2A11A

Crystal structure of nuclease domain of ribonuclase iii from mycobacterium tuberculosis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
154
structure length
154
Chain Sequence
IRSRQPLLDALGVDLPDELLSLALTHRSYAYENGGLPTNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKLRASVVNTQALADVARRLCAEGLGVHVLLGRGEANTGGADKSSILADGMESLLGAIYLQHGMEKAREVILRLFGPLLDAAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease III
publication title Structure of the nuclease domain of ribonuclease III from M. tuberculosis at 2.1 A
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription,translation,hydrolase
total genus 57
structure length 154
sequence length 154
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF14622 Ribonucleas_3_3 Ribonuclease-III-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2a11A00
1JFZA 2FFLA 2NUEA 2GSLA 1RC5A 1YZ9A 2NUGA 2NUFA 4OOGC 4M2ZA 2EZ6A 1RC7A 3O2RA 1YYKA 1O0WA 3RV0A 1I4SA 3O2RB 4M30A 1YYWA 2A11A 1U61A 3RV1A 2QVWA 1YYOA 3C4TA 2EB1A 3N3WA 3C4BA 4OUNA
chains in the Genus database with same CATH superfamily
1JFZA 2FFLA 2NUEA 2GSLA 1RC5A 1YZ9A 2NUGA 2NUFA 4OOGC 4M2ZA 2EZ6A 1RC7A 3O2RA 1YYKA 1O0WA 3RV0A 1I4SA 3O2RB 4M30A 1YYWA 2A11A 1U61A 3RV1A 2QVWA 1YYOA 1ZTDA 3C4TA 2EB1A 3N3WA 3C4BA 4OUNA
chains in the Genus database with same CATH topology
1JFZA 2FFLA 2NUEA 2GSLA 1RC5A 1YZ9A 2NUGA 2NUFA 4OOGC 4M2ZA 2EZ6A 1RC7A 3O2RA 1YYKA 1O0WA 3RV0A 1I4SA 3O2RB 4M30A 1YYWA 2A11A 1U61A 3RV1A 2QVWA 1YYOA 3C4TA 2EB1A 3N3WA 3C4BA 4OUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JFZ A;  2FFL A;  2NUE A;  2GSL A;  1RC5 A;  1YZ9 A;  2NUG A;  2NUF A;  4OOG C;  4M2Z A;  2EZ6 A;  1RC7 A;  3O2R A;  1YYK A;  1O0W A;  3RV0 A;  1I4S A;  3O2R B;  4M30 A;  1YYW A;  2A11 A;  1U61 A;  3RV1 A;  2QVW A;  1YYO A;  3C4T A;  2EB1 A;  3N3W A;  3C4B A;  4OUN A; 
#chains in the Genus database with same CATH topology
 1JFZ A;  2FFL A;  2NUE A;  2GSL A;  1RC5 A;  1YZ9 A;  2NUG A;  2NUF A;  4OOG C;  4M2Z A;  2EZ6 A;  1RC7 A;  3O2R A;  1YYK A;  1O0W A;  3RV0 A;  1I4S A;  3O2R B;  4M30 A;  1YYW A;  2A11 A;  1U61 A;  3RV1 A;  2QVW A;  1YYO A;  1ZTD A;  3C4T A;  2EB1 A;  3N3W A;  3C4B A;  4OUN A; 
#chains in the Genus database with same CATH homology
 1JFZ A;  2FFL A;  2NUE A;  2GSL A;  1RC5 A;  1YZ9 A;  2NUG A;  2NUF A;  4OOG C;  4M2Z A;  2EZ6 A;  1RC7 A;  3O2R A;  1YYK A;  1O0W A;  3RV0 A;  1I4S A;  3O2R B;  4M30 A;  1YYW A;  2A11 A;  1U61 A;  3RV1 A;  2QVW A;  1YYO A;  3C4T A;  2EB1 A;  3N3W A;  3C4B A;  4OUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...