2A13A

X-ray structure of protein from arabidopsis thaliana at1g79260
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
153
structure length
153
Chain Sequence
b'PPVHPFVAPLSYLLGTWRGQGEGEYPTIPSFRYGEEIRFSHSGKPVIAYTQKTWKLESGAPMHAESGYFRPRPDGSIEVVIAQSTGLVEVQKGTYNVDEQSIKLKSDLVGNASKVKEISREFELVDGKLSYVVRMSTTTNPLQPHLKAILDKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords At1g79260
publication title The structure and NO binding properties of the nitrophorin-like heme-binding protein from Arabidopsis thaliana gene locus At1g79260.1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 33
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08768 DUF1794 Domain of unknown function (DUF1794)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2a13A00
4M7MA 5FAZA 2JU3A 5D45A 1BSOA 4HPDA 1QWDA 5DPQA 3EBWA 1B4MA 1EQDA 1JZUA 2PY1A 1LFOA 1QG5A 3KQ0A 4YDBA 4YGHA 1G7NA 1HN2A 2NNQA 1CBRA 1A2DA 2FS6A 3BS2A 3CR6A 5D47A 5FENA 4GKCA 3APXA 4IMOA 1TXLA 1TOWA 2RQ0A 1LKEA 4A60A 4ZCBA 5B29A 1BM5A 1DZKA 1ZNLA 2ACPX 2QO5A 4ARHA 3FA8A 5EPQA 4RUNA 1TW4A 4M6SA 1FTPA 3Q6LA 4A1HA 2AT3X 4AZMA 1ERBA 4GE1A 1ZNHA 4GETA 2XSTA 3DSZA 2L67A 1G74A 2HMBA 5IO6A 1IW2A 4IB8A 3P6HA 1SY0A 3G7XA 3P6FA 3D96A 4TLJA 4ZHHA 2ASNX 1EXSA 3C77X 3P6EA 3U03A 3CBSA 1CBQA 2BLGA 3CQNA 3NQ3A 1LF7A 4TQ2A 1EW3A 3UEVA 2W2AA 1B56A 1X8PA 1A57A 3PPTA 5LJEA 2G79A 1BRQA 1KZWA 4A8ZA 4TJZA 2Q9SA 1D3SA 1JJJA 3APUA 1GT1A 1KT3A 2WQAE 1PMPA 5JR8A 1X8QA 1MVGA 4MVLA 1PM1X 1SXWA 4A1YA 1A3YA 4NNSA 1QABE 2R56A 2FT9A 2G7BA 3AKMA 1KT7A 1I04A 1E5PA 4TKHA 4NNTA 3T1DA 2G78A 3WVMA 1T8VA 5HZ6A 1ZNKA 1LIBA 3I0AA 1OBPA 4ZHCA 4AZOA 4YBPA 5CE4A 2POAA 1CJ5A 1UZ2X 1ZNDA 2RCTA 3O22A 3FEKA 4GNYA 2OVDA 3FR5A 3FA6A 4IB7A 4ORRA 1SY3A 1GT3A 5HZQA 3B2LA 1O8VA 3PH5A 4EFGA 1QY0A 2A13A 5C0NA 1ML7A 4ES7A 1DZPA 2AL0X 3CBCA 5LJHA 3D95A 1I4UA 5AQ6A 3JSQA 4XMHA 4D6AA 1NP4A 2FWVA 1GXAA 1O1VA 3FR4A 4QGXA 4ALOA 2P8GA 4QGWA 3NADA 1ICNA 4XMCA 1GT4A 5EZ2A 4D6BA 5D4AA 4DQ3A 5FFHA 5LJKA 3FENA 2AT6X 1X8NA 3KFFA 4QAEA 4OS0A 1DFVA 3FLLA 1EIOA 3D97A 1FELA 4Y0SA 1HQPA 3BY0A 3CMPA 1G5WA 1TOUA 4HFOA 3P6CA 2Q2PA 5LJBA 3FR2A 4ORUA 3VG2A 1PBOA 1LIDA 1KGLA 3MVFA 1H91A 1BJ7A 5HBSA 1SY2A 4UU2A 3ZUOA 4R0BA 1AQBA 3STNA 3U0DA 3VG5A 2GTFX 5H9KA 3APWA 3S26A 3FMZA 4I3DA 2OVAA 2A0AA 2GJ5A 3TGBA 3FW5A 1OBUA 4MVKA 5LJGA 4XMGA 1EALA 4N7DA 2CZTA 2K62A 4YCHA 2WR6A 2WEWA 1SXYA 1AELA 4LKTA 2Q39A 5HZ8A 5IO5A 4IB6A 4YGZA 3O2YA 1U17A 4ZH6A 2CM4A 2NNEA 4I3BA 1X8OA 1VPRA 1OEKA 4ORWA 5H9AA 4ORXA 4YKOA 2AMMX 1MDCA 3BX7A 1ACDA 2ANSA 4LKPA 4LZVA 1CBIA 5EEEA 2FR2A 3VG4A 4ZJ0A 4ALBA 3TGAA 3NPOA 1GX9A 2AT0X 4LZUA 1T68X 4AZQA 1A18A 3STMX 4AYHA 1LIFA 1E02A 1KT4A 1QQSA 1AB0A 3P6DA 5HWZA 2R73A 3BLGA 2F73A 3ZUIA 3BU9A 2LBVA 4Y0PA 1IIUA 4TKJA 1P6PA 4NYRA 1HMRA 3EBKA 4NP1A 4IAWA 4EEJA 3HK1A 1HBQA 3CQRA 3KFHA 5F7GA 2OZQA 4EDEA 1LIEA 4HPAA 3FIQA 4GRJA 5LJDA 3NX1A 1NP1A 3HWGA 4BVMA 5HCCC 4QYPA 1VYGA 3PP6A 4HPBA 1L6MA 4HPCA 1LPJA 2LB6A 5HA1A 4ZH9A 2MJIA 1R0UA 1ALBA 2MO5A 2DM5A 1BRPA 1DZMA 3ELXA 1D2UA 4WFVA 4NYQA 4I9SA 1B8EA 5KICA 1EPBA 2FS7A 1O1UA 1S2PA 2EU7X 3TGCA 4XMFA 1IFCA 3L4RA 4XMDA 1TVQA 1YIVA 2R74A 2JU7A 4AZRA 3VG3A 3FEPA 4YMYA 1HMSA 2LKKA 5LKEA 5EDCA 2LBAA 1ICMA 3WJEA 1ZNEA 1T0VA 5F1EA 4UU3A 1JV4A 1KOIA 3K3LA 4ORSA 5L8IA 1I05A 1FENA 4YKMA 4NLIA 1QY2A 5KIDA 2KTDA 3ELZA 3KFGA 1KT5A 3STKA 4ZHDA 4NLJA 4XMEA 1NGLA 3B2HA 1LNMA 5EDBA 1MUPA 1UREA 4PSQA 1YP6A 2LFOA 1JYDA 3VG7A 2RA6A 3FELA 1YWBA 5F6BA 3VG6A 1HBPA 2A2UA 1EIIA 5D8JA 1QFTA 4CK4A 1KZXA 3B2IA 2QO6A 1LICA 2YG2A 3OJYC 1OBQA 3UEUA 4WBKA 4IBAA 1KQWA 5HCEC 2AT8X 2Q4NA 3C76X 1ADLA 2X45A 4DQ4A 5L8NA 1AVGI 1GM6A 1FEMA 2WSJA 1KQXA 4YH0A 1BSYA 1ERXA 2JOZA 3RSWA 4AZPA 2JU8A 2W2FA 3IA8A 2NNDA 4OS3A 5LKFA 5HZ5A 3WBGA 2JN3A 1E06A 3SAOA 3UEWA 4AZNA 2E4JA 3JS1A 4MVIA 2MM3A 1IKJA 3U9PC 1FDQA 4IB9A 2QO4A 3BSZE 2WWPA 1DZJA 4KIIA 3TZSA 3NX2A 2KT4B 2WEXA 4GNWA 5HTEA 3HWEA 3I17A 3WJFA 2WQ9A 4TKBA 3EMMA 1U0XA 1BWYA 1IFBA 4QZUA 1JBHA 1KXOA 1S7DA 1EPAA 4OS8A 1CRBA 2HNXA 5LJCA 1GGLA 3WXQA 1X89A 4EXZA 2OVEA 2QM9A 3APVA 4IMNA 3NQ9A 1JYJA 2OFMX 1MX8A 3WJGA 3B2JA 3GAQA 3HWDA 1SA8A 1GT5A 1SY1A 3DTQA 3O19A 3B2KA 5D48A 5HA0A 2X46A 1E00A 2L9CA 1I06A 2FRSA 4IAXA 3WJCA 2L5PA 2Q2MA 4YFQA 1YP7A 1JJXA 1FE3A 4QYNA 2HZRA 3KZAA 3NP1A 2CBRA 5F58A 5HTDA 1SXXA 3F8AA 1BLRA 4TNNA 4Y0QA 4YBUA 5H9NA 3MBTA 5BVQA 2IFBA 1IKEA 1YWCA 4BQUA 3PEDA 2GC9A 2W2BA 2WUTA 3FA7A 4I3CA 1Z24A 2K23A 2RD7C 4ZR2A 2XKLA 1B0OA 2A3FX 3EYCA 1N0SA 1OPAA 1GX8A 1ZNGA 2ACOA 4K19A 1OPBA 1QFVA 2AKQA 1GKAB 2CBSA 1ZRYA 3FA9A 4QGVA 1YWAA 3CWKA 4ORYA 1PEEA 3BRNA 1BEBA 4I9RA 2CZUA 1U18A 5EEDA 3AKNA 3TF6A 1X71A 1HMTA 4RUUA 4ODDA 1RBPA 4YFRA 1KT6A 4OMWA 2ALLX 2HLVA 4GH7A 3ZQ3A 1BBPA 1RLBE 2FLJA 3FW4A 4YGGA 3RZYA 1XKIA 4O9SA 2NP1A 2HZQA 5BVTA 5B27A 1G85A 3QKGA 5HCDC 1DF3A 1VYFA 4N7CA 2HYSA 1EUOA 3F9DA 2O62A 4YFPA 5BVSA 5IO7A 5KHPA 2A2GA 2OFRX 1GKAA 1OEEA 1X8UA 2AT5X 2RCQA 3BDRA 1CBSA 4WFUA 4ZFXA 3IFBA 1MX7A 3NR3A 4QZTA 3C78X 4Y0RA 4ZHFA 4BOEA 5HZ9A 3WJBA 2N93A 5HAEA 3UEXA 5H8TA 2QOSC 4AW8A 3HWFA 1YUPA 4ZHGA 3WJDA 3EM0A 4YDAA 5F6ZA 1DV9A 3BU1A 5K06A 5L8OA 1S44A 5DG4A 1DC9A 2FTBA 3PECA 2CM9A 4YCEA 4ZGUA 1YWDA 1QY1A 2FR3A 2AH7X 1SXUA 4OMXA 3KFIA 3P6GA 3PH6A 1OEJA 1XCAA 2L68A 5H9LA 3BX8A 1BSQA
chains in the Genus database with same CATH superfamily
3FYFA 4M7MA 4Y59A 2JU3A 5FAZA 4DCBA 5D45A 5B11O 5B5GA 1BSOA 1VWLB 2IZIA 4HPDA 4GU8A 1QWDA 5DPQA 3EBWA 4O49A 1B4MA 1EQDA 1JZUA 2PY1A 1LFOA 2GH7A 4YVBA 1QG5A 1VWAB 2X32A 3KQ0A 2MHDA 4GGTA 4O3XB 2I5ZO 4YGHA 4YDBA 4BCSA 1G7NA 1HN2A 2NNQA 1CBRA 1A2DA 1STPA 2FS6A 3ZW1A 3BS2A 3CR6A 4Z28A 1VWKB 5D47A 5FENA 4GKCA 1SLEB 1VWGB 1VYOA 3APXA 4IMOA 1TXLA 1TOWA 2RQ0A 1LKEA 2X8FA 4ZCBA 3VE1A 4A60A 5B29A 1BM5A 1DZKA 1ZNLA 2ACPX 2IZJA 2QO5A 3D9WA 2X8SA 4ARHA 1SWSA 3FA8A 5EPQA 3VHHA 4RUNA 1TW4A 4M6SA 1FTPA 2RTCB 3Q6LA 5JD2A 4A1HA 2AT3X 4AZMA 1ERBA 4GE1A 3RDQA 1ZNHA 4GETA 2XSTA 3P02A 1VWPB 2PI3O 3DSZA 2F09A 4WHIA 2L67A 1G74A 2HMBA 2ZAIA 5IO6A 1IW2A 3PQUA 4IB8A 4JO6A 2AVIA 2A8GA 4EQAC 3P6HA 3SZHA 1JJJA 2OL6O 1SY0A 2FKJA 3G7XA 3P6FA 3D96A 1JIWI 4TLJA 2ASNX 1IJ8A 1EXSA 3C77X 3P6EA 4ZHHA 3CBSA 1CBQA 2BLGA 3CQNA 3NQ3A 1LF7A 4TQ2A 3U03A 1LCWA 1EW3A 1NQNA 2IZGB 3WYPA 3UEVA 2W2AA 1B56A 1X8PA 1AVDA 1A57A 3RDMA 4KH8A 3PPTA 1SWQA 5LJEA 2X56A 2G79A 1BRQA 1NC9A 1RAVA 3RBYA 4GDAA 4CDFA 1KZWA 4INNA 4A8ZA 4TJZA 2MWHA 1D3SA 2I5VO 2Q9SA 1Y53X 1RXKA 2A5CA 1GT1A 1KT3A 2WQAE 3APUA 4GGRA 1PMPA 2IZDB 5JR8A 4GUZA 1X8QA 2IZFB 1KL3A 1MVGA 4MVLA 1PM1X 1SXWA 4A1YA 1A3YA 2OL7A 4MEEA 3HTYA 4NNSA 1QABE 2R56A 3VE2A 2MF6A 2M4LA 3SZJA 2FT9A 2G7BA 3AKMA 1KT7A 2FGSA 1I04A 4NV7A 4DNEA 2CAMA 1E5PA 4TKHA 1SWLA 2BS5A 1LELA 4NNTA 2G78A 5FQ6E 2WPUA 3T1DA 3WVMA 1T8VA 5HZ6A 5B5FA 1ZNKA 2DJFA 1LIBA 4HWMA 5L3YA 3I0AA 4FGIB 1OBPA 4ZHCA 4AZOA 4YBPA 1VWRB 2POAA 2UYWA 3VHMA 5CE4A 5CHKA 1PBYA 1CJ5A 1UZ2X 1ZNDA 2RCTA 2OY1O 3OD9A 4FQBB 3O22A 3FEKA 4GNYA 1VWCB 2OVDA 3FA6A 3FR5A 2RTQB 4COTA 4IB7A 4ORRA 2VFCA 1SY3A 1GT3A 3RKGA 5HZQA 2G5LA 1LCVA 5IXGA 1LDOA 3B2LA 1O8VA 1VWQB 1PTSA 4BJ8A 3PH5A 4EFGA 1QY0A 2A13A 5C0NA 2RTIB 4O4OA 1ML7A 4OELA 4ES7A 1DZPA 3CKFA 1SWPA 2AL0X 3CBCA 2OFAA 5LJHA 3D95A 1I4UA 1MM9A 5AQ6A 3JSQA 4XMHA 4D6AA 1NP4A 1SLDB 2FWVA 4U46A 4GJSA 1GXAA 1O1VA 3FR4A 4CDCA 1SREA 4QGXA 4ALOA 2P8GA 4QGWA 3NADA 1ICNA 4NV8A 4XMCA 4KCAA 1GT4A 3RDXA 2RTOB 3D4RA 5EZ2A 1VWDB 4D6BA 2RTKA 3AEHA 5D4AA 4KC8A 1SWDA 4DQ3A 5FFHA 5LJKA 4GD9A 3FENA 2AT6X 1X8NA 1SRHA 3KFFA 4QAEA 4OS0A 1DFVA 3FLLA 1EIOA 4BX6A 3D97A 1FELA 5AJCA 4Y0SA 1HQPA 1KFFA 3JQOA 4CPEA 3BY0A 3CMPA 1VWMB 1G5WA 1TOUA 4HFOA 3P6CA 2Q2PA 5LJBA 2IZHB 1W4TA 3FR2A 4ORUA 4CSBA 3VG2A 1PBOA 1LIDA 2GTLO 2OYBO 1SLGB 1SWOA 1KGLA 3MVFA 1H91A 1BJ7A 5HBSA 1SY2A 4UU2A 3ZUOA 4R0BA 1OSPO 1AQBA 2VFBA 3STNA 2KW1A 3U0DA 5CYBA 3VG5A 2GTFX 2OL8O 2RTBB 3APWA 5H9KA 3S26A 3FMZA 4I3DA 2OVAA 4KC7A 2A0AA 2GJ5A 4Z2VA 3TGBA 3FW5A 1OBUA 4MVKA 1SWBA 5LJGA 4XMGA 1EALA 1I78A 2IZCB 4N7DA 2CZTA 2K62A 4YCHA 2WR6A 2WEWA 1SXYA 3PQSA 1AELA 4LKTA 2Q39A 1VWBB 2IZEB 4U8UN 5HZ8A 5IO5A 4QRLA 4CPIA 1SWRA 4IB6A 4YGZA 4Z27A 1LUQA 2IZAA 2QOMA 3O2YA 3SLJA 2X4MA 1U17A 4ZH6A 2CM4A 3T2XA 2NNEA 2RTNB 3ZI8A 4I3BA 1I9HA 1SWFA 1VPRA 1OEKA 1X8OA 3GE2A 4ORWA 5H9AA 3RY1A 4ORXA 4YKOA 2AMMX 1MDCA 3BX7A 1W6FA 1ACDA 2ANSA 4LKPA 2Y3FA 4LZVA 3RWXA 1CBIA 4U8UM 5EEEA 2FR2A 3VG4A 3VHIA 3QQ2A 1Y9TA 4ZJ0A 1RSTB 2X8TA 3TGAA 4ALBA 3NPOA 1GX9A 4ML7B 2F01A 2C1QA 2AT0X 3UAQA 4LZUA 1T68X 4MVEA 4AZQA 1A18A 3STMX 4AYHA 1LIFA 4BBOA 2RN4A 1Y0GA 1E02A 1KT4A 1QQSA 1AB0A 2Z4HA 3P6DA 4L1NA 2R73A 2HKDA 3BLGA 3HPEA 2BHVA 2G8CO 5HWZA 2F73A 3ZUIA 3BU9A 2LBVA 1JJUA 1SMPI 2OY7A 2BT9A 4Y0PA 3FIDA 3RY2A 1STRB 1IIUA 5CSEA 4TKJA 1P6PA 4NYRA 3WZPA 1HMRA 3EBKA 3S5VA 4NP1A 4IAWA 2GTLN 4BX7B 4EEJA 3HK1A 1HBQA 2KD2A 3CQRA 3KFHA 1SLFB 5F7GA 3RDSA 2OZQA 4EDEA 2ZAGA 1LIEA 3KVNA 4HPAA 3FIQA 4GRJA 1VWIB 3NX1A 5LJDA 1K24A 1NP1A 3S60A 3HWGA 4BVMA 5HCCC 3T6FA 4QYPA 1VYGA 3ZQ3A 2C1SA 3PP6A 4FBVA 4HPBA 4O4XA 3Q34A 1L6MA 2BC3A 4HPCA 1LPJA 2BSZA 3LHNA 2LB6A 5HA1A 4ZH9A 4GGZA 4ZFXA 2JMBA 2MJIA 4EKVA 1R0UA 4ID2A 1ALBA 2MO5A 2DM5A 2OF8A 3ZWEA 1WBIA 3P24A 1BRPA 1DZMA 3ELXA 2X34A 1D2UA 4WFVA 4NYQA 1N9MA 1B8EA 2OF9A 3NQKA 4GZVA 4I9SA 5KICA 1EPBA 2FS7A 2OVSA 1O1UA 1S2PA 2RTEB 3SOTA 2EU7X 1SWGA 3TGCA 4XMFA 1IFCA 3L4RA 4XMDA 1TVQA 1YIVA 4U3QA 2R74A 1EI5A 2JU7A 4AZRA 3VG3A 3FEPA 4YMYA 1HMSA 2LKKA 5LKEA 5EDCA 2LBAA 1ICMA 3WJEA 1ZNEA 1T0VA 5F1EA 1SWUA 4UU3A 1JV4A 2C4IA 1KOIA 3HOLA 1RXHA 3K3LA 4QNIA 1LDQA 4ORSA 5B3MO 5IRAA 5L8IA 3VGWA 1I05A 1FENA 4YKMA 1UYOX 4I95A 1FJ1E 4NLIA 4OKAA 3PDFA 1HXLA 1QY2A 5KIDA 1SRGA 4B55A 3S5XA 2KTDA 3ELZA 3KFGA 1KT5A 3STKA 1KL4A 4NLJA 4ZHDA 1KL5A 4XMEA 4BX5B 1NGLA 3B2HA 5BYPA 1LNMA 5EDBA 2RTGB 1MUPA 1UREA 4PSQA 3EC5A 4Z6JA 1YP6A 1VWHB 2LFOA 1JYDA 3VG7A 2RTRB 2RA6A 3FELA 1YWBA 3ZW0B 2VDFA 4JGLA 5F6BA 3VG6A 1HBPA 3F6ZB 4ZGFA 2A2UA 4MIRA 5D8JA 1QFTA 1SWJA 4GDZA 4CK4A 3WZQA 1EIIA 3NBXX 1KZXA 1AVEA 3B2IA 2QO6A 1LICA 2YG2A 4MISA 3OJYC 1OBQA 3UEUA 1VWEB 1N4JA 2JW1A 4WBKA 4IBAA 1KQWA 5B2AO 5HCEC 2AT8X 2Q4NA 3C76X 1ADLA 1E2TA 1SWHA 2X45A 4DQ4A 2RTAA 4CPFA 1RXJA 1AVGI 5L8NA 1GM6A 1FEMA 2WSJA 1NDJA 3PK2A 1KQXA 3SLTA 4YH0A 4CPHB 1BSYA 1ERXA 3EW2A 1STSB 4FBOA 4I60A 4O4SA 1HY2A 2JOZA 4GJVA 4BX5A 1GX3A 3RSWA 4O3YA 2JU8A 2W2FA 3T2WA 4AZPA 3IA8A 5IRWA 2NNDA 4OS3A 5LKFA 4QQ1A 5HZ5A 3WBGA 2JN3A 1E06A 3AUMO 3ZW0A 2Y32A 3SAOA 3LV4A 3UEWA 3ZZVA 2IZLB 4AZNA 2E4JA 1VWFB 3JS1A 4MVIA 5AJBA 5FQ7E 1N43A 4Z2PA 2MM3A 1IKJA 1MEPA 1NBXA 1FDQA 3U9PC 4IB9A 2QO4A 1DF8A 3BSZE 3RE6A 1SWCA 2WWPA 1DZJA 3CKGA 1HXZA 4KIIA 3TZSA 3NX2A 1Y9LA 2KT4B 2WEXA 4GNWA 5HTEA 4JNJA 3HWEA 3I17A 3WJFA 2WQ9A 4TKBA 3EMMA 2IZKA 2X55A 1U0XA 4CPHA 4O3WA 1BWYA 2RTPB 1N9YA 1IFBA 4QZUA 1JBHA 4FBRA 1KXOA 1S7DA 1EPAA 1VWNB 4OS8A 1CRBA 2HNXA 5LJCA 1GGLA 3WXQA 1X89A 4EXZA 2OVEA 2QM9A 3APVA 4IMNA 3NQ9A 1JYJA 2OFMX 1MX8A 4ON1A 3WJGA 3WYQA 1RSUB 2QCBA 3B2JA 3GAQA 3HWDA 3OE3A 1SA8A 1GT5A 1SY1A 2Z4IA 5FQ8E 3DTQA 3O19A 3B2KA 5D48A 1VWJB 5HA0A 2X46A 1E00A 2L9CA 1I06A 2FRSA 5AEOA 4IAXA 3WJCA 1MK5A 2L5PA 2Q2MA 2QMIA 2UZ2A 1YP7A 4I6SA 1HQQA 4YFQA 5K68A 1JJXA 1FE3A 4QYNA 3WOVA 2HZRA 3WZOA 3KZAA 3VU1A 3NP1A 2CBRA 1SRFA 2OY8A 2BS6A 5F58A 1SXXA 5HTDA 5K67A 3F8AA 1BLRA 4L3RA 1SRJA 1SWNA 4TNNA 4Y0QA 4YBUA 5H9NA 3MBTA 3OBLA 5BVQA 2GTLM 2IFBA 1IKEA 3EW1A 3MG5A 1YWCA 2LA7A 3PEDA 4BQUA 2GC9A 2W2BA 2WUTA 3FA7A 4I3CA 4NW4A 1Z24A 2K23A 2RD7C 3T6LA 4ZR2A 2IZBA 2XKLA 1B0OA 2A3FX 4CV7A 3EYCA 3X00A 1N0SA 1NQMA 1OPAA 1GX8A 1SWEA 1ZNGA 2ACOA 2JGSA 3LTWA 4GK9A 4K19A 1OPBA 1QFVA 2AKQA 3V8UA 1GKAB 2CBSA 1ZRYA 3HOEA 3ZW2A 3FA9A 1JMZA 4QGVA 2RTHB 1YWAA 1LCZA 2AF5A 2RTJA 3CWKA 4ORYA 1PEEA 3BRNA 1BEBA 4BX7A 4I9RA 1JMXA 2CZUA 2OFBA 2Y3EA 1K3BA 1U18A 3H3IA 5EEDA 3RDUA 1SRIA 3AKNA 3MX7A 3TF6A 1X71A 1HMTA 4IABA 4RUUA 4ODDA 1RBPA 4YFRA 1KT6A 4OMWA 2ALLX 2HLVA 2RTFB 4GH7A 4KT5A 1BBPA 4Y5DA 2RTDB 1RLBE 2A5BA 2FLJA 2RTMA 3FW4A 4PJ2A 4YGGA 1Y52X 3RZYA 3WZNA 1JQPA 2FHLA 2RTLA 3E3CA 3N91A 1XKIA 4O9SA 5F2BA 2NP1A 2HZQA 5BVTA 3RE5A 5B27A 4BX6B 1G85A 3QKGA 4C5PA 5HCDC 1DF3A 1VYFA 4N7CA 2HYSA 1EUOA 3F9DA 4U8UO 3SZIA 2YMSA 4Z2OA 1Y55X 2O62A 4YFPA 5BVSA 5IO7A 5KHPA 4IRWA 2A2GA 2OFRX 1GKAA 3MM0A 2OY5O 1OEEA 1SWTA 1SWKA 1X8UA 2AT5X 4LQZA 5B10O 2ZSCA 2RCQA 3BDRA 1CBSA 1UYNX 4WFUA 4BGFA 3IFBA 1MX7A 3NR3A 1N7YA 3C78X 4JHQA 4QZTA 4Y0RA 4BOEA 4ZHFA 5HZ9A 2FHNX 2N93A 3WJBA 3ZW1B 5HAEA 3UEXA 5H8TA 4CDEA 2QOSC 4AW8A 3HWFA 1YUPA 4ZHGA 3WJDA 3EM0A 4CDDA 4YDAA 1SWAA 1W5RA 5F6ZA 1DV9A 2DJGA 3BU1A 5K06A 2KTSA 5L8OA 1S44A 4O3ZA 5DG4A 3FDCA 1DC9A 2FTBA 3PECA 2CM9A 4YCEA 4ZGUA 1YWDA 1MOYA 1QY1A 1WUBA 2FR3A 3VPJE 3SLOA 2AH7X 1SXUA 4OMXA 2FKGA 3KFIA 3P6GA 3PH6A 1OEJA 1XCAA 4U9CA 2L68A 4O4UA 3BX8A 1BSQA 5H9LA 5IRUA 4OEMA 3RDOA 1VWOB
chains in the Genus database with same CATH topology
3FYFA 4M7MA 5FAZA 2JU3A 5D45A 1BSOA 4HPDA 4GU8A 1QWDA 5DPQA 3EBWA 4O49A 1B4MA 1EQDA 1JZUA 2PY1A 1LFOA 1QG5A 3KQ0A 4O3XB 2MHDA 4YDBA 4YGHA 1G7NA 1HN2A 2NNQA 1CBRA 1A2DA 3ZW1A 2FS6A 3BS2A 3CR6A 5D47A 5FENA 4GKCA 3APXA 4IMOA 3VE1A 1TXLA 1TOWA 2RQ0A 1LKEA 2X8FA 4ZCBA 4A60A 5B29A 1BM5A 1DZKA 1ZNLA 2ACPX 2QO5A 2X8SA 4ARHA 3FA8A 5EPQA 4RUNA 1TW4A 4M6SA 1FTPA 3Q6LA 4A1HA 2AT3X 4AZMA 1ERBA 4GE1A 1ZNHA 4GETA 2XSTA 3P02A 3DSZA 2F09A 4WHIA 2L67A 1G74A 2HMBA 2ZAIA 5IO6A 1IW2A 3PQUA 4IB8A 4EQAC 3P6HA 1SY0A 3G7XA 3P6FA 3D96A 1JIWI 4TLJA 2ASNX 1EXSA 3C77X 3P6EA 4ZHHA 3U03A 3CBSA 1CBQA 2BLGA 3CQNA 3NQ3A 1LF7A 4TQ2A 1EW3A 3UEVA 2W2AA 1B56A 1X8PA 1A57A 4KH8A 3PPTA 5LJEA 2G79A 1BRQA 3RBYA 1KZWA 4INNA 4A8ZA 4TJZA 2MWHA 1D3SA 2Q9SA 1JJJA 3APUA 1GT1A 1KT3A 2WQAE 1PMPA 5JR8A 1X8QA 1MVGA 4MVLA 1PM1X 1SXWA 4A1YA 1A3YA 4NNSA 3HTYA 1QABE 2R56A 3VE2A 2M4LA 2FT9A 2G7BA 3AKMA 1KT7A 1I04A 1E5PA 4TKHA 2BS5A 4NNTA 3T1DA 2G78A 5FQ6E 3WVMA 1T8VA 5HZ6A 1ZNKA 1LIBA 4HWMA 3I0AA 4FGIB 1OBPA 4ZHCA 4AZOA 4YBPA 5CE4A 2POAA 1CJ5A 1UZ2X 1ZNDA 2RCTA 3OD9A 4FQBB 3O22A 3FEKA 4GNYA 2OVDA 3FR5A 3FA6A 4COTA 4IB7A 4ORRA 1SY3A 1GT3A 3RKGA 5HZQA 3B2LA 1O8VA 3PH5A 4EFGA 1QY0A 2A13A 5C0NA 4O4OA 1ML7A 4ES7A 1DZPA 2AL0X 3CBCA 5LJHA 3D95A 1I4UA 5AQ6A 3JSQA 4XMHA 4D6AA 1NP4A 2FWVA 1GXAA 1O1VA 3FR4A 4QGXA 4ALOA 2P8GA 4QGWA 3NADA 1ICNA 4XMCA 4KCAA 1GT4A 3D4RA 5EZ2A 4D6BA 5D4AA 4KC8A 4DQ3A 5FFHA 5LJKA 3FENA 2AT6X 1X8NA 3KFFA 4QAEA 4OS0A 1DFVA 3FLLA 1EIOA 3D97A 1FELA 5AJCA 4Y0SA 1HQPA 3JQOA 3BY0A 3CMPA 1G5WA 1TOUA 4HFOA 3P6CA 2Q2PA 5LJBA 3FR2A 4ORUA 4CSBA 3VG2A 1PBOA 1LIDA 2GTLO 1KGLA 3MVFA 1H91A 1BJ7A 5HBSA 1SY2A 4UU2A 3ZUOA 4R0BA 1AQBA 3STNA 2KW1A 3U0DA 5CYBA 3VG5A 2GTFX 5H9KA 3APWA 3S26A 3FMZA 4I3DA 2OVAA 4KC7A 2A0AA 2GJ5A 3TGBA 3FW5A 1OBUA 4MVKA 5LJGA 4XMGA 1EALA 4N7DA 2CZTA 2K62A 4YCHA 2WR6A 2WEWA 1SXYA 3PQSA 1AELA 4LKTA 2Q39A 4U8UN 5HZ8A 5IO5A 4QRLA 4IB6A 4YGZA 3O2YA 1U17A 4ZH6A 2CM4A 2NNEA 3ZI8A 4I3BA 1X8OA 1VPRA 1OEKA 3GE2A 4ORWA 5H9AA 4ORXA 4YKOA 2AMMX 1MDCA 3BX7A 1ACDA 2ANSA 4LKPA 3RWXA 4LZVA 1CBIA 4U8UM 5EEEA 2FR2A 3VG4A 1Y9TA 4ZJ0A 4ALBA 2X8TA 3TGAA 3NPOA 1GX9A 4ML7B 2AT0X 3UAQA 4LZUA 1T68X 4MVEA 4AZQA 1A18A 3STMX 4AYHA 1LIFA 2RN4A 1E02A 1KT4A 1QQSA 1AB0A 2Z4HA 3P6DA 4L1NA 2R73A 3BLGA 5HWZA 2BHVA 2F73A 3ZUIA 3BU9A 2LBVA 1SMPI 2BT9A 4Y0PA 1IIUA 4TKJA 1P6PA 4NYRA 1HMRA 3EBKA 3S5VA 4NP1A 4IAWA 2GTLN 4EEJA 3HK1A 1HBQA 2KD2A 3CQRA 3KFHA 5F7GA 2OZQA 4EDEA 2ZAGA 1LIEA 4HPAA 3FIQA 4GRJA 5LJDA 3NX1A 1NP1A 3S60A 3HWGA 4BVMA 5HCCC 4QYPA 1VYGA 3PP6A 4FBVA 4HPBA 4O4XA 1L6MA 4HPCA 1LPJA 3LHNA 2LB6A 5HA1A 4ZH9A 2JMBA 2MJIA 1R0UA 4ID2A 1ALBA 2MO5A 2DM5A 3ZWEA 3P24A 1BRPA 1DZMA 3ELXA 1D2UA 4WFVA 4NYQA 3NQKA 1B8EA 4GZVA 4I9SA 5KICA 1EPBA 2FS7A 2OVSA 1O1UA 1S2PA 3SOTA 2EU7X 3TGCA 4XMFA 1IFCA 3L4RA 4XMDA 1TVQA 1YIVA 4U3QA 2R74A 1EI5A 2JU7A 4AZRA 3VG3A 3FEPA 4YMYA 1HMSA 2LKKA 5LKEA 5EDCA 2LBAA 1ICMA 3WJEA 1ZNEA 1T0VA 5F1EA 4UU3A 1JV4A 1KOIA 3HOLA 3K3LA 4QNIA 4ORSA 5L8IA 1I05A 1FENA 4YKMA 4I95A 4NLIA 1QY2A 5KIDA 3S5XA 2KTDA 3ELZA 3KFGA 1KT5A 3STKA 4ZHDA 4NLJA 4XMEA 1NGLA 3B2HA 5BYPA 1LNMA 5EDBA 1MUPA 1UREA 4PSQA 1YP6A 2LFOA 1JYDA 3VG7A 3ZW0B 2RA6A 3FELA 1YWBA 4JGLA 5F6BA 3VG6A 1HBPA 3F6ZB 4ZGFA 2A2UA 4MIRA 5D8JA 1QFTA 4GDZA 4CK4A 1EIIA 1KZXA 3NBXX 3B2IA 2QO6A 1LICA 2YG2A 4MISA 3OJYC 1OBQA 3UEUA 2JW1A 4WBKA 4IBAA 1KQWA 5HCEC 2AT8X 2Q4NA 3C76X 1ADLA 2X45A 4DQ4A 5L8NA 1AVGI 1GM6A 1FEMA 2WSJA 1KQXA 4YH0A 1BSYA 1ERXA 4FBOA 4O4SA 2JOZA 3RSWA 4O3YA 2JU8A 2W2FA 4AZPA 3IA8A 2NNDA 4OS3A 5LKFA 4QQ1A 5HZ5A 3WBGA 2JN3A 1E06A 3ZW0A 3SAOA 3UEWA 3LV4A 3ZZVA 4AZNA 2E4JA 3JS1A 4MVIA 5AJBA 5FQ7E 2MM3A 1IKJA 3U9PC 1FDQA 4IB9A 2QO4A 3BSZE 2WWPA 1DZJA 4KIIA 3TZSA 3NX2A 1Y9LA 2KT4B 2WEXA 4GNWA 5HTEA 3HWEA 3I17A 3WJFA 2WQ9A 4TKBA 3EMMA 1U0XA 4O3WA 1BWYA 1IFBA 4QZUA 1JBHA 4FBRA 1KXOA 1S7DA 1EPAA 4OS8A 1CRBA 2HNXA 5LJCA 1GGLA 3WXQA 1X89A 4EXZA 2OVEA 2QM9A 3APVA 4IMNA 3NQ9A 1JYJA 2OFMX 1MX8A 4ON1A 3WJGA 3B2JA 3GAQA 3HWDA 3OE3A 1SA8A 1GT5A 1SY1A 2Z4IA 5FQ8E 3DTQA 3O19A 3B2KA 5D48A 5HA0A 2X46A 1E00A 2L9CA 1I06A 2FRSA 5AEOA 4IAXA 3WJCA 2L5PA 2Q2MA 2QMIA 4YFQA 1YP7A 4I6SA 1JJXA 1FE3A 4QYNA 3WOVA 2HZRA 3KZAA 3VU1A 3NP1A 2CBRA 2BS6A 5F58A 1SXXA 5HTDA 3F8AA 1BLRA 4L3RA 4TNNA 4Y0QA 4YBUA 5H9NA 3MBTA 3OBLA 5BVQA 2GTLM 2IFBA 1IKEA 1YWCA 2LA7A 3PEDA 4BQUA 2GC9A 2W2BA 2WUTA 3FA7A 4I3CA 4NW4A 1Z24A 2K23A 2RD7C 4ZR2A 2XKLA 1B0OA 2A3FX 4CV7A 3EYCA 1N0SA 1OPAA 1GX8A 1ZNGA 2ACOA 4GK9A 4K19A 1OPBA 1QFVA 2AKQA 3V8UA 1GKAB 2CBSA 1ZRYA 3HOEA 3ZW2A 3FA9A 4QGVA 1YWAA 3CWKA 4ORYA 1PEEA 3BRNA 1BEBA 4I9RA 3H3IA 2CZUA 1U18A 5EEDA 3MX7A 3AKNA 3TF6A 1X71A 1HMTA 4IABA 4RUUA 4ODDA 1RBPA 4YFRA 1KT6A 4OMWA 2ALLX 2HLVA 4GH7A 3ZQ3A 4KT5A 1BBPA 1RLBE 2FLJA 3FW4A 4PJ2A 4YGGA 3RZYA 3E3CA 3N91A 1XKIA 4O9SA 2NP1A 2HZQA 5BVTA 5B27A 1G85A 3QKGA 5HCDC 1DF3A 1VYFA 4N7CA 2HYSA 1EUOA 3F9DA 4U8UO 2YMSA 2O62A 4YFPA 5BVSA 5IO7A 5KHPA 2A2GA 2OFRX 1GKAA 1OEEA 1X8UA 2AT5X 4LQZA 2RCQA 3BDRA 1CBSA 4WFUA 4ZFXA 3IFBA 1MX7A 3NR3A 4QZTA 3C78X 4Y0RA 4ZHFA 4BOEA 5HZ9A 3WJBA 2N93A 3ZW1B 5HAEA 3UEXA 5H8TA 2QOSC 4AW8A 3HWFA 1YUPA 4ZHGA 3WJDA 3EM0A 4YDAA 5F6ZA 1DV9A 3BU1A 5K06A 2KTSA 5L8OA 1S44A 4O3ZA 5DG4A 1DC9A 2FTBA 3PECA 2CM9A 4YCEA 4ZGUA 1YWDA 1QY1A 3VPJE 2FR3A 2AH7X 1SXUA 4OMXA 3KFIA 3P6GA 3PH6A 1OEJA 1XCAA 4U9CA 2L68A 4O4UA 3BX8A 1BSQA 5H9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7M A;  5FAZ A;  2JU3 A;  5D45 A;  1BSO A;  4HPD A;  1QWD A;  5DPQ A;  3EBW A;  1B4M A;  1EQD A;  1JZU A;  2PY1 A;  1LFO A;  1QG5 A;  3KQ0 A;  4YDB A;  4YGH A;  1G7N A;  1HN2 A;  2NNQ A;  1CBR A;  1A2D A;  2FS6 A;  3BS2 A;  3CR6 A;  5D47 A;  5FEN A;  4GKC A;  3APX A;  4IMO A;  1TXL A;  1TOW A;  2RQ0 A;  1LKE A;  4A60 A;  4ZCB A;  5B29 A;  1BM5 A;  1DZK A;  1ZNL A;  2ACP X;  2QO5 A;  4ARH A;  3FA8 A;  5EPQ A;  4RUN A;  1TW4 A;  4M6S A;  1FTP A;  3Q6L A;  4A1H A;  2AT3 X;  4AZM A;  1ERB A;  4GE1 A;  1ZNH A;  4GET A;  2XST A;  3DSZ A;  2L67 A;  1G74 A;  2HMB A;  5IO6 A;  1IW2 A;  4IB8 A;  3P6H A;  1SY0 A;  3G7X A;  3P6F A;  3D96 A;  4TLJ A;  4ZHH A;  2ASN X;  1EXS A;  3C77 X;  3P6E A;  3U03 A;  3CBS A;  1CBQ A;  2BLG A;  3CQN A;  3NQ3 A;  1LF7 A;  4TQ2 A;  1EW3 A;  3UEV A;  2W2A A;  1B56 A;  1X8P A;  1A57 A;  3PPT A;  5LJE A;  2G79 A;  1BRQ A;  1KZW A;  4A8Z A;  4TJZ A;  2Q9S A;  1D3S A;  1JJJ A;  3APU A;  1GT1 A;  1KT3 A;  2WQA E;  1PMP A;  5JR8 A;  1X8Q A;  1MVG A;  4MVL A;  1PM1 X;  1SXW A;  4A1Y A;  1A3Y A;  4NNS A;  1QAB E;  2R56 A;  2FT9 A;  2G7B A;  3AKM A;  1KT7 A;  1I04 A;  1E5P A;  4TKH A;  4NNT A;  3T1D A;  2G78 A;  3WVM A;  1T8V A;  5HZ6 A;  1ZNK A;  1LIB A;  3I0A A;  1OBP A;  4ZHC A;  4AZO A;  4YBP A;  5CE4 A;  2POA A;  1CJ5 A;  1UZ2 X;  1ZND A;  2RCT A;  3O22 A;  3FEK A;  4GNY A;  2OVD A;  3FR5 A;  3FA6 A;  4IB7 A;  4ORR A;  1SY3 A;  1GT3 A;  5HZQ A;  3B2L A;  1O8V A;  3PH5 A;  4EFG A;  1QY0 A;  2A13 A;  5C0N A;  1ML7 A;  4ES7 A;  1DZP A;  2AL0 X;  3CBC A;  5LJH A;  3D95 A;  1I4U A;  5AQ6 A;  3JSQ A;  4XMH A;  4D6A A;  1NP4 A;  2FWV A;  1GXA A;  1O1V A;  3FR4 A;  4QGX A;  4ALO A;  2P8G A;  4QGW A;  3NAD A;  1ICN A;  4XMC A;  1GT4 A;  5EZ2 A;  4D6B A;  5D4A A;  4DQ3 A;  5FFH A;  5LJK A;  3FEN A;  2AT6 X;  1X8N A;  3KFF A;  4QAE A;  4OS0 A;  1DFV A;  3FLL A;  1EIO A;  3D97 A;  1FEL A;  4Y0S A;  1HQP A;  3BY0 A;  3CMP A;  1G5W A;  1TOU A;  4HFO A;  3P6C A;  2Q2P A;  5LJB A;  3FR2 A;  4ORU A;  3VG2 A;  1PBO A;  1LID A;  1KGL A;  3MVF A;  1H91 A;  1BJ7 A;  5HBS A;  1SY2 A;  4UU2 A;  3ZUO A;  4R0B A;  1AQB A;  3STN A;  3U0D A;  3VG5 A;  2GTF X;  5H9K A;  3APW A;  3S26 A;  3FMZ A;  4I3D A;  2OVA A;  2A0A A;  2GJ5 A;  3TGB A;  3FW5 A;  1OBU A;  4MVK A;  5LJG A;  4XMG A;  1EAL A;  4N7D A;  2CZT A;  2K62 A;  4YCH A;  2WR6 A;  2WEW A;  1SXY A;  1AEL A;  4LKT A;  2Q39 A;  5HZ8 A;  5IO5 A;  4IB6 A;  4YGZ A;  3O2Y A;  1U17 A;  4ZH6 A;  2CM4 A;  2NNE A;  4I3B A;  1X8O A;  1VPR A;  1OEK A;  4ORW A;  5H9A A;  4ORX A;  4YKO A;  2AMM X;  1MDC A;  3BX7 A;  1ACD A;  2ANS A;  4LKP A;  4LZV A;  1CBI A;  5EEE A;  2FR2 A;  3VG4 A;  4ZJ0 A;  4ALB A;  3TGA A;  3NPO A;  1GX9 A;  2AT0 X;  4LZU A;  1T68 X;  4AZQ A;  1A18 A;  3STM X;  4AYH A;  1LIF A;  1E02 A;  1KT4 A;  1QQS A;  1AB0 A;  3P6D A;  5HWZ A;  2R73 A;  3BLG A;  2F73 A;  3ZUI A;  3BU9 A;  2LBV A;  4Y0P A;  1IIU A;  4TKJ A;  1P6P A;  4NYR A;  1HMR A;  3EBK A;  4NP1 A;  4IAW A;  4EEJ A;  3HK1 A;  1HBQ A;  3CQR A;  3KFH A;  5F7G A;  2OZQ A;  4EDE A;  1LIE A;  4HPA A;  3FIQ A;  4GRJ A;  5LJD A;  3NX1 A;  1NP1 A;  3HWG A;  4BVM A;  5HCC C;  4QYP A;  1VYG A;  3PP6 A;  4HPB A;  1L6M A;  4HPC A;  1LPJ A;  2LB6 A;  5HA1 A;  4ZH9 A;  2MJI A;  1R0U A;  1ALB A;  2MO5 A;  2DM5 A;  1BRP A;  1DZM A;  3ELX A;  1D2U A;  4WFV A;  4NYQ A;  4I9S A;  1B8E A;  5KIC A;  1EPB A;  2FS7 A;  1O1U A;  1S2P A;  2EU7 X;  3TGC A;  4XMF A;  1IFC A;  3L4R A;  4XMD A;  1TVQ A;  1YIV A;  2R74 A;  2JU7 A;  4AZR A;  3VG3 A;  3FEP A;  4YMY A;  1HMS A;  2LKK A;  5LKE A;  5EDC A;  2LBA A;  1ICM A;  3WJE A;  1ZNE A;  1T0V A;  5F1E A;  4UU3 A;  1JV4 A;  1KOI A;  3K3L A;  4ORS A;  5L8I A;  1I05 A;  1FEN A;  4YKM A;  4NLI A;  1QY2 A;  5KID A;  2KTD A;  3ELZ A;  3KFG A;  1KT5 A;  3STK A;  4ZHD A;  4NLJ A;  4XME A;  1NGL A;  3B2H A;  1LNM A;  5EDB A;  1MUP A;  1URE A;  4PSQ A;  1YP6 A;  2LFO A;  1JYD A;  3VG7 A;  2RA6 A;  3FEL A;  1YWB A;  5F6B A;  3VG6 A;  1HBP A;  2A2U A;  1EII A;  5D8J A;  1QFT A;  4CK4 A;  1KZX A;  3B2I A;  2QO6 A;  1LIC A;  2YG2 A;  3OJY C;  1OBQ A;  3UEU A;  4WBK A;  4IBA A;  1KQW A;  5HCE C;  2AT8 X;  2Q4N A;  3C76 X;  1ADL A;  2X45 A;  4DQ4 A;  5L8N A;  1AVG I;  1GM6 A;  1FEM A;  2WSJ A;  1KQX A;  4YH0 A;  1BSY A;  1ERX A;  2JOZ A;  3RSW A;  4AZP A;  2JU8 A;  2W2F A;  3IA8 A;  2NND A;  4OS3 A;  5LKF A;  5HZ5 A;  3WBG A;  2JN3 A;  1E06 A;  3SAO A;  3UEW A;  4AZN A;  2E4J A;  3JS1 A;  4MVI A;  2MM3 A;  1IKJ A;  3U9P C;  1FDQ A;  4IB9 A;  2QO4 A;  3BSZ E;  2WWP A;  1DZJ A;  4KII A;  3TZS A;  3NX2 A;  2KT4 B;  2WEX A;  4GNW A;  5HTE A;  3HWE A;  3I17 A;  3WJF A;  2WQ9 A;  4TKB A;  3EMM A;  1U0X A;  1BWY A;  1IFB A;  4QZU A;  1JBH A;  1KXO A;  1S7D A;  1EPA A;  4OS8 A;  1CRB A;  2HNX A;  5LJC A;  1GGL A;  3WXQ A;  1X89 A;  4EXZ A;  2OVE A;  2QM9 A;  3APV A;  4IMN A;  3NQ9 A;  1JYJ A;  2OFM X;  1MX8 A;  3WJG A;  3B2J A;  3GAQ A;  3HWD A;  1SA8 A;  1GT5 A;  1SY1 A;  3DTQ A;  3O19 A;  3B2K A;  5D48 A;  5HA0 A;  2X46 A;  1E00 A;  2L9C A;  1I06 A;  2FRS A;  4IAX A;  3WJC A;  2L5P A;  2Q2M A;  4YFQ A;  1YP7 A;  1JJX A;  1FE3 A;  4QYN A;  2HZR A;  3KZA A;  3NP1 A;  2CBR A;  5F58 A;  5HTD A;  1SXX A;  3F8A A;  1BLR A;  4TNN A;  4Y0Q A;  4YBU A;  5H9N A;  3MBT A;  5BVQ A;  2IFB A;  1IKE A;  1YWC A;  4BQU A;  3PED A;  2GC9 A;  2W2B A;  2WUT A;  3FA7 A;  4I3C A;  1Z24 A;  2K23 A;  2RD7 C;  4ZR2 A;  2XKL A;  1B0O A;  2A3F X;  3EYC A;  1N0S A;  1OPA A;  1GX8 A;  1ZNG A;  2ACO A;  4K19 A;  1OPB A;  1QFV A;  2AKQ A;  1GKA B;  2CBS A;  1ZRY A;  3FA9 A;  4QGV A;  1YWA A;  3CWK A;  4ORY A;  1PEE A;  3BRN A;  1BEB A;  4I9R A;  2CZU A;  1U18 A;  5EED A;  3AKN A;  3TF6 A;  1X71 A;  1HMT A;  4RUU A;  4ODD A;  1RBP A;  4YFR A;  1KT6 A;  4OMW A;  2ALL X;  2HLV A;  4GH7 A;  3ZQ3 A;  1BBP A;  1RLB E;  2FLJ A;  3FW4 A;  4YGG A;  3RZY A;  1XKI A;  4O9S A;  2NP1 A;  2HZQ A;  5BVT A;  5B27 A;  1G85 A;  3QKG A;  5HCD C;  1DF3 A;  1VYF A;  4N7C A;  2HYS A;  1EUO A;  3F9D A;  2O62 A;  4YFP A;  5BVS A;  5IO7 A;  5KHP A;  2A2G A;  2OFR X;  1GKA A;  1OEE A;  1X8U A;  2AT5 X;  2RCQ A;  3BDR A;  1CBS A;  4WFU A;  4ZFX A;  3IFB A;  1MX7 A;  3NR3 A;  4QZT A;  3C78 X;  4Y0R A;  4ZHF A;  4BOE A;  5HZ9 A;  3WJB A;  2N93 A;  5HAE A;  3UEX A;  5H8T A;  2QOS C;  4AW8 A;  3HWF A;  1YUP A;  4ZHG A;  3WJD A;  3EM0 A;  4YDA A;  5F6Z A;  1DV9 A;  3BU1 A;  5K06 A;  5L8O A;  1S44 A;  5DG4 A;  1DC9 A;  2FTB A;  3PEC A;  2CM9 A;  4YCE A;  4ZGU A;  1YWD A;  1QY1 A;  2FR3 A;  2AH7 X;  1SXU A;  4OMX A;  3KFI A;  3P6G A;  3PH6 A;  1OEJ A;  1XCA A;  2L68 A;  5H9L A;  3BX8 A;  1BSQ A; 
#chains in the Genus database with same CATH topology
 3FYF A;  4M7M A;  4Y59 A;  2JU3 A;  5FAZ A;  4DCB A;  5D45 A;  5B11 O;  5B5G A;  1BSO A;  1VWL B;  2IZI A;  4HPD A;  4GU8 A;  1QWD A;  5DPQ A;  3EBW A;  4O49 A;  1B4M A;  1EQD A;  1JZU A;  2PY1 A;  1LFO A;  2GH7 A;  4YVB A;  1QG5 A;  1VWA B;  2X32 A;  3KQ0 A;  2MHD A;  4GGT A;  4O3X B;  2I5Z O;  4YGH A;  4YDB A;  4BCS A;  1G7N A;  1HN2 A;  2NNQ A;  1CBR A;  1A2D A;  1STP A;  2FS6 A;  3ZW1 A;  3BS2 A;  3CR6 A;  4Z28 A;  1VWK B;  5D47 A;  5FEN A;  4GKC A;  1SLE B;  1VWG B;  1VYO A;  3APX A;  4IMO A;  1TXL A;  1TOW A;  2RQ0 A;  1LKE A;  2X8F A;  4ZCB A;  3VE1 A;  4A60 A;  5B29 A;  1BM5 A;  1DZK A;  1ZNL A;  2ACP X;  2IZJ A;  2QO5 A;  3D9W A;  2X8S A;  4ARH A;  1SWS A;  3FA8 A;  5EPQ A;  3VHH A;  4RUN A;  1TW4 A;  4M6S A;  1FTP A;  2RTC B;  3Q6L A;  5JD2 A;  4A1H A;  2AT3 X;  4AZM A;  1ERB A;  4GE1 A;  3RDQ A;  1ZNH A;  4GET A;  2XST A;  3P02 A;  1VWP B;  2PI3 O;  3DSZ A;  2F09 A;  4WHI A;  2L67 A;  1G74 A;  2HMB A;  2ZAI A;  5IO6 A;  1IW2 A;  3PQU A;  4IB8 A;  4JO6 A;  2AVI A;  2A8G A;  4EQA C;  3P6H A;  3SZH A;  1JJJ A;  2OL6 O;  1SY0 A;  2FKJ A;  3G7X A;  3P6F A;  3D96 A;  1JIW I;  4TLJ A;  2ASN X;  1IJ8 A;  1EXS A;  3C77 X;  3P6E A;  4ZHH A;  3CBS A;  1CBQ A;  2BLG A;  3CQN A;  3NQ3 A;  1LF7 A;  4TQ2 A;  3U03 A;  1LCW A;  1EW3 A;  1NQN A;  2IZG B;  3WYP A;  3UEV A;  2W2A A;  1B56 A;  1X8P A;  1AVD A;  1A57 A;  3RDM A;  4KH8 A;  3PPT A;  1SWQ A;  5LJE A;  2X56 A;  2G79 A;  1BRQ A;  1NC9 A;  1RAV A;  3RBY A;  4GDA A;  4CDF A;  1KZW A;  4INN A;  4A8Z A;  4TJZ A;  2MWH A;  1D3S A;  2I5V O;  2Q9S A;  1Y53 X;  1RXK A;  2A5C A;  1GT1 A;  1KT3 A;  2WQA E;  3APU A;  4GGR A;  1PMP A;  2IZD B;  5JR8 A;  4GUZ A;  1X8Q A;  2IZF B;  1KL3 A;  1MVG A;  4MVL A;  1PM1 X;  1SXW A;  4A1Y A;  1A3Y A;  2OL7 A;  4MEE A;  3HTY A;  4NNS A;  1QAB E;  2R56 A;  3VE2 A;  2MF6 A;  2M4L A;  3SZJ A;  2FT9 A;  2G7B A;  3AKM A;  1KT7 A;  2FGS A;  1I04 A;  4NV7 A;  4DNE A;  2CAM A;  1E5P A;  4TKH A;  1SWL A;  2BS5 A;  1LEL A;  4NNT A;  2G78 A;  5FQ6 E;  2WPU A;  3T1D A;  3WVM A;  1T8V A;  5HZ6 A;  5B5F A;  1ZNK A;  2DJF A;  1LIB A;  4HWM A;  5L3Y A;  3I0A A;  4FGI B;  1OBP A;  4ZHC A;  4AZO A;  4YBP A;  1VWR B;  2POA A;  2UYW A;  3VHM A;  5CE4 A;  5CHK A;  1PBY A;  1CJ5 A;  1UZ2 X;  1ZND A;  2RCT A;  2OY1 O;  3OD9 A;  4FQB B;  3O22 A;  3FEK A;  4GNY A;  1VWC B;  2OVD A;  3FA6 A;  3FR5 A;  2RTQ B;  4COT A;  4IB7 A;  4ORR A;  2VFC A;  1SY3 A;  1GT3 A;  3RKG A;  5HZQ A;  2G5L A;  1LCV A;  5IXG A;  1LDO A;  3B2L A;  1O8V A;  1VWQ B;  1PTS A;  4BJ8 A;  3PH5 A;  4EFG A;  1QY0 A;  2A13 A;  5C0N A;  2RTI B;  4O4O A;  1ML7 A;  4OEL A;  4ES7 A;  1DZP A;  3CKF A;  1SWP A;  2AL0 X;  3CBC A;  2OFA A;  5LJH A;  3D95 A;  1I4U A;  1MM9 A;  5AQ6 A;  3JSQ A;  4XMH A;  4D6A A;  1NP4 A;  1SLD B;  2FWV A;  4U46 A;  4GJS A;  1GXA A;  1O1V A;  3FR4 A;  4CDC A;  1SRE A;  4QGX A;  4ALO A;  2P8G A;  4QGW A;  3NAD A;  1ICN A;  4NV8 A;  4XMC A;  4KCA A;  1GT4 A;  3RDX A;  2RTO B;  3D4R A;  5EZ2 A;  1VWD B;  4D6B A;  2RTK A;  3AEH A;  5D4A A;  4KC8 A;  1SWD A;  4DQ3 A;  5FFH A;  5LJK A;  4GD9 A;  3FEN A;  2AT6 X;  1X8N A;  1SRH A;  3KFF A;  4QAE A;  4OS0 A;  1DFV A;  3FLL A;  1EIO A;  4BX6 A;  3D97 A;  1FEL A;  5AJC A;  4Y0S A;  1HQP A;  1KFF A;  3JQO A;  4CPE A;  3BY0 A;  3CMP A;  1VWM B;  1G5W A;  1TOU A;  4HFO A;  3P6C A;  2Q2P A;  5LJB A;  2IZH B;  1W4T A;  3FR2 A;  4ORU A;  4CSB A;  3VG2 A;  1PBO A;  1LID A;  2GTL O;  2OYB O;  1SLG B;  1SWO A;  1KGL A;  3MVF A;  1H91 A;  1BJ7 A;  5HBS A;  1SY2 A;  4UU2 A;  3ZUO A;  4R0B A;  1OSP O;  1AQB A;  2VFB A;  3STN A;  2KW1 A;  3U0D A;  5CYB A;  3VG5 A;  2GTF X;  2OL8 O;  2RTB B;  3APW A;  5H9K A;  3S26 A;  3FMZ A;  4I3D A;  2OVA A;  4KC7 A;  2A0A A;  2GJ5 A;  4Z2V A;  3TGB A;  3FW5 A;  1OBU A;  4MVK A;  1SWB A;  5LJG A;  4XMG A;  1EAL A;  1I78 A;  2IZC B;  4N7D A;  2CZT A;  2K62 A;  4YCH A;  2WR6 A;  2WEW A;  1SXY A;  3PQS A;  1AEL A;  4LKT A;  2Q39 A;  1VWB B;  2IZE B;  4U8U N;  5HZ8 A;  5IO5 A;  4QRL A;  4CPI A;  1SWR A;  4IB6 A;  4YGZ A;  4Z27 A;  1LUQ A;  2IZA A;  2QOM A;  3O2Y A;  3SLJ A;  2X4M A;  1U17 A;  4ZH6 A;  2CM4 A;  3T2X A;  2NNE A;  2RTN B;  3ZI8 A;  4I3B A;  1I9H A;  1SWF A;  1VPR A;  1OEK A;  1X8O A;  3GE2 A;  4ORW A;  5H9A A;  3RY1 A;  4ORX A;  4YKO A;  2AMM X;  1MDC A;  3BX7 A;  1W6F A;  1ACD A;  2ANS A;  4LKP A;  2Y3F A;  4LZV A;  3RWX A;  1CBI A;  4U8U M;  5EEE A;  2FR2 A;  3VG4 A;  3VHI A;  3QQ2 A;  1Y9T A;  4ZJ0 A;  1RST B;  2X8T A;  3TGA A;  4ALB A;  3NPO A;  1GX9 A;  4ML7 B;  2F01 A;  2C1Q A;  2AT0 X;  3UAQ A;  4LZU A;  1T68 X;  4MVE A;  4AZQ A;  1A18 A;  3STM X;  4AYH A;  1LIF A;  4BBO A;  2RN4 A;  1Y0G A;  1E02 A;  1KT4 A;  1QQS A;  1AB0 A;  2Z4H A;  3P6D A;  4L1N A;  2R73 A;  2HKD A;  3BLG A;  3HPE A;  2BHV A;  2G8C O;  5HWZ A;  2F73 A;  3ZUI A;  3BU9 A;  2LBV A;  1JJU A;  1SMP I;  2OY7 A;  2BT9 A;  4Y0P A;  3FID A;  3RY2 A;  1STR B;  1IIU A;  5CSE A;  4TKJ A;  1P6P A;  4NYR A;  3WZP A;  1HMR A;  3EBK A;  3S5V A;  4NP1 A;  4IAW A;  2GTL N;  4BX7 B;  4EEJ A;  3HK1 A;  1HBQ A;  2KD2 A;  3CQR A;  3KFH A;  1SLF B;  5F7G A;  3RDS A;  2OZQ A;  4EDE A;  2ZAG A;  1LIE A;  3KVN A;  4HPA A;  3FIQ A;  4GRJ A;  1VWI B;  3NX1 A;  5LJD A;  1K24 A;  1NP1 A;  3S60 A;  3HWG A;  4BVM A;  5HCC C;  3T6F A;  4QYP A;  1VYG A;  3ZQ3 A;  2C1S A;  3PP6 A;  4FBV A;  4HPB A;  4O4X A;  3Q34 A;  1L6M A;  2BC3 A;  4HPC A;  1LPJ A;  2BSZ A;  3LHN A;  2LB6 A;  5HA1 A;  4ZH9 A;  4GGZ A;  4ZFX A;  2JMB A;  2MJI A;  4EKV A;  1R0U A;  4ID2 A;  1ALB A;  2MO5 A;  2DM5 A;  2OF8 A;  3ZWE A;  1WBI A;  3P24 A;  1BRP A;  1DZM A;  3ELX A;  2X34 A;  1D2U A;  4WFV A;  4NYQ A;  1N9M A;  1B8E A;  2OF9 A;  3NQK A;  4GZV A;  4I9S A;  5KIC A;  1EPB A;  2FS7 A;  2OVS A;  1O1U A;  1S2P A;  2RTE B;  3SOT A;  2EU7 X;  1SWG A;  3TGC A;  4XMF A;  1IFC A;  3L4R A;  4XMD A;  1TVQ A;  1YIV A;  4U3Q A;  2R74 A;  1EI5 A;  2JU7 A;  4AZR A;  3VG3 A;  3FEP A;  4YMY A;  1HMS A;  2LKK A;  5LKE A;  5EDC A;  2LBA A;  1ICM A;  3WJE A;  1ZNE A;  1T0V A;  5F1E A;  1SWU A;  4UU3 A;  1JV4 A;  2C4I A;  1KOI A;  3HOL A;  1RXH A;  3K3L A;  4QNI A;  1LDQ A;  4ORS A;  5B3M O;  5IRA A;  5L8I A;  3VGW A;  1I05 A;  1FEN A;  4YKM A;  1UYO X;  4I95 A;  1FJ1 E;  4NLI A;  4OKA A;  3PDF A;  1HXL A;  1QY2 A;  5KID A;  1SRG A;  4B55 A;  3S5X A;  2KTD A;  3ELZ A;  3KFG A;  1KT5 A;  3STK A;  1KL4 A;  4NLJ A;  4ZHD A;  1KL5 A;  4XME A;  4BX5 B;  1NGL A;  3B2H A;  5BYP A;  1LNM A;  5EDB A;  2RTG B;  1MUP A;  1URE A;  4PSQ A;  3EC5 A;  4Z6J A;  1YP6 A;  1VWH B;  2LFO A;  1JYD A;  3VG7 A;  2RTR B;  2RA6 A;  3FEL A;  1YWB A;  3ZW0 B;  2VDF A;  4JGL A;  5F6B A;  3VG6 A;  1HBP A;  3F6Z B;  4ZGF A;  2A2U A;  4MIR A;  5D8J A;  1QFT A;  1SWJ A;  4GDZ A;  4CK4 A;  3WZQ A;  1EII A;  3NBX X;  1KZX A;  1AVE A;  3B2I A;  2QO6 A;  1LIC A;  2YG2 A;  4MIS A;  3OJY C;  1OBQ A;  3UEU A;  1VWE B;  1N4J A;  2JW1 A;  4WBK A;  4IBA A;  1KQW A;  5B2A O;  5HCE C;  2AT8 X;  2Q4N A;  3C76 X;  1ADL A;  1E2T A;  1SWH A;  2X45 A;  4DQ4 A;  2RTA A;  4CPF A;  1RXJ A;  1AVG I;  5L8N A;  1GM6 A;  1FEM A;  2WSJ A;  1NDJ A;  3PK2 A;  1KQX A;  3SLT A;  4YH0 A;  4CPH B;  1BSY A;  1ERX A;  3EW2 A;  1STS B;  4FBO A;  4I60 A;  4O4S A;  1HY2 A;  2JOZ A;  4GJV A;  4BX5 A;  1GX3 A;  3RSW A;  4O3Y A;  2JU8 A;  2W2F A;  3T2W A;  4AZP A;  3IA8 A;  5IRW A;  2NND A;  4OS3 A;  5LKF A;  4QQ1 A;  5HZ5 A;  3WBG A;  2JN3 A;  1E06 A;  3AUM O;  3ZW0 A;  2Y32 A;  3SAO A;  3LV4 A;  3UEW A;  3ZZV A;  2IZL B;  4AZN A;  2E4J A;  1VWF B;  3JS1 A;  4MVI A;  5AJB A;  5FQ7 E;  1N43 A;  4Z2P A;  2MM3 A;  1IKJ A;  1MEP A;  1NBX A;  1FDQ A;  3U9P C;  4IB9 A;  2QO4 A;  1DF8 A;  3BSZ E;  3RE6 A;  1SWC A;  2WWP A;  1DZJ A;  3CKG A;  1HXZ A;  4KII A;  3TZS A;  3NX2 A;  1Y9L A;  2KT4 B;  2WEX A;  4GNW A;  5HTE A;  4JNJ A;  3HWE A;  3I17 A;  3WJF A;  2WQ9 A;  4TKB A;  3EMM A;  2IZK A;  2X55 A;  1U0X A;  4CPH A;  4O3W A;  1BWY A;  2RTP B;  1N9Y A;  1IFB A;  4QZU A;  1JBH A;  4FBR A;  1KXO A;  1S7D A;  1EPA A;  1VWN B;  4OS8 A;  1CRB A;  2HNX A;  5LJC A;  1GGL A;  3WXQ A;  1X89 A;  4EXZ A;  2OVE A;  2QM9 A;  3APV A;  4IMN A;  3NQ9 A;  1JYJ A;  2OFM X;  1MX8 A;  4ON1 A;  3WJG A;  3WYQ A;  1RSU B;  2QCB A;  3B2J A;  3GAQ A;  3HWD A;  3OE3 A;  1SA8 A;  1GT5 A;  1SY1 A;  2Z4I A;  5FQ8 E;  3DTQ A;  3O19 A;  3B2K A;  5D48 A;  1VWJ B;  5HA0 A;  2X46 A;  1E00 A;  2L9C A;  1I06 A;  2FRS A;  5AEO A;  4IAX A;  3WJC A;  1MK5 A;  2L5P A;  2Q2M A;  2QMI A;  2UZ2 A;  1YP7 A;  4I6S A;  1HQQ A;  4YFQ A;  5K68 A;  1JJX A;  1FE3 A;  4QYN A;  3WOV A;  2HZR A;  3WZO A;  3KZA A;  3VU1 A;  3NP1 A;  2CBR A;  1SRF A;  2OY8 A;  2BS6 A;  5F58 A;  1SXX A;  5HTD A;  5K67 A;  3F8A A;  1BLR A;  4L3R A;  1SRJ A;  1SWN A;  4TNN A;  4Y0Q A;  4YBU A;  5H9N A;  3MBT A;  3OBL A;  5BVQ A;  2GTL M;  2IFB A;  1IKE A;  3EW1 A;  3MG5 A;  1YWC A;  2LA7 A;  3PED A;  4BQU A;  2GC9 A;  2W2B A;  2WUT A;  3FA7 A;  4I3C A;  4NW4 A;  1Z24 A;  2K23 A;  2RD7 C;  3T6L A;  4ZR2 A;  2IZB A;  2XKL A;  1B0O A;  2A3F X;  4CV7 A;  3EYC A;  3X00 A;  1N0S A;  1NQM A;  1OPA A;  1GX8 A;  1SWE A;  1ZNG A;  2ACO A;  2JGS A;  3LTW A;  4GK9 A;  4K19 A;  1OPB A;  1QFV A;  2AKQ A;  3V8U A;  1GKA B;  2CBS A;  1ZRY A;  3HOE A;  3ZW2 A;  3FA9 A;  1JMZ A;  4QGV A;  2RTH B;  1YWA A;  1LCZ A;  2AF5 A;  2RTJ A;  3CWK A;  4ORY A;  1PEE A;  3BRN A;  1BEB A;  4BX7 A;  4I9R A;  1JMX A;  2CZU A;  2OFB A;  2Y3E A;  1K3B A;  1U18 A;  3H3I A;  5EED A;  3RDU A;  1SRI A;  3AKN A;  3MX7 A;  3TF6 A;  1X71 A;  1HMT A;  4IAB A;  4RUU A;  4ODD A;  1RBP A;  4YFR A;  1KT6 A;  4OMW A;  2ALL X;  2HLV A;  2RTF B;  4GH7 A;  4KT5 A;  1BBP A;  4Y5D A;  2RTD B;  1RLB E;  2A5B A;  2FLJ A;  2RTM A;  3FW4 A;  4PJ2 A;  4YGG A;  1Y52 X;  3RZY A;  3WZN A;  1JQP A;  2FHL A;  2RTL A;  3E3C A;  3N91 A;  1XKI A;  4O9S A;  5F2B A;  2NP1 A;  2HZQ A;  5BVT A;  3RE5 A;  5B27 A;  4BX6 B;  1G85 A;  3QKG A;  4C5P A;  5HCD C;  1DF3 A;  1VYF A;  4N7C A;  2HYS A;  1EUO A;  3F9D A;  4U8U O;  3SZI A;  2YMS A;  4Z2O A;  1Y55 X;  2O62 A;  4YFP A;  5BVS A;  5IO7 A;  5KHP A;  4IRW A;  2A2G A;  2OFR X;  1GKA A;  3MM0 A;  2OY5 O;  1OEE A;  1SWT A;  1SWK A;  1X8U A;  2AT5 X;  4LQZ A;  5B10 O;  2ZSC A;  2RCQ A;  3BDR A;  1CBS A;  1UYN X;  4WFU A;  4BGF A;  3IFB A;  1MX7 A;  3NR3 A;  1N7Y A;  3C78 X;  4JHQ A;  4QZT A;  4Y0R A;  4BOE A;  4ZHF A;  5HZ9 A;  2FHN X;  2N93 A;  3WJB A;  3ZW1 B;  5HAE A;  3UEX A;  5H8T A;  4CDE A;  2QOS C;  4AW8 A;  3HWF A;  1YUP A;  4ZHG A;  3WJD A;  3EM0 A;  4CDD A;  4YDA A;  1SWA A;  1W5R A;  5F6Z A;  1DV9 A;  2DJG A;  3BU1 A;  5K06 A;  2KTS A;  5L8O A;  1S44 A;  4O3Z A;  5DG4 A;  3FDC A;  1DC9 A;  2FTB A;  3PEC A;  2CM9 A;  4YCE A;  4ZGU A;  1YWD A;  1MOY A;  1QY1 A;  1WUB A;  2FR3 A;  3VPJ E;  3SLO A;  2AH7 X;  1SXU A;  4OMX A;  2FKG A;  3KFI A;  3P6G A;  3PH6 A;  1OEJ A;  1XCA A;  4U9C A;  2L68 A;  4O4U A;  3BX8 A;  1BSQ A;  5H9L A;  5IRU A;  4OEM A;  3RDO A;  1VWO B; 
#chains in the Genus database with same CATH homology
 3FYF A;  4M7M A;  5FAZ A;  2JU3 A;  5D45 A;  1BSO A;  4HPD A;  4GU8 A;  1QWD A;  5DPQ A;  3EBW A;  4O49 A;  1B4M A;  1EQD A;  1JZU A;  2PY1 A;  1LFO A;  1QG5 A;  3KQ0 A;  4O3X B;  2MHD A;  4YDB A;  4YGH A;  1G7N A;  1HN2 A;  2NNQ A;  1CBR A;  1A2D A;  3ZW1 A;  2FS6 A;  3BS2 A;  3CR6 A;  5D47 A;  5FEN A;  4GKC A;  3APX A;  4IMO A;  3VE1 A;  1TXL A;  1TOW A;  2RQ0 A;  1LKE A;  2X8F A;  4ZCB A;  4A60 A;  5B29 A;  1BM5 A;  1DZK A;  1ZNL A;  2ACP X;  2QO5 A;  2X8S A;  4ARH A;  3FA8 A;  5EPQ A;  4RUN A;  1TW4 A;  4M6S A;  1FTP A;  3Q6L A;  4A1H A;  2AT3 X;  4AZM A;  1ERB A;  4GE1 A;  1ZNH A;  4GET A;  2XST A;  3P02 A;  3DSZ A;  2F09 A;  4WHI A;  2L67 A;  1G74 A;  2HMB A;  2ZAI A;  5IO6 A;  1IW2 A;  3PQU A;  4IB8 A;  4EQA C;  3P6H A;  1SY0 A;  3G7X A;  3P6F A;  3D96 A;  1JIW I;  4TLJ A;  2ASN X;  1EXS A;  3C77 X;  3P6E A;  4ZHH A;  3U03 A;  3CBS A;  1CBQ A;  2BLG A;  3CQN A;  3NQ3 A;  1LF7 A;  4TQ2 A;  1EW3 A;  3UEV A;  2W2A A;  1B56 A;  1X8P A;  1A57 A;  4KH8 A;  3PPT A;  5LJE A;  2G79 A;  1BRQ A;  3RBY A;  1KZW A;  4INN A;  4A8Z A;  4TJZ A;  2MWH A;  1D3S A;  2Q9S A;  1JJJ A;  3APU A;  1GT1 A;  1KT3 A;  2WQA E;  1PMP A;  5JR8 A;  1X8Q A;  1MVG A;  4MVL A;  1PM1 X;  1SXW A;  4A1Y A;  1A3Y A;  4NNS A;  3HTY A;  1QAB E;  2R56 A;  3VE2 A;  2M4L A;  2FT9 A;  2G7B A;  3AKM A;  1KT7 A;  1I04 A;  1E5P A;  4TKH A;  2BS5 A;  4NNT A;  3T1D A;  2G78 A;  5FQ6 E;  3WVM A;  1T8V A;  5HZ6 A;  1ZNK A;  1LIB A;  4HWM A;  3I0A A;  4FGI B;  1OBP A;  4ZHC A;  4AZO A;  4YBP A;  5CE4 A;  2POA A;  1CJ5 A;  1UZ2 X;  1ZND A;  2RCT A;  3OD9 A;  4FQB B;  3O22 A;  3FEK A;  4GNY A;  2OVD A;  3FR5 A;  3FA6 A;  4COT A;  4IB7 A;  4ORR A;  1SY3 A;  1GT3 A;  3RKG A;  5HZQ A;  3B2L A;  1O8V A;  3PH5 A;  4EFG A;  1QY0 A;  2A13 A;  5C0N A;  4O4O A;  1ML7 A;  4ES7 A;  1DZP A;  2AL0 X;  3CBC A;  5LJH A;  3D95 A;  1I4U A;  5AQ6 A;  3JSQ A;  4XMH A;  4D6A A;  1NP4 A;  2FWV A;  1GXA A;  1O1V A;  3FR4 A;  4QGX A;  4ALO A;  2P8G A;  4QGW A;  3NAD A;  1ICN A;  4XMC A;  4KCA A;  1GT4 A;  3D4R A;  5EZ2 A;  4D6B A;  5D4A A;  4KC8 A;  4DQ3 A;  5FFH A;  5LJK A;  3FEN A;  2AT6 X;  1X8N A;  3KFF A;  4QAE A;  4OS0 A;  1DFV A;  3FLL A;  1EIO A;  3D97 A;  1FEL A;  5AJC A;  4Y0S A;  1HQP A;  3JQO A;  3BY0 A;  3CMP A;  1G5W A;  1TOU A;  4HFO A;  3P6C A;  2Q2P A;  5LJB A;  3FR2 A;  4ORU A;  4CSB A;  3VG2 A;  1PBO A;  1LID A;  2GTL O;  1KGL A;  3MVF A;  1H91 A;  1BJ7 A;  5HBS A;  1SY2 A;  4UU2 A;  3ZUO A;  4R0B A;  1AQB A;  3STN A;  2KW1 A;  3U0D A;  5CYB A;  3VG5 A;  2GTF X;  5H9K A;  3APW A;  3S26 A;  3FMZ A;  4I3D A;  2OVA A;  4KC7 A;  2A0A A;  2GJ5 A;  3TGB A;  3FW5 A;  1OBU A;  4MVK A;  5LJG A;  4XMG A;  1EAL A;  4N7D A;  2CZT A;  2K62 A;  4YCH A;  2WR6 A;  2WEW A;  1SXY A;  3PQS A;  1AEL A;  4LKT A;  2Q39 A;  4U8U N;  5HZ8 A;  5IO5 A;  4QRL A;  4IB6 A;  4YGZ A;  3O2Y A;  1U17 A;  4ZH6 A;  2CM4 A;  2NNE A;  3ZI8 A;  4I3B A;  1X8O A;  1VPR A;  1OEK A;  3GE2 A;  4ORW A;  5H9A A;  4ORX A;  4YKO A;  2AMM X;  1MDC A;  3BX7 A;  1ACD A;  2ANS A;  4LKP A;  3RWX A;  4LZV A;  1CBI A;  4U8U M;  5EEE A;  2FR2 A;  3VG4 A;  1Y9T A;  4ZJ0 A;  4ALB A;  2X8T A;  3TGA A;  3NPO A;  1GX9 A;  4ML7 B;  2AT0 X;  3UAQ A;  4LZU A;  1T68 X;  4MVE A;  4AZQ A;  1A18 A;  3STM X;  4AYH A;  1LIF A;  2RN4 A;  1E02 A;  1KT4 A;  1QQS A;  1AB0 A;  2Z4H A;  3P6D A;  4L1N A;  2R73 A;  3BLG A;  5HWZ A;  2BHV A;  2F73 A;  3ZUI A;  3BU9 A;  2LBV A;  1SMP I;  2BT9 A;  4Y0P A;  1IIU A;  4TKJ A;  1P6P A;  4NYR A;  1HMR A;  3EBK A;  3S5V A;  4NP1 A;  4IAW A;  2GTL N;  4EEJ A;  3HK1 A;  1HBQ A;  2KD2 A;  3CQR A;  3KFH A;  5F7G A;  2OZQ A;  4EDE A;  2ZAG A;  1LIE A;  4HPA A;  3FIQ A;  4GRJ A;  5LJD A;  3NX1 A;  1NP1 A;  3S60 A;  3HWG A;  4BVM A;  5HCC C;  4QYP A;  1VYG A;  3PP6 A;  4FBV A;  4HPB A;  4O4X A;  1L6M A;  4HPC A;  1LPJ A;  3LHN A;  2LB6 A;  5HA1 A;  4ZH9 A;  2JMB A;  2MJI A;  1R0U A;  4ID2 A;  1ALB A;  2MO5 A;  2DM5 A;  3ZWE A;  3P24 A;  1BRP A;  1DZM A;  3ELX A;  1D2U A;  4WFV A;  4NYQ A;  3NQK A;  1B8E A;  4GZV A;  4I9S A;  5KIC A;  1EPB A;  2FS7 A;  2OVS A;  1O1U A;  1S2P A;  3SOT A;  2EU7 X;  3TGC A;  4XMF A;  1IFC A;  3L4R A;  4XMD A;  1TVQ A;  1YIV A;  4U3Q A;  2R74 A;  1EI5 A;  2JU7 A;  4AZR A;  3VG3 A;  3FEP A;  4YMY A;  1HMS A;  2LKK A;  5LKE A;  5EDC A;  2LBA A;  1ICM A;  3WJE A;  1ZNE A;  1T0V A;  5F1E A;  4UU3 A;  1JV4 A;  1KOI A;  3HOL A;  3K3L A;  4QNI A;  4ORS A;  5L8I A;  1I05 A;  1FEN A;  4YKM A;  4I95 A;  4NLI A;  1QY2 A;  5KID A;  3S5X A;  2KTD A;  3ELZ A;  3KFG A;  1KT5 A;  3STK A;  4ZHD A;  4NLJ A;  4XME A;  1NGL A;  3B2H A;  5BYP A;  1LNM A;  5EDB A;  1MUP A;  1URE A;  4PSQ A;  1YP6 A;  2LFO A;  1JYD A;  3VG7 A;  3ZW0 B;  2RA6 A;  3FEL A;  1YWB A;  4JGL A;  5F6B A;  3VG6 A;  1HBP A;  3F6Z B;  4ZGF A;  2A2U A;  4MIR A;  5D8J A;  1QFT A;  4GDZ A;  4CK4 A;  1EII A;  1KZX A;  3NBX X;  3B2I A;  2QO6 A;  1LIC A;  2YG2 A;  4MIS A;  3OJY C;  1OBQ A;  3UEU A;  2JW1 A;  4WBK A;  4IBA A;  1KQW A;  5HCE C;  2AT8 X;  2Q4N A;  3C76 X;  1ADL A;  2X45 A;  4DQ4 A;  5L8N A;  1AVG I;  1GM6 A;  1FEM A;  2WSJ A;  1KQX A;  4YH0 A;  1BSY A;  1ERX A;  4FBO A;  4O4S A;  2JOZ A;  3RSW A;  4O3Y A;  2JU8 A;  2W2F A;  4AZP A;  3IA8 A;  2NND A;  4OS3 A;  5LKF A;  4QQ1 A;  5HZ5 A;  3WBG A;  2JN3 A;  1E06 A;  3ZW0 A;  3SAO A;  3UEW A;  3LV4 A;  3ZZV A;  4AZN A;  2E4J A;  3JS1 A;  4MVI A;  5AJB A;  5FQ7 E;  2MM3 A;  1IKJ A;  3U9P C;  1FDQ A;  4IB9 A;  2QO4 A;  3BSZ E;  2WWP A;  1DZJ A;  4KII A;  3TZS A;  3NX2 A;  1Y9L A;  2KT4 B;  2WEX A;  4GNW A;  5HTE A;  3HWE A;  3I17 A;  3WJF A;  2WQ9 A;  4TKB A;  3EMM A;  1U0X A;  4O3W A;  1BWY A;  1IFB A;  4QZU A;  1JBH A;  4FBR A;  1KXO A;  1S7D A;  1EPA A;  4OS8 A;  1CRB A;  2HNX A;  5LJC A;  1GGL A;  3WXQ A;  1X89 A;  4EXZ A;  2OVE A;  2QM9 A;  3APV A;  4IMN A;  3NQ9 A;  1JYJ A;  2OFM X;  1MX8 A;  4ON1 A;  3WJG A;  3B2J A;  3GAQ A;  3HWD A;  3OE3 A;  1SA8 A;  1GT5 A;  1SY1 A;  2Z4I A;  5FQ8 E;  3DTQ A;  3O19 A;  3B2K A;  5D48 A;  5HA0 A;  2X46 A;  1E00 A;  2L9C A;  1I06 A;  2FRS A;  5AEO A;  4IAX A;  3WJC A;  2L5P A;  2Q2M A;  2QMI A;  4YFQ A;  1YP7 A;  4I6S A;  1JJX A;  1FE3 A;  4QYN A;  3WOV A;  2HZR A;  3KZA A;  3VU1 A;  3NP1 A;  2CBR A;  2BS6 A;  5F58 A;  1SXX A;  5HTD A;  3F8A A;  1BLR A;  4L3R A;  4TNN A;  4Y0Q A;  4YBU A;  5H9N A;  3MBT A;  3OBL A;  5BVQ A;  2GTL M;  2IFB A;  1IKE A;  1YWC A;  2LA7 A;  3PED A;  4BQU A;  2GC9 A;  2W2B A;  2WUT A;  3FA7 A;  4I3C A;  4NW4 A;  1Z24 A;  2K23 A;  2RD7 C;  4ZR2 A;  2XKL A;  1B0O A;  2A3F X;  4CV7 A;  3EYC A;  1N0S A;  1OPA A;  1GX8 A;  1ZNG A;  2ACO A;  4GK9 A;  4K19 A;  1OPB A;  1QFV A;  2AKQ A;  3V8U A;  1GKA B;  2CBS A;  1ZRY A;  3HOE A;  3ZW2 A;  3FA9 A;  4QGV A;  1YWA A;  3CWK A;  4ORY A;  1PEE A;  3BRN A;  1BEB A;  4I9R A;  3H3I A;  2CZU A;  1U18 A;  5EED A;  3MX7 A;  3AKN A;  3TF6 A;  1X71 A;  1HMT A;  4IAB A;  4RUU A;  4ODD A;  1RBP A;  4YFR A;  1KT6 A;  4OMW A;  2ALL X;  2HLV A;  4GH7 A;  3ZQ3 A;  4KT5 A;  1BBP A;  1RLB E;  2FLJ A;  3FW4 A;  4PJ2 A;  4YGG A;  3RZY A;  3E3C A;  3N91 A;  1XKI A;  4O9S A;  2NP1 A;  2HZQ A;  5BVT A;  5B27 A;  1G85 A;  3QKG A;  5HCD C;  1DF3 A;  1VYF A;  4N7C A;  2HYS A;  1EUO A;  3F9D A;  4U8U O;  2YMS A;  2O62 A;  4YFP A;  5BVS A;  5IO7 A;  5KHP A;  2A2G A;  2OFR X;  1GKA A;  1OEE A;  1X8U A;  2AT5 X;  4LQZ A;  2RCQ A;  3BDR A;  1CBS A;  4WFU A;  4ZFX A;  3IFB A;  1MX7 A;  3NR3 A;  4QZT A;  3C78 X;  4Y0R A;  4ZHF A;  4BOE A;  5HZ9 A;  3WJB A;  2N93 A;  3ZW1 B;  5HAE A;  3UEX A;  5H8T A;  2QOS C;  4AW8 A;  3HWF A;  1YUP A;  4ZHG A;  3WJD A;  3EM0 A;  4YDA A;  5F6Z A;  1DV9 A;  3BU1 A;  5K06 A;  2KTS A;  5L8O A;  1S44 A;  4O3Z A;  5DG4 A;  1DC9 A;  2FTB A;  3PEC A;  2CM9 A;  4YCE A;  4ZGU A;  1YWD A;  1QY1 A;  3VPJ E;  2FR3 A;  2AH7 X;  1SXU A;  4OMX A;  3KFI A;  3P6G A;  3PH6 A;  1OEJ A;  1XCA A;  4U9C A;  2L68 A;  4O4U A;  3BX8 A;  1BSQ A;  5H9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...