA 3I05A 3KDSE 5IAJA 1YRBA 2E4AA 2JIMA 4X60A 5CFMA 3UK2A 2Z0MA 3VA7A 4UBJA 2ATCA 2ODPA 2E82A 1JN0A 5ALJA 5AKYA 2CNLA 1V8ZA 2OAP1 2XI4A 3A8TA 3BXOA 1ABBA 2NYUA 2CJWA 3H1BA 3Q98A 3K71B 4NAVA 3I2KA 2Z1MA 4YPOA 4NQRA 2UZ1B 3ZE9A 4R0NA 1LBSA 1ADBA 1U1GA 4B7UA 3HWX1 2SNIE 4NCAA 3L7LA 1U0OC 2QWXA 3C6YA 2O1SA 3CUSA 2FFHA 3L4KA 1EUYA 2DR2A 4JDUA 4RSHA 5C4GB 2XB2A 4B1FA 4EO9A 4TKMA 4F5YA 5DWDA 1YI1A 1W34A 3VOTA 4NULA 5KC9A 4HN4B 4RD2A 4M87A 1UP6A 5EKSA 3V8MA 3FIUA 3HNOA 2FJPA 3LFTA 5IDWA 5ICCA 3DXFA 4Y0AA 1GR1A 4US0R 1P9WA 1GT6A 3C8ZA 3UG7A 4QM7A 1KETA 4WZBA 1MO6A 2IEZA 3ZUGA 3SS7X 4S1WA 5HIAA 3GLQA 4IX1A 2ES4A 1VYVA 5ER9A 2W6JD 4P4GA 5F77A 1RE0A 3PGMA 1E7YA 1VA4A 1S9DA 2J85A 4X44A 2GHRA 1YIOA 1N1GA 5SY6A 1V39A 2G9UA 1XKTA 1K7FB 1Q83A 4KG7A 1ZMRA 5C7YA 1J8VA 3G89A 4KV7A 4O1IA 4MQLA 2C5GA 1KRXA 1F3LA 1VMDA 1ZEMA 3ZX5A 3ND7A 3I1IA 4C01A 1WF3A 4IH4A 2QI9C 1E63A 4L9AA 1QO7A 4H6WA 4ZVRA 1N2GA 4YWJA 4AWBA 1FJXA 1T10A 1B4DA 3FVVA 3WNVA 1NKSA 2IODA 1EFRD 5C8DA 2RGEA 3NVMB 3WVNA 4PSKA 1C1YA 2EIXA 2OECA 5H4GA 1IHDA 3WRYA 1E2DA 5IKEA 3OM8A 3R0XA 2GM3A 2C5LA 2ZCVA 3JASA 4G0PA 4QO8A 3BTVA 3VAZA 1W36D 2Z4RA 5DCLA 2W6CX 1RMQA 1UBJS 1KJNA 3P97A 3O1LA 4LDNA 4A9AA 3T1HB 1WW8A 2GZRA 2QMUA 2KLHA 3DL0A 5DT9A 4AG6A 4Z4EA 3THWA 1DEKA 1M7GA 4FM9A 4Y2VA 1M3SA 1KI4A 2HU2A 3F6CA 2MCFA 1SR8A 2QI9F 1V3VA 3I9MA 2J5RA 3PK0A 4FZ5A 1GZSA 2ZAMA 4PLCA 1XDBA 2ZAOA 4TRJA 1Y0BA 3PFFA 1MAUA 2QTMA 3E6AA 1RLIA 1YL7A 2VPXA 4Y6RA 1E9VA 5CGQB 3G5MA 1WR8A 3OOWA 4I8XA 4XR9A 1NM5A 5LQMA 4U2BA 4DIBA 3V4OA 4FUTA 3U7GA 1KEEA 1IATA 2NVUA 5L6MB 1J9ZA 1LW7A 4MITA 3D7RA 5E95A 1Z2OX 2RIRA 4E07A 2B1QA 2HSJA 3GYGA 1I33A 3N8DA 4OYYA 2GARA 1E1MA 1RM3A 1UM9B 3BEOA 2ID8A 3TZCA 3ZG6A 2XBMA 4H9GA 3B60A 3GJXC 4RHXA 1I2ZA 2QP4A 2WDPA 4WN9A 3MB8A 4D80A 3OZDA 4NG4A 1PZHA 3PHBE 4MMZB 1YTUA 1CV2A 1GL9B 1PJ2A 1S2GA 2J5XA 2V96A 3R44A 4MW2A 2RE8A 2YIMA 2N1MA 2PQMA 3BAZA 3ONVA 3ZWWA 3NHWA 3T5DA 1HYHA 2D13A 3GRUA 3TS1A 4D3FA 1I24A 4RO0A 1Z5ZA 5AUPB 3L7KA 2EFHB 2J41A 1A04A 1GPDG 1U7HA 2JHGA 2RGBA 3ZV7A 1GGJA 2W4IA 1EZZA 3H5LA 2ECKA 1CUYA 4FMCB 1R4ZA 4G5YA 3OQPA 3AKEA 1GNRA 1ULZA 3T7IA 2W6NA 3OPYB 4LX0A 4CZ2A 3NBFA 2O1WA 2XYGA 3A3KA 3L02A 1O8BA 4G5XA 4F6LA 3TJZA 4BFCA 5I9LA 1W2WB 5A4KA 2V6JA 3AJDA 3IUJA 4LQCA 1FQWA 1JLKA 3L7CA 3OZGA 1N92A 2ONJA 2PUEA 3LPCA 4NXMB 3FGPA 3DAYA 3H86A 3UMGA 4HJRA 4KLRA 2Z9DA 1ZNWA 1FY2A 4GS5A 4URYR 5DM0A 3O8OB 4D44A 4OK6A 4OMFG 4DIOA 4HAOA 5HJ5A 1Q0TA 1DIOB 3G5LA 1VGRA 3GN1A 1KPGA 2EVWX 3B5JA 3NOOA 3QLJA 1NHGA 4V0OA 5CB0A 1QVRA 3GOHA 6NULA 1PVOA 3QLVC 4UNPA 1E18A 1YJ5A 3B2NA 1U9IC 1U3GA 2HDOA 1P0CA 2NO7A 2XJ4A 3D6MA 4P84A 2B82A 4V1CA 2H65A 3MGBA 2UV8A 3R5HA 4K8OA 4ENVA 4LF7B 1CZOA 2E4UA 3QEBZ 2E89A 5JROA 3O2SB 4HUQB 4RTMA 2JHFA 2C92A 4KYIB 1RXSA 4E6PA 3BGDA 2OO3A 5A9TA 3IV6A 5HVNA 4IYJA 1EINA 2MSWA 3DM5A 3V2IA 1L4EA 4FFOA 3F7TA 2GHIA 2ENWA 7REQA 3HM9A 1RAAA 2MINA 4WH0A 1TAQA 3COJA 3N0VA 2DUUA 4OLHA 2NU8A 1VSUA 3VYSB 2HZBA 5L3SA 1Z8NA 5JEDA 3OZIA 4C06A 3BTSA 4YAWA 5GZ1A 1VG1A 1JU3A 3EVEA 3EXG1 3RUHA 3SBXA 4AJLA 3UJHA 1KVTA 1N5KA 2QTAA 1YBVA 3GYBA 3UUWA 2EW8A 3T9CA 4OUKX 4EX6A 5EJ8A 5HIJA 4RENA 2DCMA 3CZQA 3WLMA 2EX0A 1AF7A 4TX1A 1WLSA 3IPRA 4B6EA 2OC9A 3JPYA 5BSKA 2B34A 3TNYA 3GDOA 4WCFC 4LW8A 5AK4A 2J3IA 3R3SA 3P4UA 2F17A 1XTQA 2Q2WA 2SICE 5KX5A 2Q0QA 1AUOA 3SHOA 1FL9A 3BULA 1B0ZA 2W90A 4LSGA 3B6JA 1HYGA 2FZVA 3K9FC 4TTVA 3HEMA 1ZIOA 3UWKA 3OP4A 2DZDA 3DAFA 3AUKA 2YMQA 2WIBA 2NPOA 2PLFA 5LYJB 1GDHA 1DTWB 1PG2A 1BHO1 3ONNA 3EZLA 4NZNA 4OJKA 4Z2AA 2Y77A 4MWZA 2VQ6A 5G0UA 1BWPA 3ETJA 5KNCD 1O97C 3AU8A 3EBOA 1HDCA 3LPNA 3PNYA 3QM1A 1Z34A 4DSOA 3I9OA 10MHA 3PENA 1Z5WA 1G6Q1 2YBDA 5FBVB 1BXGA 2G1JA 2WNHA 4IJKA 4XDGA 4YJ2F 3I4CA 4IIVA 4GX2A 1JJFA 2X4LA 5LXTF 4LTNA 3CF4A 1YQEA 3K0BA 4J49A 2X5JO 4S12A 1ZHOA 2HIAA 2W6IA 3OC6A 1QZZA 1O96B 4P81A 1WDMA 4MRNA 4CRWB 1I5EA 2VT6A 2ZRIA 5IVPA 1XQ1A 3BQMB 4JVOA 1NY6A 2KS6A 2MTBA 2NT3A 4YRDA 4ML3A 1ZEJA 1ORWA 4YI3A 3R76A 1OAKA 4ID3A 1YE8A 1ZGCA 5B58C 4MYTA 1ENPA 2R8PA 3A27A 3K9WA 1KA9H 3EG5A 3TW8B 4RTOA 4O02B 1N0IA 1I4OA 1IK6A 2O2JA 3A70A 2PKQP 1D4OA 2J08A 1HEUA 3H83A 2VAVA 4O4JF 3EH1A 4FBLA 5DYIA 2VRCA 2XUDA 2C88A 4EK9A 3RKUA 3WWOA 2Z3ZA 1WHTB 5CX1A 1F6DA 4Q9IA 2C2BA 4J8PA 3A25A 2YXBA 3CBGA 2FRDC 2WYOA 2ZVPX 1V8FA 3E0QA 1ISSA 1QQTA 4N5IX 5AI8A 1I30A 5FFMA 2HQSA 4J0FA 1DAOA 4BZQA 2FMFA 3ESXA 3A4TA 1UMBB 2D1QA 2Z5GA 4KB5A 4M0CA 1VLZA 4UBOA 1SY7A 1FRQA 1ZONA 3ILSA 2A9PA 4HWTA 3HCBA 2Q8PA 2IDMA 2VO1A 3C6MA 2FPRA 3LT0A 3P0RA 3A0RB 4AIRA 2VJMA 2EZ9A 1CY8A 1FFSA 4OVKA 1O94C 2A9FA 1R9NA 4PAMA 4MDYA 1IXRC 4WLFA 4AJ4A 1H2ZA 1M34B 1ETHA 5HUJA 1RZ3A 1BMTA 4LVCA 5F12A 1Y82A 1PUXA 1ZGZA 3E9ZA 5DM70 3BDAA 2ZSFA 4KR3A 3TJMA 2JFWA 2OLJA 2RHMA 3E3AA 3LCVB 1VPTA 4GWGA 1DADA 1I3KA 4QJ4A 3LX8A 4IQ8A 4LPSA 1N4AA 4WA8A 3KM0A 2V5VA 5EZ5A 4LMRA 1C8BA 4QUHA 4D6XA 4I08A 4GVXA 4ER3A 2JK0A 2I2BA 3W8EA 5J2UA 3NGMA 1MZVA 2Q41A 4WTOA 3WL5A 4PYLA 4WFJA 1EIZA 4MUXA 4DMCA 4LBYA 1GPLA 1PUIA 5BVGA 3GRAA 2DLDA 3SJCA 2JIZD 4N41A 2NSDA 1JR2A 1WSWA 1N2CB 2ADMA 5KKCA 3K35A 4TV9A 2Q5OA 2Y0CA 2BCJQ 3ZZMA 1AHPA 4DV7B 4W5NA 1CY0A 4QPCA 2B1RA 1K7SN 4KITB 3PC2A 4JLJA 1JNXX 1QAMA 2P6UA 4IGKA 4WX2B 3GEBA 1IN8A 3PQ4A 4KKVA 3SHVA 4G0WA 1AGYA 2IHTA 2PWZA 3G7SA 3KSRA 4O4JA 3U4GA 1FRZA 1YZYA 3FN4A 1Z6YA 3O1HB 5AT1A 4GKVA 4Z54A 3W06A 2VRNA 2EDAA 2FW0A 1CUXA 3UMRA 2JGFA 3O2JA 4L51A 1TPZA 3SIWA 1TNDA 1CF4A 3GROA 1JEDA 2RKWA 2QTNA 3K32A 4IMJB 3HUFA 4TQAA 3RSHA 1DIHA 1W46A 3MILA 4G2TA 1TQ2A 2C4UA 2NN3C 3RREA 3JQ9C 4YQYA 3ZGLA 1PS9A 4ETNA 2NSHA 2HQRA 3GCXA 1YS9A 2WG2A 5IU6A 1NLMA 4S04A 5SY9A 1T91A 1UFOA 3GFFA 3OLXA 3PKIA 3RLIA 3EUFA 3ADDA 2J9XB 2ZITA 3RBZA 1HDIA 3MOIA 2C0QA 4PZPA 1DHRA 2FCRA 2H2IA 1RLJA 1TC2A 2GGSA 3PC7A 4FVTA 2F1JA 5THQA 1SCKA 3BZBA 2YQZA 4HNHA 1XTVA 1DDOA 2O54A 4A1FA 3DL2A 3AP1A 1SBQA 1H93A 3A9RA 3MVEA 3LPAA 1MB9A 3V8VA 2C84A 2QGZA 2WKPA 2DY1A 3RRZA 2BE9A 4BASA 3IUEA 4V0QA 5ADVA 4BNXA 1FOEB 2C2MA 1UBTS 4O4IA 821PA 1ZJYA 3LK6A 1JMKC 5MN6A 2C2HA 4OAOA 1HDOA 4XM2A 1IQUA 4PXSA 1RC8A 1R6AA 4H7KA 3VR6A 3AY0A 3UO8B 2PKQO 5BQ3A 2QF7A 2B5WA 5ESXA 2OMKA 2QX6A 4XFDA 1S1CA 5BWMA 3I1FA 2CV0A 2CY0A 4MV7A 4YO7A 4BDTA 2ZUUA 3OX2A 4OI4A 1KYIA 2QD5A 4NMMA 4XWAA 1SHTX 2EATA 3CR8A 4GI7A 1E2UA 1EAYA 4G65A 1CHNA 4ZMSA 5K99A 1WXXA 4WD3A 4TYMA 3RYCB 4DZZA 5LQKA 1QV6A 5L3QB 3UVEA 4HX9A 2WK1A 1RZVA 1MZPA 4L02A 2PH7A 4S35A 1RE1A 1DAGA 1SHKA 2H1LA 1DAPA 2H0RA 2A14A 4ZARA 3HVUA 2E37A 3U7QB 4XCXA 1X1AA 4NBKA 3AEYA 3TOZA 4QBHA 3QVKA 1NVUQ 4M0FA 4MA5A 4ND2A 4UOQA 5JCZA 4QU0A 3GCWA 2OAGA 4LYHA 4JJ7A 1K6EA 4JIMA 4KGXA 4MW6A 3LCRA 4EB0A 2CGEA 4QARA 4B6OA 2ORYA 4MTCA 3QUTA 4W7IA 5EUCA 2PQ6A 3EVAA 4AO6A 5DBIA 5KAMA 3U5ZB 2MWMA 3JVVA 4JLAA 4G25A 2OBYA 4BP8A 4YUWA 1C81A 1I3CA 2OENG 1H2XA 1AK2A 3CRW1 4L5IA 4DL9A 5FR2A 1HG1A 1E9EA 4NX2A 4GR5A 1WX1A 3C4JA 4QU9A 5DZSA 1DKPA 2B8EA 2WSSA 2ZYWX 2E1PA 3GNQA 4U7GA 1KGDA 4I9UA 1XLTA 4JXXA 2CLSA 5CIYA 4BKMA 1TADA 3PCTA 1EHYA 1OIXA 3GJ7A 5TPZA 2JDID 2A94A 5BYAA 3NHJA 4YRRA 4DVGA 3TSZA 3SDZA 4AJJA 2A9VA 4WZZA 3K6SB 2J3QA 1NXOA 3MSXA 5BMVB 3MWDA 4WHMA 2GK3A 2PS0A 4I46A 2QTVB 2Y76A 3WC4A 4YRGA 1W94A 2XMRA 4BMPB 4P34A 3DDSA 3LXRA 3K94A 3K2QA 3PUVA 1WAMA 1UEXC 3ESQA 3HC7A 3K15A 2HHHB 3UTCA 3IAM1 2AFIB 4J2TA 4Q02A 4DHEA 4DQUA 1L1QA 1VPVA 2AFVA 4AKHA 3BUSA 4TROA 4U9IS 2J7KA 4MRPA 4C88A 2GF0A 1QIFA 1T6YA 3DHNA 2HR1A 2G25A 1TJ4A 5J2UF 5K8LA 1RRCA 3HCRA 1SIBE 2D1YA 4BKOA 1XVIA 1WPXA 2H11A 4RE5A 3WB1A 2FLKA 3IAUA 2ZULA 1E3SA 3I04M 5FWDA 1ZN2A 2AI1A 1WW2A 1JWLA 1P44A 1K9SA 3GLIB 4TTJA 4PR3A 2QRGA 2IHZA 3CRVA 3PE3A 1OIVA 1V3UA 1N1DA 3B38A 4FEEA 1XFAA 2H16A 4F2GA 4C6RA 2QTCA 4F3CA 2QN7A 621PA 3PPYA 2AJDA 2IYPA 1PYDA 3QU7A 4IDGA 1DXOA 2BMEA 2R3SA 1Z6ZA 3BILA 3SZUA 3QTTA 5DYGA 5A0FA 1QRUA 1UPXA 4O5AA 1N4DA 4UTOA 3LPLA 2YYYA 4Q3AA 4B76A 4D0RA 2VK2A 5ALLA 1G1MA 1TEHA 5J5CA 2FQYA 2GO1A 1P1KA 6REQA 3FGNA 4QUIA 2G5TA 2WFMA 2XEXA 2Z09A 2G4VA 4X8HA 1AZLA 1IUKA 3AUJB 5B7QA 5BP7A 3ETDA 3TFQA 4B83A 1XZGA 2C9OA 4WA7A 3RTAA 2PBRA 4M55A 1C0IA 3W5IA 3G0CA 1EK0A 3ZXSA 4CL0A 1R0WA 3MTJA 4IQGA 1IBSA 4YRKA 1H0KA 2NT4A 4AX4A 2R1TB 2WNSA 2GFQA 2GPYA 1C7RA 1HRKA 1IONA 3ISTA 4LJAA 3UOAB 2JF0A 3DZBA 5IJ0A 1P60A 3K8YA 4WLUA 5GZ6A 2NUAB 3W90A 3R5FA 1ZQ9A 3AHCA 3OG9A 1DG3A 1R5JA 3QHPA 4HR7A 2SKEA 2AJBA 2GCOB 5G3ZA 2LCQA 4BP1A 5JJCA 5TT0A 1MO2A 1OIWA 4KWHA 4P3YA 4HGZA 2QK4A 2REBA 2GI4A 3LLSA 4EVQA 3KT0A 4UVIA 5LLSA 3NHPA 3IYLW 2HUNA 4AVYA 2G6TA 2WJHA 4A0SA 1DKUA 3E53A 3W5CA 4ER6A 2NPFA 2IELA 1QQ7A 2BF7A 4U2FA 3EW9A 1WJGA 2JGAA 4MO9A 1NP7A 2CWDA 1I6LA 2N1BA 2D4HA 5H1YA 3QSYA 4NFYA 4FJ2A 4B34A 4G1EB 3T5CA 1PNRA 3VZDA 4G8CA 3LCCA 3OUUA 3A1SA 2BR4A 2GQ0A 3VISA 4UXHA 1M2HA 1YMUA 3RSLA 2C59A 2ISCA 4IBOA 5HS6A 1LI7A 2J0VA 1W0CA 2XWJI 2QRHA 1DAFA 5H68A 1GARA 2FN9A 2XE6A 1Y6GA 3NOQA 1AO0A 1EB9A 3P2MA 1XWFA 5JD4A 1P2GA 1R0ZA 3ZVKA 5TQ0A 1JSLA 1A2KC 3T3MB 2FPMA 3WQHA 5EKDA 1J0EA 5H9WA 4ZU6X 3B48A 5HDBB 1CWUA 1NNLA 3VPCA 1QU3A 5TQ2A 1SHZA 1LLQA 1NMXA 5LZ8A 3PPIA 4Q48A 1G55A 4D41A 1UKBA 1TB4A 4M1ZA 5SZJA 1Y8QB 4JBGA 1EHIA 1DKQA 1N3YA 2Q2VA 3GQBA 2GUWA 4RELA 1R0LA 2VVTA 3JQ8A 1GQRA 1SU6A 3GFOA 4JT2A 4KTTE 3ZWAA 3U44A 3ZVMA 3MYRA 2NU9B 3V6MA 2EJTA 4PLYA 4TL9A 5J2TF 1PZEA 4TUYA 2QB5A 3B6EA 4Z4CA 3U7QA 4A6EA 4G5HA 2V5AA 1J33A 2D0IA 1JL3A 2IHVA 2BWJA 4IRXA 1LDNA 2HA3A 5AVOA 2Z8YM 1JFSA 2HK6A 1US8B 2I6FA 1W75A 4LXQA 3DDUA 4GKKB 4H7HA 5JZBA 3OTWA 2CBXA 1N7JA 5DNAA 1DWQA 1QVWA 5JPIA 1NUSA 4FE4A 4EBBA 5BVGB 1DLIA 1ZO8A 3AL2A 5A5VA 2R6ZA 1AMOA 1I4LD 4E14A 1J6UA 4XYMA 4M53A 4JR2A 3ZX4A 4LV5B 5L4NA 3UICA 1DBVO 1OXSC 2IHKA 3HBAA 1O95A 4LMPA 4ZT5A 4L0DA 2AJ8A 1PR2A 2P6MA 3FI9A 2PL3A 3K6JA 3ELYA 2Q3DA 4XVHA 3DE7X 1JV2B 1V95A 3VUEA 1QHYA 4AN0A 9ABPA 3CPEA 2IDKA 1TGVA 2O23A 3SVTA 3A9VA 4II3A 1RWMA 2QN3A 1EWVA 1E66A 2GH1A 1M1UA 1PHPA 3PGA1 4Y1FA 4BUJA 4X63A 1VIMA 1IHUA 2VJMB 2V0NA 2AFRA 4ENWA 1YQUA 1W7AA 2V7QA 3GGJA 4UHDA 2NGRA 4ESOA 4BKRA 2I0FA 1UWVA 5B3KA 1FYWA 1PS0A 2OGWA 2HX1A 2PRIA 3IUBA 3QKIA 4IILA 4IZOA 4MLCA 2PEYA 5CM2Z 3KBOA 5HF6A 5M5BA 1T8YA 3FOCA 2C9DA 4R2WA 3T7DA 3HJRA 3W7BA 1FTQA 2OMEA 3A3NA 3MBIA 3OI7A 4F04A 4IGIA 8ATCA 5JADA 3I9LA 3O4VA 2ORIA 3ZLJA 2QRVA 1XZMA 3GLHB 4XD7A 1SGWA 3D4BA 3DUFA 3OY2A 3P32A 4BNVA 2IYZA 2M1XA 2W2TA 3K1TA 3O8RA 3KKZA 1EWQA 1N5MA 2V6MA 1TT7A 3EDOA 1FJHA 3DW3X 3UXHA 4OO3A 2R68A 4EF6A 1MO5A 3D2BA 2XMQA 5IJ0B 2F9FA 1KAOA 3DM9B 4EFMA 3QPDA 4RJJA 3WY9A 2F3PA 1WCYA 4D0SA 1B7GO 1XALA 1SZPA 4FZ3A 2HJVA 2OAQ1 3MG9A 5FQOA 1N8SA 3JRNA 1EFKA 4EB6A 4PBTA 1DDGA 2X22A 4DMFA 4XLTA 4MCIA 3D2CA 3WL7A 5A6VA 5GGYA 1WXGA 1SIUA 4DLSA 4ZYUA 3BH7A 1XNJA 2GCGA 1JG1A 1IHXA 2RK4A 1J7JA 3AI7A 4EKYA 4Q18A 4KREA 3A1EA 3B7WA 4DG9A 2JFVA 1VL6A 2P4SA 3HL0A 3QTBA 2JJ2D 4DLYA 4DYDA 3E22B 5DRYA 4BVEA 1HNNA 2JLWA 1G98A 3ISJA 4LSMA 4BKQA 1Q5PA 3V7YA 3EJ6A 1M8PA 2Z2JA 2JIBA 4E5MA 3EFBA 5KZMB 5KYUB 1GQSA 4G26A 1H8HA 3R3HA 1T13A 3IERA 1AD2A 5IXJA 4X71A 4AY3A 3GB9A 4REOA 3BRQA 5KNBH 1DAEA 2F7SA 1CYDA 5K45A 2HPVA 1NIPA 4DM4A 2D2VA 1FU7A 4Y2YA 3RT9A 2GKGA 3TQFA 3L1VA 2FR8A 1HYBA 1HE5A 1OI2A 2G0TA 3TOXA 2O8CB 5CJPA 1UC8A 3TNJA 3DB1A 3UK7A 4A0HA 1J22A 1OZFA 2WIAA 1QG0A 2WU4A 3G5TA 4QWWA 4R1TA 4B9EA 4JI1B 4YRAA 2H1OA 3JZMA 3W1EA 5DM1A 2XITA 1ZH2A 1O9GA 4OBWA 4GBED 1LZKA 1PQUA 3IH5A 5E6RB 4N49A 4TLEA 5JR3A 1PE0A 5F1PA 2VATA 3D02A 1JJ7A 2Q9AA 2CK3D 2Y4OA 4LQ4A 4BLTA 2UVPB 1BIFA 1QV9A 3OQVA 1TA4A 2JGEA 2Q6KA 4G5RA 3MWDB 3N76A 5CFLA 1Z5UA 5FPKA 4CIAA 1EGHA 2UDPA 1V7QA 4MUBA 3UV6A 4X62B 4F3TA 3H8JA 2XDQA 2BRUA 2EF0A 3WHKA 1JRLA 1IJBA 1QFJA 2JCVA 2ZAIA 4NEGA 4AICA 3A1DA 1RXIA 1HORA 1N2XA 5FLEX 2R2AA 1NVTA 4IZHA 1P74A 1RD4A 2VC2B 1VLVA 2VHYA 1N5IA 2VA9A 2ZDGA 3A6KA 1C9MA 3PDUA 4UASA 3AF6A 4QLOA 1LWOA 3LX6A 4MS3A 2PZLA 5FUMA 2IF2A 1BS2A 2H2HA 1MKYA 3CLTC 2YBEA 1YBMA 4TV8F 1L5SA 5F3RA 1J8MF 5AYVA 1NC1A 2C3MA 2Q6VA 3OE5A 3FCCA 3KOWA 3C8HA 1T1SA 2WP8J 1I13A 4DV5B 1Z2NX 1XMJA 1LPBB 5AW1A 2BP7B 4KYTA 2ZJ2A 3L18A 1D6JA 2G8LA 2D3TA 3DCYA 4GMXA 4AN4A 1Z4IA 1F7VA 3MN1A 3IUPA 4J4HA 4IH1A 4NBRA 1JI3A 3GELA 5KX5B 2BMWA 3D3NA 2FSVA 3TYXA 3W5SA 5CDFA 1Y9JA 5LZ9A 2QT1A 1QFMA 3O3MB 4JK3A 1Z47A 1NMSA 3PBKA 3R8XA 1C7EA 1NRXA 5AXDA 5BSMA 2HCJB 2BV3A 1NUQA 1OTYA 2AOUA 3B20A 3H2SA 3ICCA 3JQ9A 3LZ6A 3MINA 3OMXA 2Z6VA 4RPHA 3RS7A 1SXJB 2GYUA 2DUNA 5LP1A 1SCAA 4CKCB 2Y3IA 4QBGB 4YP7A 3QVGA 3NTVA 3SVLA 2QUJA 4C0WA 3SNKA 1VPEA 4CL3A 2C42A 2B1GA 2VWHA 1FJGB 4RKEA 1U8CB 2BFCA 2B20A 4FK8A 2YWHA 5A04A 4UKDA 4YJKA 1E2LA 2PQ2A 2OORA 2VJPA 4QO7A 3TSOA 1HQYE 5B3JC 4KRYA 4F4CA 1E2MA 1SG0A 2ROQA 3GAAA 4J7AA 3WLJA 4EEZA 1M2OB 4KPYA 2XNJA 1KS9A 1VDMA 4LAFA 3JWGA 3QFRA 4HDRA 4JLSA 1KJYA 4CTOA 3PHJA 4LVOA 2UYCA 3K4QA 1VJGA 2FSUA 4RCZA 4OK3A 4NFLA 3MCUA 1YBHA 3MJTA 5AKKA 3AO0B 1IG3A 2XIJA 4JHXA 4D9JA 1HLGA 4LXUA 2VQFB 3AQ4A 3PR2B 5LB4A 2AOTB 2BN4A 4M6WB 2AMVA 2JAWA 1TC1A 4RADA 5DNEA 3TLCA 4YUZA 13PKA 4JJEA 2XADA 1YI8A 2VP5A 4E5UA 2Q28A 3GFTA 3HPRA 3MTIA 3ONFA 3QWIA 3SZ3A 4DRXA 3JASB 5JHHB 1G16A 3UMBA 4M37A 3W3ZB 2AV6A 4E15A 2F8TA 4N8DA 4YAOA 2C3PA 3DBVO 3U3JA 4IIEA 4RIHA 1QAOA 2D2IA 4J7UA 1BO6A 5DM4A 5FP0A 1P5HA 3RNOA 4GP9A 1HSZA 2QGFA 2WB4A 5LSAA 2ZZMA 3QVXA 1MDFA 1BN6A 2PUVA 4HXFB 4NNPA 5A0VA 1OFUX 2AKEA 2GXSA 2ZRLA 1L4UA 2XXJA 4ZV7A 5TGZA 5JYBA 3O5AA 3D6AA 3AILA 4ERXA 2XMDA 2B35A 4JUCA 2JZCA 3BRWD 1FSPA 2OHJA 4QVIA 1N2IA 3HCOA 4B2PA 1TTTA 2H7XA 1EWTA 3NW9A 3PZRA 1FNMA 1NFRA 2VLIA 4H7JA 4Q93A 4LI0A 3LHIA 2IYRA 4WJZA 3GPDG 1JG6A 4BNYA 5DIFA 3E4CA 4JI3B 5KYYB 4KQGA 3F1KA 4M38A 1WPGA 1BW9B 1NXQA 2GK4A 2JHPA 3UK0A 4H1UA 1NV8A 1F5NA 4EECA 1NVVQ 5A7HA 4QXPA 4PINA 4WQMA 5KWSA 2HMSA 1EP2B 3AYZB 4MAMA 2CMFA 4WN9B 1E1DA 3R3UA 3IB6A 4XB6B 4NOKA 2WY2D 1JR6A 2JLYA 1PI3A 1VIDA 2WMDA 3CLVA 1PTJA 1Q0LA 4I8DA 1N9GB 1KEEB 3QXXA 1G8HA 1M2KA 5EHZA 1P6QA 1DRWA 1LVGA 4B3DA 4AQ7A 5FBZA 2EZUA 4XIGS 2RIPA 1EG2A 1UBUS 3AJ9A 3M3HA 4L85A 3TLJA 3OT4A 3RF6A 1D6MA 3EY4A 4YUAA 2VDWA 4XI9A 4F92B 3EGXA 2D59A 3HO1A 2IP2A 5K05A 2BTQB 4L15A 1KARA 3R3XA 2HRQA 1ZMXA 4RQBA 3R6TA 1V9SA 4NBVA 1LPOA 3TO5A 2CCKA 3GMIA 4GZ3A 2QY9A 1G9TA 2CL5A 3SBOA 1MW9X 1SUEA 2XDWA 1MJ5A 1RKBA 4Q34A 4F60A 3FCSB 4FJ0A 4M9RA 2R751 4PLPA 1E58A 4BKPA 3GDGA 3S2EA 4D82A 4Q1FA 5ALWA 2OHIA 2X7HA 3KJXA 3LC7O 3HEAA 2JVIA 1A4XA 3F5SA 4UFPA 3FYUB 4Q7LA 3DEHA 4KYVA 3VH1A 4X64B 1GCIA 4EAAA 3C4QA 1PR1A 2VTVA 2YZNA 1P62B 1CUGA 5FFFA 3RUDA 3NDBB 5CR9A 1GGEA 3ND8A 1K3UB 3PDIB 4C6TB 4DPKA 2P2NA 3OU6A 5HK9A 3PYLA 1A9TA 3TI9A 4Y0NA 1TQ8A 1UP4A 4DLKA 5C1OA 4ZVUA 5LZ7A 5K6AC 1A4RA 1JX6A 3GZNB 5JAQA 1D0IA 1P2FA 3QE3A 1I2AA 1PLKA 3P27A 5L7YA 1RQRA 2Y1FA 2GD1O 2XV1A 3WKCA 5C81A 2PMEA 3DEYX 2KI5A 5REQA 3MINB 3JU3A 4QFDA 2BKAA 3ME5A 2JANA 4ECAA 4IPTA 1Q12A 5K0NA 5E3IA 5D6NA 2QE6A 4GD3Q 4WCFA 4C2BA 1PN3A 3VHRA 3AVYA 5KTYA 3KXKA 3PDHA 4B8WA 2H4JA 2V55B 2J3JA 1QUFA 4BFWA 4Z0HO 4CT0A 3ZLBA 4C0SA 2IXDA 3T06B 3JQEA 2IDZA 2A5GA 3GRRA 2ASVA 3V1NA 3UJAA 5KO2A 1YA6A 3REFA 4HFRA 2JLBA 4CF5A 3BJIC 1DQYA 1P17A 1QP8A 1R3DA 1WF6A 4KXMA 3EDRA 3NKLA 4CLDA 1CS4C 3O7WA 2ZIXB 4HMOA 4C21A 5E1BA 1U1FA 4PSUA 1VBMA 3IUYA 1ZDMA 1TCCA 2FUG6 2JHAA 5TARA 3LMKA 3TLGA 3ZXIA 4ADSG 4BX2A 4UOZA 1W35A 4DV2B 2RKBA 3OLZA 4Q21A 2EQ5A 1OLSB 1ZGBA 5GIOE 4U2GA 1O77A 4E7OA 3SFZA 3KOOA 3O26A 1J0DA 3TKLA 2XHZA 4KSYA 1GNLA 5D51S 4ANFA 4D3XA 2HJGA 5DF1A 3KQPA 1D4ZA 2NVBA 4AM8A 1KMHB 3FDZA 2H07A 5JY1A 3U1BA 9GPBA 2I7TA 3GFQA 5K3DA 1D4AA 4NOJA 4BUZA 3E23A 3WYBA 3NCTA 3ASYA 5TMDA 4CR6A 5BSVA 2ZCJA 3LYUA 1CJTC 3W77A 4QKQA 3BGWA 3S44A 2P2LA 3PIIA 4B8YA 5I5EA 2CLMB 4MI9A 4G86A 2A0YA 2BHSA 4HNAA 2H92A 4RK4A 3VNAA 2VF7A 4JL6A 4PHTA 2MHCA 3JWPA 1L5KA 5IF9A 4OATA 1Q20A 2AZTA 3L7JA 4G0XA 1OHHA 4IQ0A 3F5DA 4LF8B 3NKVA 1XRMA 3K6KA 4W63A 1FYXA 1ZCBA 2I65A 4IUDS 5EGSA 2A0FA 2QAGB 4TL8A 3WB0A 1NBOA 3R7BA 4A8PA 4CUJA 5H0IA 3E03A 4COKA 4NY1A 2YMPA 4L5YA 1WU8A 4C7VA 1IN4A 4C6SA 3EC7A 5HJ7A 5CLLA 4RY8A 1A97A 2I54A 4JB3A 2FE1A 3GG9A 4R54A 2DWQA 1C8LA 1PWYE 2F6RA 3DVRX 2BJHA 1XXHA 3HBJA 1E62A 3GOQA 3N3BC 1ID1A 1Z28A 1SWWA 3G8BA 2CXUA 2HHJA 3T5AA 5AUQA 4EGJA 3ZDDA 1WEKA 1YE5A 1A9ZA 2X0KA 4DG5A 4QYSA 1XA4A 3HTXA 2V9PA 3HXLA 2IPXA 2PFSA 5J59A 4XQGA 1H5QA 1L8OA 3UT6A 2O0KA 1G4HA 2VWQA 3IAS1 3SLRA 1E9SA 5HA5A 2YXDA 1VE7A 1Y4SA 2DLNA 3HY4A 5ALMA 2OUKA 1OWMA 1U2GC 4WNAB 5JCOA 1CD5A 2A6PA 1HBJA 1XLWA 4IXTA 4K40A 5EP2A 1M2EA 2GRAA 1UXKA 1CUHA 5JAUA 4BO4A 4LJKA 3AR5A 4RD4A 4FHFA 1C2TA 3FLBA 3RABA 4IDNA 2C7GA 3S27A 4F12A 2XGJA 3G7NA 2I87A 4QTZA 2MYUA 4CM8A 1Y34E 1MRNA 3H16A 3DOHA 4PZLA 5A02A 5JLJA 2OA0A 1RFGE 4BOYA 3ZHXA 2Q1XA 3WTBA 3VDXA 4TM8A 3WWDA 3QLUC 4CMEA 1A8PA 1J09A 1OWPA 2V7UA 1R6DA 2QZZA 3H5VA 3T3DA 4LJSA 3QPBA 4K9QA 1RI3A 4EKEA 3KJIA 1Y3BE 2HXYA 1GTMA 2ZE6A 3LC0A 2ZUBA 3OEED 4OXXA 1R6UA 4E1AA 3U6BA 1MA0A 4ZAGA 5B7PA 1OGYA 3KZCA 2FDXA 4Z53A 3PV0A 1LTKA 1CIJA 1FBTA 3SKYA 1ML3A 1EVYA 3KLMX 2CV1A 2ZXFA 2OFOA 1JJVA 5IKXA 1RBMA 2JIQA 4F6CA 3TNLA 2UZ4A 4UUAA 5BW4A 3MF4A 3A58B 1RLMA 3CO0S 4RK1A 2PSFA 2R87A 4AZ3B 3J7AC 3W8FA 5KQMA 1WXIA 4K88A 4HPJB 1JKIA 3NOXA 4GX5A 4NC9A 5TPWA 1I80A 1KK1A 1QGOA 2DPGA 2MSLA 3DS8A 3PTZA 2JI9A 3H5NA 2HUPA 2O1EA 1Y1SA 4IMIB 4L28A 3TTWA 2JVKA 2SCUB 3FR7A 4FN4A 2Q5QA 4RTSA 5EXXA 2I78A 4AC9A 1ISFA 4BBZA 3T0FA 4WY5A 1XYVA 2QMZA 4NJEA 2AEJA 2ASEA 3EIHA 3HB5X 4JYPA 1G17A 1VFNA 2P9CA 3PXUA 4K05A 3K0AB 4MS1A 4BZZA 2AJTA 3VGJA 3P20A 3ZH9B 1GUDA 3L3BA 1O95D 4UMFA 1PEYA 2YV5A 3LHKA 4K03A 4DRYA 1K5DA 5AM1A 2JLCA 1G6HA 3NJ8A 4QJBA 3ZKWA 3SYLA 2UUOA 3K0EA 3TLGB 5MF6A 1NJ6A 2ZI9A 5L4SA 2QG9A 4EJMA 3C5EA 4DKJA 1UJ6A 4U2CA 1F1JA 1KFEB 3RROA 3SQLA 3ZY2A 3DLBA 4QAQA 1LQUA 3HVHA 4JYCA 4MWTA 3OETA 4OXYA 1Y5MA 3K0KA 4RMNA 1C0PA 5ALTA 3LY9A 1T3ZA 3H2GA 3N7AA 4MRMA 1SG9A 4YCDA 4FLMA 3ZJ4A 1C1XA 5I9MA 1JILA 3WE7A 1UPUA 5BYKA 4X45A 3OOJA 4JXKA 1LTQA 1D5CA 2B2NA 4Z9BA 1FSGA 3HR4A 1QE3A 3RANA 4B3IA 1CULC 3DNPA 4LV8B 4OU5A 3S3TA 1W4CA 3K0HA 3L4BC 2H06A 2Q2QA 3N2KB 3B1WA 1ST3A 4ZVPA 1AHNA 3CN9A 3S2YA 5K2OA 4M60A 1NOKA 1XMPA 2VF4X 1GD1O 3HV0A 4M8NE 1J8DA 2QPAA 3GF4A 4ITUA 1P1FA 1ZI9A 3GQBB 2PD3A 1BU5A 1MAAA 2RHWA 2ZJ5A 4C7BA 1SD1A 4PS0A 2IYAA 2A0UA 5CNJA 3ICOA 2ACEA 4G36A 4YIHA 2VQDA 1UFQA 3AB7A 5HQ3B 4KQ1A 4BXOA 5BW5A 2VG8A 2B78A 3FKJA 4PAQA 4QOGA 1IY9A 1P2BA 1I4WA 4L7QA 5AHRA 1CUZA 4M0DA 4L8LA 1JVSA 3FZGA 4WNCA 4XQEA 5JE8A 1PR9A 3SC6A 4JS0A 4K9DA 4DRZA 4EGCB 1IDOA 3K7EA 4G9EA 4ETWA 4F4IA 1L8QA 1L7NA 4RTRA 4OHRA 1N5JA 2IPMA 1Q0QA 4ZHSA 5JZSA 4LDZA 1U2DC 1HSOA 2BEJA 2Z9BA 3CMMA 4RUKA 1FW8A 4KBYA 1L0BA 3DT8A 1DEHA 1YZLA 2AN4A 2II6A 3MJVA 2IEBA 4WXYB 4Z8YA 2VP0A 4O3MA 4X1IA 4H08A 3DCIA 2A9JA 3RWOA 2FZCA 3F47A 4U00A 3ZY3A 1JQ3A 1U7UA 2AW5A 2RK6A 5TPZD 3JWEA 1MIHA 4O33A 4O29A 4ZAFA 1R0XA 1YONA 5DISB 3BK1A 1TJNA 3KWMA 1GZ6A 2FWMX 3U9LA 3HBMA 4KE7A 3T3IA 1KJIA 2QZ4A 1EIWA 1TD9A 2E21A 2OHHA 1JHDA 2YYSA 3KELA 4JP8A 4WK0B 3UFXA 4QPDA 3NEJA 3IBSA 4BBJA 1PT8A 4KXWA 5ALPA 4F56A 3AVTA 4FNGA 3I3SR 1Y8ZA 1ZZEA 3RASA 3TQIA 4OAQA 4QUGA 3W4IA 4F84A 1FDSA 5T4EA 5EE1A 1G8AA 4UNIA 1V47A 2BKUA 2GCOA 2HNKA 3H5WA 3PC4A 2Q5FA 4UHKA 3ZIDA 3NMUF 1G21A 4V0MA 5K8TA 3WBFA 3C3XA 3SF0A 1EB8A 3FDFA 1XJ0A 3LHSA 1TVKB 5CVVA 3RQSA 3T7JA 1JB1A 3GP5A 1OFTA 3ZCUA 4OQFA 4QL3A 2AXEA 1ZI6A 3OTHA 4ZVVA 1EQAA 4P7FA 4R8KA 3UHAA 3HKCA 4P32A 2J59A 3LNTA 1WNFA 1XIVA 2GYYA 2V58A 1J8YF 2FVXA 2Y0PA 3C3EA 4G0YA 3FHLA 4G1VA 3T0GA 1T9HA 4XPIB 1OSNA 4P92A 5CA1A 3IBYA 1HDXA 3K9CA 4OXNA 3ZLUA 4UMEA 4YPFA 4BZXA 3PD7A 2MU1A 2O48X 4J75A 3LIPA 2PBFA 4WMLA 4Y1RB 2FN7A 4XW2A 1L5QA 2FUCA 2QTTA 3BIWA 1PS8A 1IJEA 2E6UX 1A96A 3MAGA 1FIUA 1N1MA 3OVMA 2PLWA 3V7NA 3L7NA 2BGIA 3OKCA 4DV4B 2V54A 4WE3A 3L7IA 4P8RA 1FXWA 1W76A 1CJUC 5K3AA 3ZK7A 2Q6OA 2Z43A 4FT4A 4Q0MA 1A9SA 2OWDA 1DOZA 1X42A 1CF9A 5TXGA 3NTQA 4RJIA 1G63A 1Z7GA 2MYTA 1XN4A 5F51A 1ZY2A 2P3QA 3L40A 4QOSA 3K5PA 3SR3A 2Q49A 3TAHA 1X7ZA 4J1QA 4M1MA 1T1RA 1TKRA 2FETA 1TF5A 3L8EA 2BGKA 2OPBA 2GBGA 2Z56A 3EHDA 1RYBA 3CF6R 1D1TA 4FS3A 1X1CA 3IAXA 4W7HA 2Q3BA 3VV3A 3KPWA 3GXOA 4NJMA 1I7SB 1VTKA 4A15A 5ICFA 3ZW7A 2WA2A 1CUFA 2NSJA 1B6SA 1SO8A 4GM0A 2G7MC 3FRIA 1GLVA 1KI2A 1HGXA 2YMMA 4UFOA 4BCCA 4C1NA 3GDFA 1JEAA 4GPD1 3IUNA 4YROA 3WO0A 2G07A 4O1MA 1TTHA 2E3JA 3GNLA 2VTDA 2FPPB 2HF7A 1MJGA 1Y6QA 1A3CA 2FH5B 2H5JA 2BM8A 4G4JA 3B6KA 4Z9FA 2UUPA 3ZUPA 1JLRA 4IJ6A 3ICPA 1F8YA 1N2SA 3Q5DA 5CNMA 1GAWA 4HATA 4MPJA 4LRWA 4JOCA 1PV4A 1H69A 2JDIA 4QDZA 5HF5A 3U4IA 3RU7A 4K0RA 4DARA 2P6NA 4GH5A 1QVVA 2C97A 3NBKA 4DLBA 4BRUA 1T8SA 4H7EA 2FWNA 2Q4EA 4D0NA 2FSFA 4EZEA 3KOMA 2R1TA 1FLVA 2XYPA 4TXHA 5AI5A 4BO0A 2NP7A 1S0UA 1QGYA 2HJWA 1TM4E 5J4HA 1GSOA 1TPYA 3EQ7A 1IY1A 5HKLA 5JXHA 3JALB 2I7CA 4KWEA 1REQB 3QFCA 1J56A 4PYNA 4HQRA 3AM1A 1K4YA 1HRDA 2Y1KA 1BMFA 4QXOA 2ZETA 2NO0A 1JXQA 1T0UA 3GWGA 1IDN1 221PA 2JAUA 3RS9A 3WDLA 4A10A 5F73A 2HJ9A 2Q21A 4NFSA 2P1DA 4RF3A 2FTKE 4RZSA 4D8XA 3P9NA 4PC3A 2WC1A 3OJXA 4A0RA 2ZYGA 4EKIA 3CRNA 3ESBA 1VM6A 3BRWA 1P8JA 3WGLA 4YJ2A 4FHCA 2P1RA 4MLZA 5KREA 3LBYA 1LJUA 3U81A 4EX7A 2AK2A 3VC2A 2H2AA 2YNMC 3OU2A 3VYTB 1FYEA 4IIDA 2B3TA 4X41A 3LQFA 5TVGA 3K0FB 2EZTA 5JBQA 3JS5A 2HWKA 2I4LA 1T2EA 4GP6A 2P9GA 2GRUA 4CKEB 2GBCA 3R9XB 5J5AA 3CR3C 4QOIA 1YRHA 4YP9A 1JKXA 4QHYA 2C8JA 3JRXA 4ZZ2A 1MABA 1P5ZB 4D2IA 4PFKA 4KPUA 6ABPA 3DFIA 3ZDCA 2ODWA 2AMJA 3H2HA 1RKUA 5C8XA 3QHAA 4K86A 1WOYA 3L4JA 2IZ6A 1KTVA 2FZ5A 5FNZA 1JEYB 3KQNA 1F2VA 5LP6B 4LHVA 2H1HA 5EXPA 3KQHA 4Z9XA 3MWEB 2GD2A 3WLPA 4QIHA 4DXHA 4R6WA 2OT3B 3E27A 3B8EA 3GEPA 4F11A 3KDAA 3EPRA 3LUJA 4WADA 2NUPB 4K2HA 5FOWA 1TU0A 1K3TA 2R4TA 3A06A 1HTTA 3PL5A 1VE1A 1R4MA 1O5IA 4GNKA 5I8WA 3C8DA 2R6HA 3D0RA 4IXNA 3SGLA 3FNBA 2OXFA 5FBQB 1D6NA 5TLSA 2FEXA 1F5SA 5FF9A 5JS8A 3K6SA 3UQYS 3PNBA 4J03A 3CKMA 3CZ5A 4ZO4A 4LV6A 3K05A 4E11A 1NQAO 1DC5A 1AN0A 2C9CA 2YIJA 3CONA 2D62A 5DM60 4G5SA 1VE5A 4GMKA 4KHZA 1SK8A 2IH2A 1AKTA 4Z49A 4A73A 4AG5A 2YZKA 4BFXA 5CBPB 4HNTA 3CRQA 1AT1A 1SCIA 3OEYA 1E5TA 2VKTA 1C0LA 3O90A 4MGEA 3K8ZA 3AF3A 3ZNPA 3UBTA 4CLEA 2C2WA 1SXJD 2VZ0A 4GE3A 4MVWA 4CODB 1TLLA 4MVYA 2ATXA 1S4MA 2BZSA 2JIZA 3K5IA 3R1IA 4UOEA 2AHRA 4NV0A 1R9JA 4DSUA 1UXGA 1U8ZA 3DGEC 3TPCA 5HZHA 2F8SA 3LHFA 4NYJR 3LQ1A 1WKBA 1OLOA 3LKDA 4CQMA 1XPUA 2WEKA 3AVQA 4KPUB 4QEZA 4R0VA 4UAUA 1NDQA 1U9CA 1MEJA 3G2NA 1NY5A 1YS4A 3ZBPA 3HI6A 4MQEB 3WIBA 3JYNA 4LNHA 4ZZIA 3F46A 3M8KA 4KNWA 4ZVOA 5KINB 2X5XA 1E2FA 1AZWA 1JTEA 3LO8A 3G9TA 1Z22A 3MLEA 4N3GA 2P5UA 1AQYA 1ZITA 1NUHA 3K2BA 3T7RA 4I3GA 4EBFA 5CXUA 1DEXA 1RCTE 4TKVB 2NX2A 2REXB 3DJYA 4BAUA 3FKSD 4Y1GA 4QASA 3I5MA 4TTQA 4OHZA 3KXDA 1OT5A 2CVFA 4YJ2B 4BX3A 2IEAA 4D5EA 4Y7DA 2ZYIA 2P40A 4OTZA 2J3DA 3JTMA 1R27A 1WKVA 1QTNA 4OQQA 4QYIB 4RJLA 4UU8A 2ZAYA 3BRCA 4QPJC 1C3LA 2VHEA 4AUMA 5CB8A 4B3RB 3H13A 2QJOA 2G9RA 4KDFA 1PFWA 1K3FA 5JD5A 2FPGA 3AVXA 4CI0B 4TRRA 1WXWA 1AZSC 1TK2A 3BKXA 3LDAA 4MV5A 4RESA 1O54A 4IIJB 4JMLA 3K73O 3Q11A 1FTNA 1M2JA 5FPSA 5KHAA 3ANTA 4GOKA 3STXA 5ALXA 2Y67A 1V1RA 5EQFA 2GOYA 4FR5A 4WOCA 5CURA 1DBWA 1Y3IA 3LUCA 4N9WA 1BDIA 1ZUWA 2HH9A 1CQIA 4K1XA 4LRQA 3WAGA 2BFDA 2JH3A 3Q4GA 4Q7QA 4DQKA 5LCXA 1E4VA 2VDUE 3B9QA 3THYA 2GZMA 2AXQA 2P67A 4GVPA 4OOFA 3A2MA 4PZAA 3OKAA 2WU3A 3VBEA 3I0NA 5HIMA 1BE1A 4FCWA 4W5JA 3WGGA 4HOYA 4AMGA 4EB3A