2A14A

Crystal structure of human indolethylamine n-methyltransferase with sah
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
257
structure length
257
Chain Sequence
FTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKGEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human Indolethylamine N-methyltransferase in complex with SAH.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords indolethylamine N-methyltransferase
total genus 98
structure length 257
sequence length 257
ec nomenclature ec 2.1.1.49: Amine N-methyltransferase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2a14A00
3MGGA 1R6AA 4BP3A 4YV1A 3NMUF 2H1RA 3ELWA 2C7PA 4FR0A 4OQDA 5T64A 5FUBA 1YF3A 5K01A 2AOUB 3ELYA 4PCAA 3D2LA 1UWVA 2K4MA 5K0BA 5KYGA 2BR4A 3MCZA 5C1IA 4PYNA 3P8ZA 1RI3A 3PX3A 5K0LA 4RTMA 3FPHA 2IIPA 3R6TA 3GU3A 1FP2A 4IV8A 5DXAA 2C7QA 3LCCA 3G88A 3HCFA 2PWPA 2G72A 3G5TA 1SQFA 1ORIA 3C0KA 2GPYA 2XVAA 3BXOA 4YUXA 3TFWA 5BW5A 3A27A 3P9NA 2PY6A 3FYCA 3LL7A 4DF3A 3EVAA 4FS8A 4A6DA 2Q41A 5HIKA 3CJRA 3HCCA 5DM0A 2P40A 5FA5A 4EQZA 2ZIFA 1NW5A 5KS2A 3VC1A 1P39A 3OE5A 2B25A 2G70A 2YQZA 1NW3A 3OZRA 4E30A 5IKMA 1YFJA 2AN3A 5B1SA 4EVIA 1BHJA 2Y1XA 3AXSA 3V97A 3A7EA 3PS9A 1VIDA 2FHPA 4RYLA 4XCXA 3Q87B 4P7FA 4DA4A 4RTQA 3SGLA 5JR3A 2B2CA 5BXYA 3HM2A 5EVJA 3MTEA 2XBMA 3NW9A 2BZGA 3ERCA 2HWKA 2UYOA 8MHTA 3GIWA 4IKPA 2V74B 4M38A 3FUVA 5GM2A 3RW9A 3UJAA 2HR1A 4PYJA 3LX6A 2IDKA 3KQYA 3FTCA 3ID6C 4CXMA 2BM9A 4DZRA 1ORHA 5EMKA 3LBFA 5DTMA 5T67A 1RJDA 4EK9A 2FK7A 1R00A 2P3QA 5DSTA 2N47A 3E05A 3GDHA 2QRVA 3PT9A 4ATNA 5ICEA 2WA1A 3TPZA 5K09A 3B3FA 4IWNA 3LECA 1AV6A 5EOVA 2BR3A 4CKBA 3GRZA 5KQSA 2AOUA 3H2BA 2GB4A 4AZTA 2OBFA 3GRUA 2FYTA 2CMHA 2ORED 3B5IA 1AQJA 4CKEA 3E7PA 4BY9E 3GGDA 3LGAA 4GEKA 4Z2YA 1O9GA 4RTLA 1KXZA 4PONA 4P7GA 3EMDA 4HGYA 5EQJB 3EVZA 4YUWA 3DMGA 2CWWA 4RTRA 3FUWA 4BLUA 1L3IA 3X0DA 5FWDA 3THSA 4F86A 3KU1A 2ESRA 3AWIA 3FPFA 3ELDA 1ZG3A 1JQ3A 4RX1A 3B3GA 1ZGAA 2VDWA 2P3LA 1KP9A 2OZVA 2QYOA 3R0QA 2VP3A 5HEKA 1NW8A 2QY6A 4QDKA 4E2YA 1TW2A 5F2OA 2O57A 4IV0A 4AZVA 5FQNA 3MTIA 5E1DA 3CCFA 5E8JA 1QZZA 3KQOA 3TLJA 4B17A 3REOA 5EKXA 5LSAA 5FHQA 2A14A 3SVZA 4BLVA 4ER7A 4R8SA 1JQDA 1MHTA 3HP7A 2P7HA 1H1DA 1R74A 4RTKA 3HVKA 4WVLA 3A7DA 3PVCA 4PIPA 2OXTA 1XDSA 1RJGA 2JHAA 3KKZA 3P9CA 3TOSA 3MHTA 2O0LA 4POOA 2B9EA 3L8DA 2JH8A 2PXXA 1F38A 1JQEA 2IPXA 5BW4A 4PGHA 1RI4A 3P9KA 5EIFA 2R3SA 9MHTA 4QDJA 3DLCA 3UJCA 1FPQA 4CWAA 4YUZA 2QRVB 4DCMA 4FZVA 3UZUA 2E5WA 3EVCA 3UJDA 4HH4A 3PTAA 1YFLA 3SMQA 2IP2A 2CKDA 2FCAA 4GC9A 2IBSA 3M6UA 5DRTA 2UYQA 1UFKA 3M6VA 3PB3A 4LG1A 2I7CA 4MTLA 3DXYA 4R05A 3NDIA 1DCTA 3BGIA 2ZCJA 1Q0SA 1VLMA 3BGVA 2IBTA 5BP7A 3PLAE 1IXKA 2PX2A 2V7EA 4OBXA 4AZWA 3UJ8A 2YXDA 1KPHA 2FPOA 2JJQA 2YXEA 1XTPA 4QTTB 3LHDA 1R8XA 1X19A 3LSTA 5ICFA 1L1EA 1JSXA 3EEYA 5P8WA 2VZ9A 2PX5A 3AY0A 2QE6A 3IHTA 3ER8A 4YV2A 1HMYA 3OU7A 5CVEA 5FTWA 4LWOA 4RVDA 2BM8A 4MWZA 4NECA 5EMJA 3PFHA 2XVMA 2YUIA 3I5UA 5LQKA 4KIGA 2ZWAA 4X41A 4GOOD 2B78A 3KQPA 1L9KA 5FHRA 2WK1A 4GF5A 3G89A 1QAMA 1SUIA 2ZZNA 1UIRA 4HRAA 3OCJA 5EIWA 4R8RA 1N2XA 4MQ4A 4KW7A 1M6YA 4RVGA 1RJEA 3BKXA 5LQRA 3G2PA 2UZ4A 3LBYA 3WSTA 1NW7A 4HTFA 3LKDA 4GUAA 2NXCA 3OZTA 3MCTA 2IFTA 3C6MA 3R24A 2AOWA 3OU2A 4DQ0A 5U4XA 2ZFUA 5FULA 5LQAA 1ZHFA 2ZWVA 5MHTA 1G55A 4E70A 3TKYA 4C05A 2G71A 1EQAA 4KWCA 2IH5A 1KYZA 1VP3A 3BWBA 3DMFA 3FUUA 2ZVJA 2NXEA 2XYQA 4RTNA 5GM1A 3TM5A 4HG2A 2OB1A 2Z6QA 1QYRA 1R8YA 2IGTA 4CKCA 3ME5A 3TKAA 3O7WA 5EGSA 3MB5A 1KHHA 4DKJA 2PX4A 1D2CA 1WY7A 3HCAA 3GWZA 3K0BA 5F2KA 4YMHA 4P58A 3NDJA 5C0OE 3S68A 2VDUE 3EVEA 2PGXA 1XVAA 3DP7A 2O07A 4ISCA 4OA5A 1KR5A 1I1NA 3NVKI 3R9XB 2BH2A 3K6RA 2ADMA 5CD1A 5CIYA 1F3LA 4RSRA 4F85A 1JSZA 3KQMA 2YVLA 5CVVA 1AF7A 1NW6A 3VYWA 2QM3A 2WA2A 4YUYA 1BOOA 5DXJA 4FGZA 3HEMA 4F84A 1TW3A 1XJ5A 2EX4A 4FSDA 4OQEA 4LWPA 1FP1D 5K0CA 3BWMA 2GH1A 4FP9A 2HTEA 3I64A 1VQ1A 1VPTA 3HCBA 3FPEA 3LCUA 3DUWA 4H0NA 4PWYA 3G7UA 5DSXA 5HIMA 3R3HA 2AOTB 2O06A 3CJQA 5HFJA 2DPMA 3MAGA 3SM3A 1X1AA 1TPYA 3UJBA 5DT2A 1P91A 3IYLW 1EAMA 3M6WA 4V0QA 4E2ZA 5FCDA 3JWGA 3UA4A 2FRXA 2JH9A 3GJYA 3U81A 3E8SA 2H11A 1G8AA 3FPJA 2HMYB 3P2IA 3G5LA 5D1NA 1L3BA 1OR8A 5FADA 5K0EA 2PT6A 2ERCA 3SXJA 3HA7A 3KR0A 1VBFA 2JHCA 1ZKDA 5E1OA 2JG3A 4WXHA 4GQBA 3OFKA 4ZTBA 4QPPA 5K03A 4DCGA 2OPBA 1L3CA 5G02A 4YUVA 5JUWA 4E33A 3KQTA 3UA3A 4QTUB 4E31A 4G56A 1IY9A 3KPWA 2I6GA 5M5BA 4RTPA 2NXJA 5FA8A 2Y1WA 2C7RA 2IH4A 1VE3A 2AOTA 3SSMA 2IDJA 3UJ6A 3A26A 4R6WA 5E2AA 4OBWA 3UBTA 3A25A 3FYDA 4PNEA 3HVHA 4EKIA 4HGZA 1RI5A 1YUBA 3O4FA 3SSNA 3FTEA 4C08A 1X1DA 5ICCA 3JWHA 2PX8A 5LQUA 1D2GA 3FRHA 5DLYA 3KR1A 3JWJA 1PJZA 2AVNA 3M70A 3GO4A 1KYWA 2GLUA 4FSXA 1PRYA 2ZBPA 3HNRA 5CM2Z 1JG2A 4KDRA 4EKGA 3QOWA 1G60A 2AR0A 2I62A 2EG5A 3VC2A 2PWYA 5E8RA 5DM2A 4ER0A 5HIIA 4O29A 4PYLA 3DXXA 3HCDA 4CTJA 3B89A 3GNLA 1T43A 4C03A 1KPGA 4KVZA 4AX8A 1RI2A 3JWIA 3PX2A 2PXAA 3BWCA 1P1CA 1YZHA 3AXTA 2ZLBA 4EMSA 3KQVA 4RTJA 2PVCA 2P1DA 2P35A 3M33A 4PYKA 2I9KA 3DR5A 3LPMA 2C7OA 3LKZA 1BKYA 2KW5A 5EEGA 3FTFA 3SSOA 3G8BA 3GRVA 3FUXA 1EG2A 4M36A 2ONZA 5E9QA 4KDCA 3TM4A 5EHGA 2HNKA 5EKUA 4MIKA 4K6MA 3LDFA 5F2NA 4Y2HA 3M6XA 4JXJA 4A6EA 1X1BA 4BLWA 2GS9A 1Q0TA 5CCBA 3SR4A 3CKKA 1VP9A 1XCJA 3Q7EA 2ZTHA 1ZGJA 5DX8A 3ELUA 3ORHA 4L7VA 5GP1A 3ER9A 3DTNA 3DMHA 2AOVA 2P8JA 3I53A 3AJDA 3QOXA 5T6BA 4YMGA 2G1PA 7MHTA 1JG1A 3EVGA 5CVDA 4HSGA 3RIEA 5K0NA 5ICGA 1MJFA 5C9ZA 2NXNA 3B7PA 3EVBA 3I9FA 1NT2A 5K8VA 2EJTA 2O05A 4OA8A 3UJ7A 2P3OA 4C04A 1M0EA 2PXCA 3CJTA 1KIAA 3NVMB 4X60A 3FTDA 5EZSA 3TRKA 1WXWA 2IH2A 3EVDA 3LDUA 2DULA 3TR6A 3CBGA 3TMAA 4HC4A 4PINA 5K0GA 5GOZA 5E9JA 4U7TB 1EIZA 3OU6A 4RTOA 1FBNA 3C3YA 1D2HA 3UJ9A 5D1HA 2CMGA 4PYIA 3G2OA 3CVOA 3PFGA 3EPPA 1NKVA 4GC5A 5DX1A 4QQKA 2NP6A 1V39A 1YB2A 3BZBA 2GA9A 3OE4A 3OPNA 1BC5A 3EGVA 3I58A 3SX0A 1O54A 3CGGA 3UFBA 2YTZA 4QQNA 3GRYA 2ZIGA 3A4TA 1R18A 5HIJA 2AVDA 5EMMA 3NTVA 4X63A 2AOXA 3FPGA 1WG8A 2OY0A 3C3PA 1ZQ9A 3DOUA 1NBHA 3EMBA 5CVJA 2UYCA 1INLA 2YX1A 1SQGA 4KRGA 4M7RA 5H02A 2PBFA 5FQOA 3UWPA 1EJ6A 1AQIA 3B3JA 4E2XA 3CC8A 4BP1A 2VDVE 1XDUA 3KHKA 1IM8A 5CVUA 4MHTA 4OX9Y 1XXLA 1P1BA 3RODA 1XCLA 3LCVB 3BT7A 5DWQA 3KQSA 4AZSA 1NBIA 4X1OA 3EGEA 3BWYA 4P7KA 5EEHA 1YZ3A 4PYMA 3DH0A 3FUTA 3KPYA 4C07A 5LQCA 2PT9A 2F8LA 4PCLA 4RTSA 5IH3A 2YXLA 1NE2A 3HA5A 3GXOA 4U7PB 2ZW9A 3HVIA 1JTFA 4C06A 1JG4A 3GRRA 1EJ0A 1X1CA 1DUSA 5DPMA 3HCEA 3KR2A 3MERA 5GINE 2JHPA 5HILA 3IEIA 4FT2A 5E1BA 5EG5A 1Y8CA 2OB2A 2BR5A 2PSSA 3FRIA 3DULA 3NWBA 4E2WA 1WZNA 3KPUA 2ZZMA 4M37A 1I4WA 4R6XA 3MQ2A 4RVHA 3P71T 4FT4A 5K0JA 5KQRA 2Z6UA 2ZULA 3T7SA 3T7TA 1G38A 1QAOA 2PLWA 3T7RA 1Z3CA 5LQNA 3E23A 2ZZKA 4RV9A 4RWZA 5KVAA 2AN4A 4X61A 4UOEA 5K0FA 4GOLD 4XUCA 5DM1A 3P97A 3G2MA 3THRA 3KPVA 3BGDA 4ER3A 3P2KA 3TQSA 2AS0A 5EHIA 4HTFB 1NV8A 1JG3A 3KR9A 3O31A 3QV2A 2Z6AA 2LD4A 1QANA 2ZBRA 3P9IA 3T0IA 3EGIA 5E2BA 5EZQA 3V8VA 3FZGA 4PIMA 4RVFA 4XUDA 3HTXA 5E1MA 5GWXA 4PGGA 4GOND 2VS1A 4Y30A 5GIOE 1NV9A 3OZSA 4AUKA 5K05A 1DL5A 4QPNA 2OYRA 2OKCA 4KIFA 2EJUA 2XYVA 1RJFA 2YR0A 5HOQA 1RI1A 3G2QA 5EPEA 2ZBQA 3P2EA 3BKWA 2PV0A 1XDZA 4V0RA 3EVFA 5GIPE 2PKWA 3BUSA 3C6KA 4CTKA 1JR4A 4PYQA 2AN5A 3HVJA 5CCXA 1G8SA 2EFJA 2R6ZA 4ER6A 5LQJA 1M6EX 2UYHA 2GAFA 1B42A 2ZSUA 4PYOA 4GBED 2NP7A 4E32A 2CL5A 4LECA 1FJXA 3OFJA 5DRYA 1WS6A 4DMGA 2ZIEA 3VSEA 4ER5A 1U2ZA 5CUQA 2NNWB 1G6Q1 1N7IA 5LR6A 5DM4A 5HZMA 3G8AA 3HA3A 1QAQA 4C4AA 3M4XA 3LDGA 4P7JA 5E9WA 2FK8A 2G8NA 2H00A 5EMLA 1KPIA 3F4KA 1SUSA 5EC8A 5ERGB 2AZTA 2B3TA 2OO3A 4DM3A 2HV9A 3KQWA 4QVKA 4XUEA 10MHA 4YV0A 3DXZA 1JTEA 4GOMD 2XYRA 3IV6A 1SKMA 3NJRA 1N7JA 1SG9A 1HNNA 3KPJA 3EEOA 5DTQA 5DX0A 3ANXA 3KQQA 1SVUA 5DTRA 5FWAA 2NYUA 1WXXA 1I9GA 2P7IA 3DLIA 1VL5A 2PJDA 2ONYA 2P41A 3GCZA 3NWEA 1O9HA 4QVGA
chains in the Genus database with same CATH superfamily
1RWOA 3C5VA 4OLHA 1RMTA 2RIPA 1NA5A 2J59A 2MT9A 4JJ7A 3I9NA 4WI1A 4WK4B 1NBMD 4PPNA 3ZH9B 4JU8A 1WX1A 5FOWA 4IHQA 4AF6A 1T1SA 4LY0A 4AMZA 3CZCA 1YRHA 1SRRA 4MWDA 4N8EA 4WN9B 2C2GA 3RAFC 3DDUA 1KOJA 1SVSA 1BXGA 3LF1A 1T9ZA 4YQFA 3F49S 5JMWA 3QVJA 3A27A 4EO4A 2FUNB 5GGXA 1CY0A 2VP0A 1UT6A 4LK3A 1BIFA 2JDIA 2CVQA 1O0CA 2Q41A 1BKSB 4BGIA 2ZR7A 4TQ9A 1RRPA 3WLFA 1UJ6A 3L4SO 3VXKA 4DR1B 2H6EA 1JB1A 3VC1A 2JVKA 3PHGA 5ALMA 3TQIA 1NW3A 4TV9B 2ZYWX 1SC6A 3VR1A 1NJFA 1CRZA 4Y0VA 2WT4A 1A9QA 1XF1A 3VPBA 2O2IA 2GFHA 3G59A 4WNCA 2AT1A 3NNDA 4L57A 2YWDA 3I2GA 2G5CA 4R2IA 2DB3A 3VYRB 3PD1A 3E22B 1LPPA 1E2JA 2CYAA 4OHBA 2TMYA 4R69A 3SJ7A 3UJAA 1SIUA 3BG5A 2HRDA 2HMUA 3RVBA 1LDBA 5DWVA 4BUJA 4RMIA 4X71A 4B40A 1XHLA 3FMOB 1PZGA 5EJAA 2KE5A 5DYIA 1N1GA 3DEIA 4HN4B 5FEMA 1U8AA 5AVOA 5JNRA 1H3EA 5AW1A 1R15A 3IAHA 4LZLA 3C87A 3GV0A 1HDZA 2GVZC 3LLVA 2I7VA 2BM1A 2NXWA 3IB3A 3NKFA 3PD0A 4BMZA 1G3MA 1Y4DE 5BR1A 3R3SA 5F4ZA 2FZWA 1VLVA 1P2DA 4H0CA 5M7EA 2J9RA 1QJ4A 2FYTA 3BRWD 2BMJA 2LCQA 4ZYUA 4HQ0A 2EBUA 1MW8X 3LGAA 3N8DA 1EUDB 1T9GR 4Z2YA 3PEUA 4F45A 1F2TA 2B1GA 3IMGA 1IULA 3EMKA 3DMGA 1C9JA 1SUBA 1JXAA 5CNJA 2HN9A 1R8JA 1HWYA 2L2QA 1KI9A 3LWBA 3W34A 1IQPA 1L1QA 3WHKA 5JMPA 3RU7A 5EL0A 2I91A 5JECA 1ZINA 1EQ2A 4DDHA 3NDRA 4KXNA 5AXBA 1ISFA 1DCMA 1JEDA 3QSYA 2OCLA 4HS9A 4KX5A 4AJOA 3T5CA 4C5CA 2IYPA 3FNRA 3VDMA 3MTIA 3LOQA 2BKXA 3AF5A 4L1KA 3THWA 5IN4A 3REOA 4AULA 4Q66C 3D6UA 3VI4B 3BCUA 3VO8A 2ZPTX 5C1DA 1JQJC 3L43A 1NW9B 4MUBA 2O48X 4G5SA 4D8YA 4HUTA 4ZP1A 2XNHA 3DJYA 4UTZA 1E1CA 1H2YA 3GN1A 3HVKA 3C3MA 2BELA 3IEPA 1NC3A 4QEKA 5CVJA 5AOCA 3WGTA 2WTXA 3ZDXB 3TE6A 1XDSA 1RJGA 3CCCA 3OZUA 4NK5A 4EEZA 1PK7A 3HDVA 1HDGO 4DSTA 3MFYA 2QNBA 2PXXA 4C7JA 1NUPA 5C46F 4UATA 3GL9A 2WF7A 1JWAB 2GI4A 4UULA 5HZKA 1FPQA 3FVRA 3RQSA 2QBYA 1QOQB 1CUAA 1RYFA 4Q3LA 2PRJA 2VTBA 5IT5A 3ZLTA 2F67A 1ZU5A 2CY0A 3UJDA 3T35A 2WYIA 1V48A 1YFLA 4PC3A 1B15A 2IP2A 2ZPAA 4URVR 3M6UA 1Q16A 4KGVA 4KFUA 1MBZA 3NHRA 5AJYA 4B7CA 4HNTA 4DV6B 2HK7A 4MTLA 2IZZA 2ZI6A 4WZBA 4DAEA 4PXYA 1A9TA 1OXSC 2H65A 3ZWKA 4FZ3A 4EA9A 4S04A 4HQOA 4RVNA 1I2BA 2QPOA 5DI3B 1MA0A 4UNQA 4G01B 4W8GA 4UTVA 1D6MA 3JVVA 2YDYA 3LLCA 3KOZA 2W90A 1YJXA 2WKPA 5BUCA 1OFUA 2NO5A 3SP1A 1ECCA 4X1IB 3LHDA 5JXHA 5DOVA 4IGKA 3AF3A 2R8BA 2ZJ4A 4RA6B 3K1AA 2PX5A 1OQAA 4JLBA 2PMEA 1GTZA 2WDZA 4G63A 3M1YA 4DW8A 3WAKA 1K9VF 3N75A 3NB0A 4MWZA 3L0DA 2V4ZA 4HWRA 2BGKA 2PD6A 3PXCX 4KIGA 1EZ1A 2AR7A 2CYCA 4X41A 2WWXA 4MCIA 3TW6A 5B57C 4N5DA 5FBQB 3BWEA 5FHRA 3IBYA 4IRUB 5B6IA 1Q2XA 3EDYA 1JDBB 3OEED 5DOZA 1A5TA 2RFLA 3MT9A 2H1CA 3CW9A 3LSYA 1LDEA 1P0QA 2ZYHA 1CV2A 3HU5A 2OXFA 1OFVA 1ZK2A 2JIPA 1TQDA 1N2EA 1V5GA 1W4CA 4J8PA 4PIVA 3PC8A 1JJIA 4HTFA 1QRDA 5DEOA 1XMXA 3ZLJA 3OESA 1HFWA 2FMFA 3NBZC 2AD5A 2C2BA 2R8OA 3LOUA 3RT1A 2A8YA 2J5RA 3AJ9A 2BSQA 2W00A 2F1IA 1P1JA 4K9QA 4HB2A 3ZGNA 1RFLA 2V7GA 3RRMA 5H4HA 2YZNA 1MAUA 1VCMA 2BONA 2DFLA 2K6GA 3CKLA 4QBTA 3L92A 5H82A 4BVGA 1PJAA 2Z6QA 4OP2A 3GFTA 1ZJ4A 2OQRA 3T54A 2DUUA 4MB2A 3TR0A 2NIPA 1A4XA 3BN3A 4M8NE 3CRMA 2DEUA 3W90A 2VR1A 2WLTA 1XROA 2PX4A 5J40A 4EP1A 1ECGA 4YXFA 1E3IA 1ZMXA 3TQFA 2Q6TA 4GVLA 1RRGA 2VDUE 4HXGA 1LPAB 1JMKC 2C4TA 4F9EA 5J4LA 3J81k 2JH3A 3W2GA 5GONF 5JNTA 1LU9A 2CHGA 1WSWA 5E3IA 3IO3A 4YJGB 1Y6GA 2ADMA 5CD1A 5CIYA 2UZIR 2H57A 2IUTA 4F85A 4Q00A 1AF7A 1V9CA 3E9ZA 4HWTA 1VE6A 1KZ1A 2JB9A 1S8FA 1XN4A 3G68A 2B5WA 1HETA 4G37A 4GGOA 4UJ3A 1JRLA 1CR1A 4DQKA 4RQAA 3T4EA 1N8KA 2GK6A 3V8MA 1SQ5A 3RFFA 1BS1A 1GA6A 1TEVA 4N6GA 721PA 4DR5B 3O1LA 4EH1A 2J87A 1CJTC 2PUGA 2YVKA 3ASYA 2JHGA 2WF6A 3F1KA 3LBHA 1RAAA 3N28A 3E70C 4HH3C 4MUNA 2X13A 4I4CA 1SIBE 3B1JA 4S1PA 1ZRHA 1Z28A 3G9XA 2WZDA 3KZ1E 3E9RA 4ND6A 3LUHA 4JLSA 3S2IA 3IIJA 4MCHA 2O2DA 2GXQA 1OWPA 1G8AA 1Q1ZA 2DTXA 3GFPA 5FADA 5DCLA 2AZ4A 5I9NA 1TX4B 4BMNA 2QIPA 3EQ7A 4ZTBA 3GJQA 1Z8DA 3A1EA 1BSVA 2H3HA 2DPYA 1GA4A 2YYZA 2VF2A 2D0IA 2ZDHA 3FVWA 5DTJA 5CYOA 1GILA 1P2SA 3L4EA 5EQDA 4QTUB 4MKXA 3LUJA 4RTPA 3ZTTA 2NXJA 2VWGA 4LCJA 3ESCA 1FFCA 4HDOB 5CDSA 3R7NA 4N3CA 2BN4A 4H7KA 1V3VA 3VHXB 1GZSA 1O97C 2JD0A 4PN7A 3P9SA 3C3WA 1ISRA 4PR0A 1YUBA 3EFEA 5CH5A 5JCOA 2IXAA 5BPFA 5JYDA 2FRVA 3FLBA 2FPLA 2C2KA 2AI1A 1QPGA 2B1IA 3IQFA 4H6VA 4JODA 4RHCA 4U0KA 1BS2A 4BE4A 5B4VA 4H35A 2EJCA 4L08A 1K2VN 1MO5A 2P6RA 3HY3A 2D54A 1I3LA 4WOKA 1QCZA 1AUVA 3NO4A 3VNBA 3HCDA 4CEJB 1KPGA 1T8WA 1VM6A 3O47A 1FDUA 3WIBA 4S05A 3LUGA 1D8TA 3HR8A 2Q6IA 3TIIA 1GZ5A 4OTZA 1USKA 2C8VA 3P45A 3P9RA 2PPVA 2P8SA 3QTTA 4WW0A 5CDTA 4DB4A 1P8JA 2FRDA 4R4JA 1V5WA 3CH6A 1NR5A 3PNQA 3X1YA 4BNZA 4CUZA 3H11B 1GKIA 3TLKA 1XTBA 3ISJA 4BO0A 4Z0HO 1DX4A 3GRVA 4ZYYA 4F93B 4M36A 2W6NA 2PKYX 2PMBA 4MI9A 4DV2B 2WHEA 4ED9A 2YJ6A 1I5EA 3EXFA 3FMVA 3M5WA 4KFCA 1F0KA 4G5XA 1W1UA 4R1SA 2O8VA 1GAEO 1E0SA 4YMIA 4PTZA 4A4DA 1MJNA 2QY9A 1XCJA 1TMYA 1ZGJA 1CJKC 3M2PA 1T5HX 4DB2A 2ODNA 3O1HB 4RXTA 2FX2A 1MABB 3ZXUB 3G1UA 3HXLA 4BE9A 5K8JB 1VLLA 3FFTA 4EJ6A 2A0XA 3DTVB 4QECA 3L8FA 1T36A 4PSAA 5EP2A 3FKSD 3RIEA 1EHIA 1PDWA 4I6JA 3EVBA 1E99A 3H6KA 1AGXA 1R6DA 4TKZA 4A8TA 3W3AD 2ZXFA 4FQ7A 1C3OB 3DVAB 3NJ4A 3H3FA 4GI3A 1KARA 3U7RA 1COWD 3RYTC 5EHZA 3DFFA 1QZXA 2BSAA 1ZHOA 1K8ZB 2J4FA 4TQGA 1E2UA 1PZHA 1T10A 4WEOA 1N34B 4XXHA 5EMHA 3WKDA 3FY4A 2XB4A 3KXPA 2C2ZA 3MRVA 4X1YA 1YONA 4F3RA 3ITEA 2BFCB 1C4XA 4J0QA 1JBQA 1SXHA 5BQ5A 1O4WA 5DM60 3F1LA 4P35A 2ZRAA 2CSXA 1PZNA 2J46A 3PJFA 2MYTA 1TMOA 2P4QA 3IR6A 2CMGA 4PYIA 3UJPA 4RL4A 5J47A 1IHDA 4GE3A 2H16A 3KWFA 4TUYA 4JEMA 4E2FA 3A1SA 2YN2A 4FWIB 3PE4A 2W93A 3EGVA 2YCBA 5I7RA 2WJ4A 3DT6A 2BEKA 3WWYA 1Q92A 5BMVA 1QTQA 5BSTA 1BDJA 4IV5A 3ZWVA 3MG9A 1NT4A 5CB8A 1ECBA 1ZCFA 2JI8A 4F7WA 4M8KA 2XGJA 1PSZA 1NBHA 3I4FA 4Y0NA 1GT6A 3V32A 3RVMA 2E6UX 5AM5A 3DAFA 3SSAA 1ZJZA 3ZCTA 2QTNA 2CVHA 2IZOA 3LAWA 1GARA 4HPJB 2HGSA 4W4TA 3CT6A 3D1JA 2H1OA 1QMGA 2J0UA 1IU9A 3CXUA 2C07A 5GJCA 2VQ6A 4PC1A 1TQ8A 2JATA 5DGTA 5DTEA 5EA2A 3KSBC 2BGWA 3OSUA 4K46A 5ESDA 1QPZA 1SHZA 4GRAA 4ZKEA 5EWJA 5TGZA 1Z2OX 5AHKA 1X13A 5FOTA 3WQHA 4CQJA 2OT3B 3TBHA 4YRQA 5KNDD 2C04A 3QF4B 4C06A 5C35A 5BN5A 1OBCA 2PSEA 4OM7A 5EKSA 4BVKA 3E7FA 3LDAA 5K45A 3L7DA 3MERA 3IEIA 2D6FA 1D5WA 3JCZA 3LQRA 2Z8YM 2FP3A 2XIQA 4ZEWA 3CF6R 3UUEA 5IXSA 2ZZNA 4TT8A 4MIEA 1QKIA 2FSSA 3C5WP 3EN0A 1XK7A 1R0CA 3FMIA 3RGWS 5KKNB 2DH5A 2BBWA 2FFHA 2EC5A 1GCIA 1R4AA 1SB8A 2GYUA 2NZJA 2VXCA 4CODB 3T7SA 1VGVA 2IHKA 1Y6JA 4LE2A 3H13A 3PE3A 4KJXA 1D7OA 3R9KA 1IHPA 3W1VA 4B84A 1H6BA 3E23A 1K8QA 4F2HA 1EG7A 4RWZA 3WIDA 2AN4A 4CE6A 4G2NA 4RANA 1VPLA 4TKUB 3GZTB 1JQBA 1T2AA 4TUYB 1JIQA 3TQSA 4MKFA 2YICA 1DBIA 1HYEA 1LV7A 4GXNA 3VPXA 4AY3A 3O73A 4NE7A 5IHPA 3RYIA 3FSGD 3ZZ0A 4ETMA 4O3MA 2QP4A 3RC9A 5KREA 4G0OA 2J9FB 4XD7D 3EGXB 3Q3HA 4YJKA 4PIMA 2WM8A 2BEWA 4FU0A 5FTJA 4KNYA 2VS1A 3MILA 1HE1C 4KMRA 3RVQA 5FWNA 5KEIA 4YJDA 1X70A 2X0KA 1P1HA 3NBKA 4MUIA 3FIUA 4D9BA 4UOQA 2PUEA 2WAMA 1VZ2A 2PV0A 1NSYA 1KH2A 2PSDA 4HEHA 1BEZA 1RWNA 1ESZA 2AIRA 5AKZA 4FW9A 3B3AA 2EYQA 1UMCA 1YS2X 3PQ8A 3DL2A 4NIMA 4XB2A 1B73A 2GKOA 2QW0X 2VN8A 4YJHA 4OHZA 3IUBA 3RDPA 2PYDA 1LBHA 4GI7A 3RE1A 2GAFA 4DHEA 1E2HA 2ZSUA 5DRYA 1WS6A 1Z45A 5IFKA 2XAAA 4H4DA 5JSKA 5K1ZA 2A6PA 4CIVA 1S6YA 2E82A 4TKLA 3RC2A 5LR6A 1UPTA 4U63A 2CXRA 5IDWA 3K9HA 1GWNA 1R6BX 2I3GA 2R5WA 1QAQA 3WLJA 3RLFA 3WGLA 1KS9A 2VZ8A 4YAKA 1GN8A 1QORA 2QL7A 1E9SA 4KO3S 4DMLA 4MWEA 3W4JA 1Z0SA 3V8NA 1KVQA 3PCXA 2ZJ3A 2JLRA 4M8IA 4DMRA 1AT1A 2X2EA 4M8LA 4EJ0A 1J0EA 2KJQA 2OHVA 3G9TA 2K7FA 1SVMA 1CDZA 4GOMD 1D0VA 3MJFA 4AWAA 1HNNA 2FSVA 3E58A 4E5KA 1Z4NA 1DAIA 1VKHA 4B31A 4DPMA 3F78A 5DTRA 4F3TA 3BFPA 3MTDA 4C2BA 2NV0A 5LJLA 5FA8A 5AJWA 1GQ2A 3TLBA 3HDTA 4DXAA 1Y9EA 2XTJA 4ZT3A 2C7PA 4C22A 3DE4X 1YF3A 5L95A 5JYBA 3F7NA 1D6JA 2I3ZA 4FFBB 1KDOA 4MQUA 1ZNZA 2EKLA 4PO3X 1RI3A 4LC0A 2OC4A 2O8EB 2J48A 4WCFB 5HTKA 4RZUA 5F2EA 4Y2PA 4AP6A 1U1DA 4DABA 3G5TA 3RUPA 1UEIA 3EFBA 1IJBA 2VXBA 4ADSG 4GMDA 4M8SA 3BXOA 4CQLB 4Q3AA 2HEIA 3FYCA 1W0KD 1WQ1R 4FS8A 4XDYA 4XGNA 4A6DA 4EJSB 1DAGA 1KYXA 1GTJ1 2XWQA 1R8SA 3BCSA 5HK9A 3VVLA 4M9RA 4JBIA 3RAGA 3OFNA 3VSBA 5ER9A 1IXRC 3NETA 1NW5A 1DAEA 4NENA 3OE5A 3U44B 4GPBA 2G70A 1NFRA 4G89A 1DDGA 1UWCA 3JQBC 1GGMA 3AETA 2EEZA 3WDSA 3CA8A 1GO2A 1P5RA 2FHPA 1NJGA 2GN2A 4G0UA 5IVIA 2PFSA 3GJSA 1AUOA 1PAUA 1X9GA 2GZRA 3VH4A 5LXTA 5JR3A 1D2RA 1DKLA 1O96A 3I2YX 3NHSA 3OC6A 1KRWA 3QVKA 2JGNA 1P5HA 3GZ4A 3S2GA 3T7JA 4XB6B 4BATA 1SKBA 4TVSA 5FUXA 5F1PA 1Z39A 4KPUA 4DCUA 2V5UA 2I65A 2IIBA 3ENKA 1XPUA 1RJDA 4B3XA 5FLEX 4EY6A 1KVUA 1G8GA 2OEPA 4HDNA 4IFIA 3GDHA 4L9RA 4UNSA 3U0VA 4AFNA 3TEFA 4CRWB 1V7PC 3HZHA 5FI1B 1QIMA 1SXGA 2C9ZA 3MLAA 4EPVA 4HGOA 5ILGA 3QMPA 1J7JA 1DRWA 4QTXA 2OFFA 5E0KB 4MRAA 4XWKA 4CKBA 2Z2JA 5IHXA 3I76A 2ZSHA 3U4QA 1KYIA 3UMJA 3L7OA 4IHAA 4OQLA 1XU4A 3O8QA 5K8CA 3GRUA 4BWFB 3BC1A 3L1KA 3EG9B 4D3DA 2B92A 1CDEA 3I6IA 1TUBA 4KIUA 4PAQA 1R9GA 4LC1A 4Y7CA 5H8WA 1JT2A 4PPGA 4HNAA 5ECDA 5G1PA 3E81A 13PKA 4UCFA 3OY7A 4ZGWA 1M1YA 2UYGA 3OE1A 3UPDA 5KO2A 1IBLB 4LXTA 1KAHA 2DPGA 4F86A 1Z25A 2AKYA 4NBWA 1CY4A 4B8ZA 2NZ8A 4QTZA 1QSGA 2QJFA 4W5TA 3VC3A 1HL3A 4B45A 1L7NA 2J30A 4OHRA 5CFQA 1E1QD 1NXTA 2W6QA 3NTRA 2GRJA 5BNIA 5CNKA 2TRSB 1RE0A 3P4XA 5I9BA 4M49A 4COKA 2H5IA 4FUTA 3O38A 2J45A 3KQOA 3TNJA 1YS6A 2I1QA 4LXIA 4ZVSA 4LTMA 3JD1A 1Y3CE 5LSAA 2CC2A 5FHQA 1H0RA 1KSHA 1BCSA 1UBCA 4NC9A 4ER7A 2R00C 3AR2A 4S0XA 4MUFA 3DVQX 3S1LA 1T5DX 3T5DA 3PI6A 3ZIAD 1VPWA 4S1WA 1ZZEA 4PCVA 4GM1A 2JLCA 4P0TA 4PIPA 2FR0A 1U3FA 2NV6A 3AFOA 3EF1A 3FNGA 2ZAYA 3KEFA 3LP8A 1AF4A 1CYDA 4FHFA 4Q9JA 5JD5A 4PGHA 1GLNA 8AT1A 2QF7A 3EX7C 2DT5A 2EDAA 3K1JA 2WIKA 3HU3A 3LTEA 1QCDA 4CMHA 2CSUA 2YWXA 3DLCA 3UJCA 1DJOA 3STHA 1TXGA 4CMEA 1N78A 4H7IA 4LYAA 1WUTA 3A1FA 3CLRD 3Q72A 4ZOEA 2H0RA 3DTTA 3HS3A 1VJGA 5DFAA 5CDHA 3VYTB 2JGJA 5DRTA 1IBCA 3HMQA 2O0HA 2VUHB 5BN1A 2ZYVX 3L84A 4CQMD 2XHEA 3QOYA 4K8RB 1FXWF 4L3VA 1RZRD 2IX3A 2GPNA 2R1TB 3BMOB 1PS8A 1YC2A 2XIJA 4TL9A 3KJNA 4P5DA 5F4BA 2IZ0A 4TSFD 3WADA 5AVSA 4GBMA 2EBHX 1M1NB 2PX2A 4KQ6A 3SQNA 4B3CA 3R6GA 4AZWA 4DC0A 1Y8ZA 4MV9A 3VAZA 4LF6B 3K2IA 3UVEA 4NKRA 3QJYA 1A8PA 1PR3A 1YTLA 4JEIA 5GPBA 4UPEA 2PMWB 3DW3X 3FSRA 3CZ5A 4AMGA 4JD5A 3CYFA 4MRMB 1TI7A 4NR0A 2VZ9A 4X3CA 3QY9A 3RVNA 4E12A 2CVOA 3H97A 1TO1E 2BF4A 2RG1A 3PFWO 3I2FA 3CNOA 3UHPA 3L7BA 3W77A 2CNBA 3RT7A 3OCUA 1ZU4A 4FYMA 1NNSA 3I2HA 4JJEA 1Z2EA 4LWZA 3RSQA 3N70A 3QK7A 3DCYA 3SKYA 4B3IA 1N3YA 4I55A 4DADA 3OP4A 1J0DA 1TPZA 1SXJA 2HKIA 3J7TA 1JEYA 4XVRA 4DQDA 3JQ6A 3OO0A 1X1RA 3KLMX 1BH2A 5GVSA 1C0LA 1SGWA 1SQ0A 1U5AA 1YCFA 2VJCA 3PSAA 2G08A 2WYVA 4ZCSA 3UOAB 4HQRA 1PGJA 1RAGA 1JSCA 2OORC 3QEMB 1T24A 4J16C 4DMHA 4XI9A 1DO2A 4DIBA 1BYIA 3VPFA 4I5IA 2H0QA 3DG9A 3KUXA 4BX2A 2P75A 2X2OA 3GFOA 3OZTA 4TZTA 4HFMA 4MH0R 3RVSA 2IOQA 5JTTA 3R77A 4BKMA 2WMNB 2YZKA 5J2UB 4MGYR 1U98A 1QHGA 3STWA 5A9SB 3U7JA 4YTEA 1ZC4A 1R5NA 3MQFA 2O0MA 3AVVA 2D06A 3CKMA 1Q15A 5EZYF 4MPDA 4JIMA 3R74A 2R2AA 5IMBA 3TM5A 2GD2A 1DQRA 1ND6A 3MIIA 3H1FA 3GDWA 4B47A 5HNKA 1EVEA 4MLPA 1Y3IA 5EGSA 5G0SA 5C37A 5LD2B 1P17A 1DKQA 4HVTA 3DBLB 1HE4A 2Y1LA 4NEHB 2AFHB 4Y8VA 5F2KA 2FPIA 4M87A 1E3TA 1OGYA 3KFVA 3WB0A 4B81A 4YASA 1AGNA 1JQKA 1Y42X 4MNTA 1G21B 4IIGA 1ZXXA 3Q9NA 3T7AA 1NPYA 5CEJA 1WKCA 4BLQA 3NLLA 2A59A 2O8CB 3L0OA 4YJ2A 1AKTA 1Y4UA 1MT0A 2YNMA 1E1MA 2OXRA 2YVLA 4I9UA 4QO8A 1CUEA 1NW6A 5ED4A 4GPTA 2QM3A 6ABPA 2Z57A 4MYDA 1E64A 4NBKA 1EXMA 1EZ4A 1U0HC 3D3NA 3E6AA 4JWTA 4MLCA 5T57A 3QVWA 4O33A 4UZEA 1XU9A 2QZSA 3VR2D 4LJKA 2O59A 2GH1A 3A1UA 1ZLYA 5ALDA 1JALA 3QWBA 1JEOA 1NLUA 1NUSA 1T3TA 2RBEA 2VYVA 3PGVA 3R3HA 4UVHA 2RJNA 5C80A 3KUKA 3H4TA 4IG4A 1TPYA 1DHTA 1SVIA 3WV4A 3PP8A 4N49A 3ZVLA 3ZE0B 5JSHA 1P2GA 1YK1A 2CYBA 2NO7A 4K40A 4WCDA 3FDZB 4E2ZA 4PG7A 5A4MS 3VH2A 5JZ9A 3R9WA 1TM1E 1HT2E 5K8LA 1V7ZA 1OOEA 1VPEA 2I3BA 2JJ1D 1RC8A 3Q3JB 1WM1A 3RSFA 2PZKA 4EYEA 4K03A 1X7DA 5AVXA 1I0IA 1V1RA 1VBFA 2V7XA 1YE3A 1ZH8A 2Z9CA 3AFIA 2EF0A 1KOLA 1S9DA 5E6UB 2GBLC 2INGX 2O50A 4JYCA 4NDNE 3OZGA 4BJ3A 2CHUA 1KJIA 3WTBA 4P3PA 3VH3A 2ZJOA 3GT0A 5AI6A 3PWSA 1X3SA 3BMCB 1RZ3A 3EZNA 2B6HA 2X8JA 5DN6D 5LD2C 5TARA 1MORA 4PZ0A 1SBTA 3FFAA 4MVJM 5ICCA 5LQUA 2P69A 3JWJA 2P30A 2V7VA 4W6ZA 2QQFA 2MCFA 1Q22A 2V97A 3D8TA 4WZAA 2JIOA 5CM2Z 4BVEA 1XA4A 1JKMA 4KI7A 3PK0A 3CVXA 1D8AA 1YCGA 4Y6LA 2J9ZB 4YP5A 2D0OB 4EEXA 4IIXA 1L5NA 3C6ZA 1N57A 1UBSB 4ER0A 2JCSA 5BSKA 4HWPA 4CR8A 1R1DA 1AHIA 4LDPA 4UZFA 3B89A 3SIRA 3HDQA 4D9KA 2FMUA 2FUCA 3FCCA 5IKOA 5CCDA 3T3MB 1AURA 4PG8A 1UC9A 4CF3A 4OREX 1NDHA 5KI6A 2D1QA 3VJMA 3RO7A 4YRTA 1PJBA 1Z6AA 3NAMA 5FLKA 3WLEA 5KYWA 1FX1A 1T6YA 3CUKA 1RVDA 2E4VA 4LHXA 5EJFA 2W83A 2E4YA 2OGUA 3PTZA 1G8PA 1OT3A 4JX8A 1DCFA 3U56A 3FOCA 1FZQA 5DF1A 1POWA 2JIRA 3V4FA 3QSGA 1X6VA 2HFJA 4PO8A 3AP2A 3TMKA 1M67A 1LK5A 1ZBDA 2F3QA 2J41A 4K6MA 1QBKC 4KTVE 4NARA 2B34A 4JXJA 4Q05A 4RULA 4FFBA 3ZJTA 2JLXA 3O26A 1ZI6A 2HDWA 3KVVA 4GWLA 2Z8XA 1ZONA 2AYXA 1SQ6A 3N2IA 4GM4A 4IJUA 4JASB 1UKYA 3H1PA 3RTEA 3T1VA 1FDIA 2FMKA 1EESA 1TUGA 4BV9A 3IS3A 3QU5A 5EPOA 5IM4A 3MUNA 4G1EB 5J5VA 3K15A 1CUSA 4BZXA 4CPDA 1MJFA 4C3ZA 1T4MA 1NRIA 1YJ8A 2ORWA 5SYNA 2GSDA 2EZ9A 4ZZ3A 3WZ2A 3PGMA 2OXCA 1YRBA 1WV1A 4B4WA 2Y93A 4JLVA 2WFLB 4I9NA 3UJ7A 4E7OA 5JSQA 8OHMA 2WOOA 2V8OA 3URKA 3PIIA 3ZCSA 2HL6A 4HUQA 4OK6A 4LRQA 3LDUA 4KGZA 2JHFA 4RCYA 1IVNA 1LQ2A 3I73A 4D9MA 4DLZA 3DEYX 1ZMTA 3EXHC 4O4LF 4WZZA 1LD3A 5CHEA 3NHJA 4IX1A 4NK4A 3JYHA 1IUPA 2RGBA 5LZ5A 1DXQA 1E0DA 1GXSB 3GUVA 2EQBA 4MR7A 1FNSA 5TC4A 4GC5A 3LO8A 1DKOA 4QQKA 5LZ2A 4N8DA 4W5HA 3GPIA 3ZQKA 3NGXA 1WEKA 3ZYZA 1R4NB 1U7HA 4L0MA 4RZXA 4KQ1A 1DBVO 3PDUA 1PP4A 3A4TA 3P26A 4JOBA 3QLUA 4NU0A 3T5AA 3PNMA 5ALRA 3MGCA 2WU3A 1PFYA 3L0YA 4Q3CA 5GJWC 3H1BA 5HKBA 2HTFA 4EEKA 5JAIA 1RPNA 2BZ1A 3ND8A 4KVGA 5DP1A 1JIJA 1OFTA 3GDFA 4A2QA 4EENA 4A92A 4BNDB 3HDYA 1ZS9A 3MWFA 4ZU3A 3KJHA 1KO8A 2XVZA 4H1WA 2Z04A 1EH5A 2AXPA 4JJ4A 4OX9Y 4LN1A 1DQZA 2CE7A 2DG2A 3IERA 3OZWA 4MJ3A 4YRDA 3ZE9A 1E63A 4YJ3F 4ZHQA 2A1UA 5HMLA 1JBKA 2X7XA 4W9MC 3PJRA 4CQMA 3FBGA 4G1BA 1O6FA 4A0SA 1KY2A 1P7VA 1HQKA 2R65A 3BHJA 1NVFA 1Z5PA 5FOVA 1UKEA 2RGNC 2OV1A 2F8LA 4D45A 1LSOA 3WK7A 2QK4A 4QYTA 4D8WA 1CNFA 4DZZA 5B7GA 1ENYA 4RTSA 3C6BA 1JTFA 1GOTA 1E32A 4TXHA 2XCOA 2ZSFA 2A9FA 2GCIA 1NQOA 5JNSA 2FV8A 1SBNE 2Q3EA 4A8JC 1EUCA 4G1VA 2XVYA 1NF3A 2GAOA 4HZUB 4H7HA 5H4GA 1PSWA 4KQWA 1A5BB 1YASA 1DQPA 4G84A 4M37A 4OUDA 1KTIA 1S89A 2VCEA 3JQ7B 4FIZA 5ANRB 4G4SP 2F48A 3OJWA 3EULA 3ED5A 4MLZA 5HCUA 4JUDX 4V0OA 5HBRA 1MV8A 1GUYA 2Z83A 4F6LA 5A71A 1N2BA 1FFXB 2G7MC 1IYZA 2PLNA 5JS8A 4CR7A 4NBRA 3IAM1 1FSPA 3DB2A 4K9RA 3DQQA 3R9XA 2XUQA 4KGDA 4DNQA 3EBOA 1NXVA 1L7QA 3KZXA 1HDCA 1E9FA 2J6HA 3D8UA 4O4LA 4RSHA 5DNWA 4HAZA 2W2OA 1B16A 4IHJF 4DCSA 2VTKA 3DF9A 5GWXA 4ESOA 4GOND 1F8UA 1GPWB 1JEQB 4AUKA 4HN9A 2XQFA 2VQFB 4FQ5A 4PZDA 1KVTA 4U8GA 3ER6A 2EJUA 2QVGA 4PAWA 1GNRA 5H70A 3PEVA 1UXKA 5IYZB 4WZ6A 3BKWA 2HLDA 1YC5A 3SYNA 1EXDA 1RACA 5EZYB 4R3WA 4B87A 3D8BA 1PR2A 1L5KA 2DBZA 4ROTA 1U0EA 2C8KA 2JLBA 5IM4F 2JVIA 3CHYA 4H2DA 1B42A 3FDXA 4MRMA 3KYDB 5HCNA 1PV2A 4TOIA 3SQDA 4E32A 4R54A 5EIXA 4IDFA 2BBSA 4PFKA 4ER5A 3KUCA 4OB8A 1GU7A 1PR6A 1PU2A 1VGQA 2ETXA 2HLHA 2HHJA 4ONEA 3TRDA 3VOAA 2QTHA 1V8OA 3OUTA 3RUHA 3K8QA 1CNEA 1ZOLA 1HR0B 2NZWA 5LVAA 4WBNF 1JB9A 1JIIA 3MW8A 1SUSA 1WDWB 3DAPA 2ZE5A 3CUWA 4JGIA 4OHWA 5JNVA 1W88B 2I2AA 5AK0A 2GRUA 5AM1A 4R1NA 2F1JA 2JZCA 4DM7A 3G3EA 2R8XA 1WMFA 3GNQA 3SG0A 3AERB 3UK2A 2XGSA 3PPIA 4ZAZA 3QVGB 2OCXA 1GN9A 1YJCA 4DBVO 3K1AB 4CYMA 2ZUBA 4RK0A 2IEGA 4K8OA 4S1NA 4WLUA 3NMUF 4KRFA 4EABA 1J0XO 1QGUB 4PF1A 2OOSA 4TV9A 3N0WA 5FUBA 3RAJA 4FFRA 1HLPA 1J24A 5FOXA 4M7OA 3ITDA 4CF7A 3R6TA 1Y8QA 1ESNA 1YE8A 1Z4QA 1XDDA 4C2AA 4JJGA 3ML1A 4NU8X 4HDKA 3VVMA 3IBFA 1SQFA 2HUNA 4URYR 1YL5A 2H1SA 3GDOA 4QFBA 3OCWA 4OK5A 3GVIA 3ICVA 3ZCVA 2PVSA 3JYNA 4AXXA 1AMNA 4NCIA 4QWWA 2YXPX 1HORA 4MVJE 3DZHA 4AY5A 1G21A 1M76A 2GBGA 3U7EB 3GQVA 2A67A 4NEGA 2R1VB 1EA5A 4AQYB 1Z63A 3ZEAA 3OJEA 4J03A 2OHJA 3DZFA 5JROA 5EJGA 1JAIA 4GLLA 3Q10A 3E18A 2YY6A 1WA5A 1SKUA 2AUMA 4QIHA 5DJ5A 3OSZA 4X0EA 2FLVA 3NEJA 4YUZA 3RCBA 4RTQA 3M9XA 1P6XA 2DWUA 3V33A 5L3QB 1JMYA 2PGNA 4UW9A 4MUXA 4XASA 1NLYA 5JG7A 3QF7A 1SD2A 4ARBA 1IEVA 3ID6C 4UUNA 4DG8A 4FYXA 5BN3A 4LCEA 4C2UA 3GT4A 2VRCD 4MSUA 4WKCA 1US8A 4AC9A 1P4AA 3UM9A 1FJHA 3MBIA 4ILEA 2VBGA 4IWNA 1PQWA 1I32A 1BEUB 2WWTA 1E58A 3MXTA 3WDMA 3R0IA 4B3JA 5JXJA 4XDZA 1KZHA 3Q2KA 1ZM2A 2I22A 3E7PA 4W7HA 1Z0AA 5BRNA 2I3DA 2PRZA 2QLNA 3VPCA 3LHFA 5EQFA 4HZIA 3T34A 1O9GA 1S7CA 4E6EA 2F9MA 2QZZA 5A4JA 4YUWA 2B7LA 2OTCA 5TGDA 4BLUA 1GZ4A 3SDBA 4CR6A 3DWGA 4P4TA 2UUOA 3ZWOA 4B7UA 4R9UC 1OIXA 3EZYA 1CUVA 4XD7A 1L5LA 2NU6A 4KQFA 5FTLA 3T3GA 3L79A 1FQJA 2V9ZA 2W6MA 1T15A 3OUZA 4WZAB 1WOMA 1YB5A 4HX9A 4II2A 2H85A 3HYLA 4YAJA 1WMSA 3ZN2A 3PEFA 3FLAA 5E8JA 1EHCA 4L8YA 2VA8A 2D2EA 4X20A 5IAJA 4AW9A 4CL3A 1KY4A 1H94A 1SVNA 4HAOA 1PVVA 1Q74A 3HCRA 4LXGA 1PGNA 3OG9A 2HSEA 1H1DA 2XMBA 2VNKA 1JPUA 4E5MA 5TX7A 4U3JB 4AJ1A 4DLSA 2PA0A 3GC6A 4OGWA 3MHTA 3EXAA 1OBHA 3ROMA 1I3CA 1V1MA 1WXQA 3IO5A 2Q8NA 2WIBA 2Q2OA 2PIDA 3IVGA 3ICQB 5LP1A 2B35A 3DM5A 3O6VA 2VJBA 4R9VA 3UXEA 2LZ0A 3U4DA 1TVMA 1OX4A 3WNDA 1BTOA 5FTKA 2AE2A 4ZQGA 4UU7A 4NDAA 3BMNB 5JYCA 3D8NA 3N3BC 3G0CA 3A1VA 1XT6A 3RPEA 3CZRA 1CFZA 5FOUA 4N5HX 2V4UA 3ZW8A 1ZKMA 2UYQA 2AEEA 1P2VA 1RWPA 3BJIC 3TLEA 3U61B 2I8CA 2P68A 1E89A 3H5RA 3QEOA 4UTXA 1E4EA 4D41A 4MJ7A 1EVQA 2BKVA 2E37A 1UJ4A 4W1RA 4BQRA 1H9BA 1CUUA 1NFFA 4D6XA 4D9HA 3KVNA 4W6QA 1X14A 3KV1A 3TB4A 4M1TA 4CCAA 2ABWA 3GLFA 4ZQCB 4YVFA 4FR5A 4C4TA 2X9NA 4BZZA 2JJQA 3H5NA 3ONFA 2WFLA 5IZCA 1I24A 1P44A 1X0XA 1ZGCA 4HAVA 2JBHA 3RRBA 3SX4A 3QG5A 2A0YA 2YL2A 4IQ4A 2V9CA 2JLYA 5L3SB 1QKKA 3AR4A 4UPVA 2YJNA 1XRSB 3O74A 3VDNB 3V4PB 2RGEA 2BFPA 2IIVA 3F5FA 2AWOA 3E48A 3M1AA 3I5UA 4HBZA 4YUAA 4B71A 3ZJVA 2VWHA 1C7RA 2GT1A 4HDAA 1XR3A 4GOOD 3M2TA 4L5IA 5EWMA 3RYFB 3MEQA 4BFUA 4QFCA 3ETNA 1ODIA 2CNNA 1Y4ZA 5A2QA 2DLNA 3B1XA 2X1HA 3BMQA 3ZX4A 2GF0A 3JARB 1FFWA 3RTCA 4FMPA 4A36A 4N7MA 1B23P 3FBWA 4MYHA 1B74A 1ZVJA 3DZCA 1A2OA 2HBQA 3HJUA 5B3LA 3I1YA 3L04A 4KWIA 3TGWA 1AGRA 4QYXA 3VBEA 2VHUA 4NBLA 1M1UA 2NXCA 1PS9A 4MV4A 3JD3A 5DLPA 4DXHA 3LYLA 2P5UA 2JAQA 4CBVA 5CFPA 4Q7JB 2XMRA 1R0WA 3I52A 1ZHFA 1KIFA 1NY6A 3FR8A 3TBFA 3DC7A 1QHIA 2P2ZA 4KWCA 1IPFA 4Q7EA 2XCLA 3WYDA 4HH0A 5KX5B 4NMMA 4MROA 1ZK0A 4RUKA 2ZVJA 4J1TA 3TSCA 3WBKA 4RTNA 4YMSA 4AP9A 2OQVA 4YEDA 5IYZF 4TX1A 2A5FA 1FP7A 1RIFA 3O7WA 4MO2A 1OI3A 2OLKA 2E5FA 1GFZA 1C9MA 2ZQYA 1YL7A 1J0AA 1SA0B 2KLBA 1OC4A 3K9LA 2AB0A 3UUFA 2HWYA 1ZH0A 2Z3WA 1DBSA 3QWIA 3ZNQA 2OOKA 3D0QA 1Z5GA 2ZBDA 3QQPA 4E46A 1Z15A 5B6JA 3T9BA 1RXWA 3AM4A 5IJAA 1JNXX 1A9RA 1DAKA 1KAMA 2FSHA 2J7PD 2RHJA 3BQNB 3A3PA 1KI4A 3KLOA 3OF5A 1Y4AE 5DP2A 3PICA 4B82A 4CGZA 1PR1A 3FRJA 2FZVA 1MG5A 2JGRA 2OUKA 2W2LA 4E13A 3BWMA 1RTKA 4RJ2A 3ET4A 1P33A 1W8IA 4LOKA 3I64A 5DT9A 3VZCA 3LPLA 4D7AA 5EE9A 3RS9A 4DOMA 1I10A 1VCIA 3ODGA 4PQGA 4AKEA 3C6QA 4ZU1X 3MTGA 2HDOA 2M6KA 1ONOA 3MJDA 4U7DA 2JLQA 1LJ8A 4V0QA 2RONA 1IMOA 2ON6A 3FZNA 2OXIA 3VO1A 2AQKA 3RARA 3NTXA 5AVKA 4A5OA 3E8SA 1E18A 1Y1PA 2HIAA 1R7RA 2QTGA 1OR8A 2WE8A 4S1VA 5LXTF 1CUFA 4O6VA 1DADA 3X1WA 3I6QA 1YS7A 4UAUA 3W4IA 4BBPA 4Y9TA 1Z08A 4YBZA 1L3CA 4TT3D 5JUWA 4F3NA 2BCJQ 4OHFA 3L01A 4FGSA 3HU2A 2WIJA 3TTVA 2EKZA 4FEGA 3C1TA 1WUIS 4TTSA 3U48A 2WJYA 2AOTA 1CNMA 1BXKA 2ES4A 1FSFA 1BDHA 4KKXB 3L5OA 1BA3A 2Y6UA 3H5AA 3WDKA 3RRNA 2CMFA 3KKOA 4LJRA 1N3IA 2HK8A 4DR6B 5JS6A 2CDCA 3FRHA 3REQA 4WNAA 1R6VA 1MTZA 2H4ZA 2A86A 2D4AA 4W7IA 3EGXA 1ST2A 2JKVA 4P86A 2Y9PB 1N1DA 5JAZA 3AV0B 5LDDC 4NEQA 3VC2A 3CO5A 1IUNA 4HDRA 4HATA 3DXXA 4L8GA 1JLRA 5AM2A 1CRPA 1NQTA 5JAPA 2W5UA 4AX8A 2YHUA 1XLVA 3DL0A 1MIOB 1P75A 2NAPA 2J3LA 1EFPA 1JYFA 1OJ7A 3ZIDA 1P1CA 2UZAA 4B6RA 4F9GA 5BN4A 4JVNA 1LRJA 1X7WB 4QHSA 2DWQA 5BT9A 1IBSA 1KEUA 3DT9A 1UMCB 4LRWA 1N5OX 2AF3C 1BROA 4KJZA 4YJHB 2FPKA 3S8MA 3C74A 1OFHA 3SF8A 3SFVA 1E9RA 3KEGA 4M1ZA 1OX5A 4Q93A 3VC7A 4DLPA 3W2EA 5ITWA 5TVKA 2YFYA 2ONZA 2QZPA 4AECA 3MBKA 4B6PA 4C43A 4CVNA 3H65A 3FX2A 5C4GB 4I9FA 3JASA 1KU6A 1PLKA 3PXXA 3L0IB 3HBNA 5BWNA 1OHHA 4XR4A 1YJQA 2ZJBA 4C0AC 5BPHA 3IAFA 1N5RA 5U9CA 3LT0A 3LGXA 3FCXA 3KX2A 3GP8A 4EO7A 3ND5A 1GTMA 3EZ2A 4PBRA 2QV0A 4WJZA 2D3TA 1Z88A 4ZYVA 5B4TA 1SR8A 2BL4A 5E4FA 2D74A 5T5QA 4UARA 1E62A 2YDXA 5E0OA 5DN6A 2HOQA 4HFRA 2OBXA 5K0NA 4IHKA 4RH0A 4RS4A 5DNCA 2ZROA 5J59A 2H3EA 2G3YA 4PBTA 4MVJI 1UP6A 2PLAA 4MUJA 4ZYTA 1ZZGA 4P8RA 5IKPA 1GYRA 4LDNA 1Z4KA 4GYWA 3GMTA 1QONA 5JVDB 2PXCA 3SJAA 3TW8B 2ZI9A 3GGPA 4D4LA 2WMYA 3PRJA 2XDWA 1T9BA 2ZRNA 3S55A 3TRKA 4G0XA 4MQEA 3HL0A 4TWIA 4DYHA 1GPDG 3DKKA 4RX1A 4TWBA 3SVLA 5E9JA 1ZMRA 4NCHA 4HGRA 1I5RA 4U6SA 5L3QA 2DJIA 2B30A 3TLZA 2VDJA 5C5DA 1SY7A 3EPPA 1G3RA 5KOJB 3L7NA 4K2HA 1C7EA 3EPRA 4D02A 4HWGA 1GD1O 3KXIA 4GECA 3B82A 3V3KA 2VYVD 2X58A 5AO9A 1WTCA 2Z6VA 1OH8A 1Z56C 4GO1A 5DZSA 3ZHUA 3OM8A 2OL4A 1C9DB 3O75A 1YIAA 3ZV4A 3EXHB 1ZQ9A 3L05A 3U62A 5T3UA 3PX7A 2NUBA 5H02A 5PGMA 1QH8B 4Z6KA 1EJ6A 3B7WA 2QLMA 3RV4A 1AQIA 2EFEB 3ABSB 4XQEA 3GFRA 4GUDA 3C4VA 1IWPB 2XNKA 1Q7GA 2CL7X 1NHWA 2CLEB 4PLGA 1P1BA 3BXPA 3AI3A 2NTNA 2Q1TA 1T3GA 2XZTA 1NBIA 5IVPA 5I7HA 4P7KA 4GGMX 2ENUA 4DNOA 1BVRA 3C45A 3V2GA 2BVNA 1S4QA 3G79A 2W6ID 3KZNA 4AO8A 4DLTA 2Q2QA 1MZPA 1Z6TA 4JT8A 4GWKA 1SOVA 3GRRA 1DTWA 2IX9A 2Q6KA 3CSDA 4UBMA 1DUSA 5B3JC 5ERXA 3W5AA 4RHEA 1S4MA 2ZYGA 1YSCA 2GEFA 1YI8A 4HCJA 4DVJA 3QE9Y 3JPWA 5F77A 4UHDA 3RWBA 2G83A 1GPKA 2HNBA 2VH2A 4NI5A 5EN4A 3SXUB 5H7XA 2PNJA 3TXYA 1I94B 4TV8B 3K35A 2Q1WA 4RVHA 2G9NA 3IXMA 5B1EA 3V1YA 4H7JA 3AG6A 1M8KA 3OF3A 1OH5A 5EJ5A 2VYCA 4P3NA 3QPVA 1QIKA 3CPSA 1XK6A 1Z3CA 1WRBA 4PQRA 4AY2A 3RWOA 5JPDA 1LCIA 5K0FA 2QUZA 1DHRA 2FF7A 3G13A 3QVTA 2VHZA 3BRQA 1DWUA 5D85A 3MTBA 5DM1A 4EBBA 5K0SA 1W4BA 1E1RA 3LD9A 3FGPA 1C0KA 1NQVA 1OTHA 2ID7A 1WB5A 2AJTA 5IBPA 3IVAA 3VBCA 4PN3A 4E6PA 2R6FA 1GT91 4ENQA 1A71A 1ONSA 2JFNA 1VKOA 4MMZB 1Z7WA 3SHFA 4IQ0A 1DEHA 5EESA 1CULC 5D6NA 4QUIA 4R3UC 5GIOE 2HU2A 1TCAA 1XVIA 1TVCA 2H2FA 3IAAA 5AOBA 1X86B 1CHDA 3ZG6A 3KKNA 2TECE 5AW0A 4G1MB 1Z38A 4XRRA 2OKGA 3ICCA 5AVYA 2P2YA 2DSTA 3E8MA 3FOBA 1L5GB 3ZQUA 1A5SB 5GIPE 2ERYA 1IOLA 1UPFA 2MSKA 3H16A 4H17A 3RABA 2W11A 3MUFA 1U7PA 3ZE6A 1BG6A 2DYKA 4R9RA 4ZT2A 1JLSA 2A9PA 5E7JA 3AZPA 4R2KA 5A2GA 1KAOA 2PS3A 4R9NA 3RREA 1A4UA 3E4CA 2C5SA 3A6KA 2ORYA 4RVCA 4YALA 4CM9D 4CV3A 4P7JA 4TXNA 5IZCC 1XEXB 2R1TA 4UMFA 5EZ5A 5IAGA 4ZANA 3UMCA 1EP3B 2EJWA 4JP5A 2VIIA 3OKPA 4FYYA 2R79A 1MU0A 4OFXA 4QOEA 2QN7A 3Q7TA 2ZWOA 4XJTA 4EF4A 1KEPA 2PBLA 2WJAA 2X3YA 1M8PA 3S27A 2PUCA 5JY1A 1ADCA 1U2TA 1SKMA 2O2EA 1CU1A 1GSAA 4FZJA 5I45A 1DFGA 3RF7A 4UU8A 4D26A 4EJSA 3HK2A 1Q1EA 4B3SB 4K6KA 1K5GA 2VP4A 4MYSA 4ODIA 4W8OA 2I54A 5KU7A 1WU7A 1H4TA 5AFSA 1QM5A 1R6XA 4YV1A 4LW8A 3LHKA 4NAUA 2O1EA 2V6FA 1QH9A 1IONA 2AOUB 2QXUA 4BO5A 1WNTA 2HA6A 2HCTA 3AGQA 4IHJA 1BD4A 5D86A 1YR9A 4C0XA 2I4RA 3V1NA 4QRDA 1ZN9A 1NNEA 4BRSA 3BTOA 3P8ZA 3PX3A 3NUGA 2O2JA 4HWOA 5ESXA 3Q98A 4TYMA 1R16A 1OU4A 4FPXA 3HR4A 3SQLA 1PQYA 1E94E 3LCCA 5F35A 1NBMA 3BL5A 4D8VA 3C0KA 1HOTA 1S2NA 2B5VA 5LYJF 2EOAA 3CZQA 1I2MA 3I6BA 4FE7A 3WWPA 1BYUA 4X6LA 5EJ4A 3WA6A 1EX6A 2C29D 2QPTA 4ARCA 2WTEA 1S9HA 4RCVA 5A5VA 3DR3A 1C5KA 1Z0KA 2BHLA 4QXRA 3ONVA 4PE5B 4W1QA 2PH3A 1FMTA 3E9QA 2B4KA 1EGAA 5A9RA 1EB8A 4IVPA 1TKRA 1G7TA 2Y1XA 4OHUA 2Q1SA 4E08A 3U4QB 1PJ4A 1JH8A 4GU5A 2NW6A 1KAGA 4J0DA 4EITA 1GZ3A 1ORWA 1TUBB 1CR4A 1ULSA 121PA 1XCGB 3GLRA 1M5RA 3ERCA 1Z4OA 3L6OO 5SICE 2GTPA 5FOQA 4R8VA 2YHSA 3B20A 4NZ9A 1UJCA 2Y67A 3G1TA 3TQOA 4E14A 5LLTA 4WK0B 3JQFA 2HJHA 2OLJA 4YBRA 1PV1A 1AU9A 3B2EA 4ZOQI 1Q11A 2QRVA 3GEPA 1LX7A 2B37A 2WA1A 3VHRA 4RV4A 3I3SR 1SPBS 2HBRA 2PGJA 3QPWA 5GAJA 2VPWA 5AMXA 4AYXA 3NYRA 4K6CA 4GPEA 4ND3A 2PPLA 4TSKA 4OMCA 2NQ8A 3ROQA 4BV3A 5LIRA 4ARIA 7REQA 1AV7A 1YJ5A 1FNMA 1QP7A 4J0CA 2NAFA 4RHYA 3DAHA 1MUUA 4E7PA 2J9GA 4P83A 3BGOS 5I9MA 1KJWA 3EFOB 2VXYA 4H16A 2C5FA 2P9QA 5BSWA 1AZSC 4W8HA 5JH7F 4NPCA 1WMBA 2DQYA 4KDEA 5DNAA 2QJOA 1W46A 2H4JA 4XIJA 3ZVRA 4FYKA 3FPFA 1P31A 3EEFA 1OGJA 2DECA 5CA0A 1BZYA 3KYJB 1PS0A 3R5SA 1H2AS 1R88A 3H1EA 3H5IA 2QY6A 3WFJA 8ABPA 4YRFA 3LBNA 4ZCRA 4GMXA 4FFDA 1HZZC 4UBLA 4YH1A 5DW3A 4BXOB 2AH5A 4NOMA 4RH1A 2NO4A 3CCFA 4B3MB 2JK1A 1T6ZA 5AXDA 3MB8A 3AFHA 2J5XA 2VG8A 4KN6A 3VTAA 4EARA 2VUSA 1QRUA 1UL1X 4DIKA 3RU2A 1W36D 1HV8A 3DWFA 1LSJA 4HP8A 4FDLA 2PFKA 1M33A 4NP6A 2Y2VA 2YS7A 4OQNA 2XGGA 1XFDA 3BMCA 1Q1BA 4D80A 3MLEA 2JHAA 1IG3A 3CV3A 3KKZA 4JY7A 4R16A 3G85A 5JXIA 1ITZA 2OBLA 2XT6A 3F90A 3P7MA 5CT8A 4IY1A 4C4YA 4K6HA 4WCFC 2JIDA 4OU4A 3RSZA 3A3YA 2IUFA 3UH1A 2FKNA 1P9LA 1KC1A 4RKFA 1KMMA 3X43A 5AVRA 1Q0UA 4HH4A 1QX4A 1XWFA 1JDNA 5A3VA 1UAAA 1QBGA 3BCHA 4BFLA 2OAGA 1ZHHA 2FCAA 4C7MA 1MO3A 2DQKA 3Q88A 4W5QA 4FKBA 2X4DA 3LW8A 1UFKA 4KN9S 1XWIA 1Z0FA 2VTDA 2XRFA 3NDIA 3RJ5A 3WGIA 1P7ZA 2WF9A 1CEEA 2WSSA 3Q40A 3BGVA 1VKZA 1ADJA 1PNTA 2IBTA 3K94A 1MQAA 3QX7A 3U09A 3A58B 4YQZA 1W4LA 2PKQO 5TQ0A 4OBXA 4P5PA 2DC1A 2OWDA 3QUTA 3UXHA 3RS7A 2X9GA 5K8TA 4RJKA 1C0PA 4JP2A 3PA8A 2NZVG 4WUTA 5ULLA 3HKDA 3G17A 5ALJA 3RHFA 5KC8A 3KYCB 1XEFA 3QKRA 2QVXX 2JIQA 3SIPA 4V24A 2HBYA 4EL5A 3B6KA 3ZCPA 4QLAA 1JYEA 4UUBA 3WTCA 4ENVA 4EDFA 4CLOA 2PO7A 4MS4A 4FNAA 2ODEA 5AYVA 3IOBA 5JVDF 1SBYA 5IW8A 3UWSA 1QPBA 5J43A 3A0RB 1P7CA 1QAMA 1SUIA 1H2ZA 5KMGB 1PJQA 2SCUB 4MV0A 4R3NA 4YAWA 5MN5A 1R64A 1N2XA 3PGJA 4JUCA 4KW7A 3DXFA 3SFTA 1V5FA 4JB8A 1CS0B 3AM5A 4B79A 1P2FA 3MYYA 4FC6A 4BX3A 2ZJ5A 1W5BA 5CLLA 1YR7A 2WU8A 3GYGA 4RK6A 4YYEA 1Z83A 3PQEA 2BYTA 4Y67A 2QLJA 2FGKA 4KNVA 4Z1OA 4H27A 3EXHA 4DJEC 2WHQA 2QX6A 1I6WA 3OU2A 3IOMA 4HUQB 3DLBA 4U7HA 2WSSD 2X9LA 3AUKA 5ELXA 1LPMA 1UODA 1XAIA 4E70A 5IKEA 2HSGA 1KKUA 4V0NA 2GPTA 4REMA 3S7TA 1KJYA 3QJGA 3QA3E 3FUUA 4ITUA 1V25A 3OHSX 3EIXA 3P20A 4CCYB 4G4JA 3D7LA 4JIGA 2OV2A 4MR7B 1MZVA 1MB0A 4GS5A 3T61A 3HXTA 1CQIB 2Q6LA 4J0IA 4M1EA 4BB0A 1EQUA 4H3KB 3HN7A 4DKJA 2XQKA 4DLYA 1XP5A 5L3ZA 2EWWA 4OATA 4YLYA 1USWA 3ETEA 5C0OE 3IELA 3WIVA 3U3DA 3I28A 2IXBA 2C83A 3FDZA 4GSYA 4IYJA 1I2ZA 2PH1A 3EA0A 4RHUA 3OT4A 4QDUA 3U1BA 1NTOA 3IJPA 4LEIA 4BUCA 5IJZA 1TJ5A 2OC9A 2V98A 3CWZA 5BSMA 3E3MA 3VU0A 4OFZA 1IPHA 3GIDA 2MSDB 1E9BA 3FA2A 1ZD2P 4ZI5A 3ZNPA 2R4QA 4FGZA 3MAAC 4IMRA 2LBPA 3LKVA 4BFXA 3PPYA 3QHQA 3GK3A 5CLJA 2IYXA 4ZHQB 3VZPA 3K9BA 1M75A 3QE0A 1T0UA 1UPCA 2DH6A 3DUWA 3OTIA 4QSHA 1DSSG 1NBWB 1CZRA 3CJQA 3U5ZB 1K7YA 2HV8A 4J9UE 4BU1A 2YWEA 2JL1A 5HQ3A 2P6NA 1KDZA 3BE6A 2J3HA 2HCJB 1XMIA 5FA6A 1T3ZA 5FCDA 1USGA 4ENPA 4Q1AA 3T3DA 4BAGA 2IBMA 1XJQA 4JSRA 5EUMA 3E3OA 3W9UA 1CBUA 1QU2A 4FX2A 1JHDA 2V59A 2D3WA 4H6PA 4PW0A 3O4IA 1EVJA 2KM1A 3SXJA 1NLZA 3VRHA 3BRCA 4GQBA 4A6PA 1HNWB 4OAPA 4BQSA 1RWQA 2HK6A 2OCAA 4DCGA 4BPRA 3G0BA 1V2HE 3DBVO 1NMEA 4HNRA 3SYMA 2RB5A 2OHFA 3FTQA 4UUOA 4DR2B 4G56A 4LJAA 4Q4JA 2I6GA 5IWCA 3GEIA 3MWJA 1QU3A 3BHIA 5A7FA 3N8IA 2YVUA 3QI7A 2A84A 4OU5A 1M2NA 2QRUA 2AE1A 4PSUA 1TT5A 2IDJA 1U5BB 1WBJB 2IPNA 2ZR8A 4JCCA 1Y6RA 4Z7NB 4AMUA 1ULBA 1DWOA 4HAXA 3GGCA 4A10A 4XLZA 2Z1NA 4ETWA 2JJ2D 1E6KA 2GCEA 1QJCA 4JN6B 2W43A 3ZDDA 3FR7A 4ENUA 5CEFA 5AJZA 2OO5C 4AG5A 2JAOA 4Q24A 1AS3A 1U0BB 3ITNA 2A9VA 4P4SB 4NE9A 1OMOA 1OPXA 3Q5GA 3MVEA 5TGTA 2OG2A 4WOBA 4ALMA 4BHTA 1TM7E 2YIJA 2UUBB 4JKIA 1NMXA 2CGEA 1RD4A 2DPHA 4MVCA 2H06A 2EATA 5K3SA 3MWDB 3AVTA 1VI6A 3IALA 4DBLE 1THMA 2XKAA 3KHSA 4BS9A 3BWCA 3CEHA 3CS3A 4MR8B 2FUG6 2VLBA 3LT1A 4V1CA 5JOQA 1BVUA 3AW9A 3UV3A 2GA8A 4NV1A 2DX7A 4MMXB 5AVQA 4ZC1A 1NXQA 3W0LB 3FTFA 2O5VA 3G8BA 3GJ7A 5AI9A 4A6XA 4YV7A 1IL0A 1RLTA 1STOA 2QN6A 3PQ6A 5E9QA 3THYA 4DJTA 2P2NA 2I87A 3B60A 4YP0A 4CQNA 3HADA 3RYCA 4IILA 2XUDA 1FXSA 1BMDA 2GS9A 4BVLA 1X15A 3B53X 4JP1A 3CMMA 4PLYA 3STUA 3K70D 3CRNA 4WDQA 4QNNA 3EEIA 4GX0A 1ZAKA 2R6DA 3D4IA 3ELUA 2GJ8A 1RCTE 1RE1A 2YC4C 4JJZA 4F8EA 4FHCA 4TYQA 4B6JA 2WKSA 3B6EA 4PC7A 4C7BA 4FMDB 2ZRPA 1ZC3A 3QVVA 3R7FA 2ATIA 1QV7A 5IAAA 1U63A 1N92A 2XHZA 3G2IA 3I9FA 4DUGA 2PQ2A 2EJTA 3DEZA 3IVMA 1IZ7A 1A69A 1HG0A 2XUHA 4J6FA 4PQEA 4Q4AA 1CEXA 3ZY5A 3H1AA 3K0AA 4M88A 4PU0A 1GPJA 3K72B 4I1IA 1FFDA 3VNSA 2C1XA 3JZMA 4E4TA 1AS2A 1KIAA 2I6XA 4WLEA 2KYRA 2HW8A 1XJWA 5LOVB 1AO3A 3FTDA 5J5CA 2D0PB 5B5SA 3TMAA 3HB7A 3NCHA 3SIXA 2FE4A 1XA0A 3C3EA 2NPIA 2NUAA 4KE9A 4PBSA 5I8ZA 2C2XA 3A9WA 3RBAA 3NWPA 4ICIA 4MWCA 3DDCA 1JZQA 3SOPA 1JR6A 1OAOC 5JO0A 4IH4A 3HSSA 3IT1A 3TJZA 1U3TA 1V39A 1YB2A 3OKAA 4DLVA 1OFUX 2ZUSA 4JL6A 2HHAA 3OPNA 1JIVA 1GZDA 2JAWA 3DQZA 2D5LA 3CTMA 3I58A 3R1IA 4RL6A 4I1PA 2YTZA 4GKKB 3ORRA 1ESMA 4TTJA 4RPHA 2J3KA 3UGKA 5KC9A 3GLGB 1SUWA 4WOJA 5DHUA 2F9LA 3C3PA 4F5EA 2JW5A 2I6SA 2X8BA 2R4UA 4FHDA 1ZK3A 4LK2A 4I5DA 4QO7A 1TO2E 1USIA 2WI8A 2XE7A 4O2LA 2PZAA 2I5PO 3EC7A 2AYYA 1N6LA 1O0SA 2FPWA 1XEWY 2I67A 4PAGA 2YOHA 2PYIA 3NATA 3QH4A 4GW3A 1CZUA 2AG8A 2WRZA 4UD6A 3RODA 1XCLA 2HA0A 3ELBA 4JLUA 3TSYA 3EIFA 4IDCA 3KQSA 5K9ZA 5LP6B 1KC3A 3VNAA 4ASUD 1FRZA 1XCMA 4B1FA 4D3FA 4CKCB 5EEHA 1DXYA 1OC2A 1P74A 3OOWA 3NT4A 3ZHXA 2GN9A 1KZGB 2HB6A 2PT9A 2G36A 1VJ0A 1A0OA 2HPZA 3CTPA 2W0MA 3GLQA 1P77A 4MAMA 4BP8A 2JIZD 1V7QA 3CF2A 2NOAA 3V48A 1WVIA 1V3UA 4EY7A 4F1WA 1L4FA 4A1FA 1YA4A 1P0PA 4N8SA 2PSSA 1IZ8A 3FRIA 4E1AA 2BPOA 2P2CA 2LR0A 2VHTA 1G17A 1GZ7A 1KI7A 1O94A 2DKNA 4I8XA 4A1OA 4ENTA 2QTRA 4UTOA 2H31A 4XYGA 2QD4A 4F4CA 4FT4A 4GZ3A 5CR9A 1T9GS 2B3DA 4ZXPA 1UOPA 1VLQA 2QMOA 2OE2A 4X7RA 3T7RA 4AMVA 4DYVA 2FLWA 2VXOA 4LYHA 3RS2A 5IJ9A 1YBMA 3DTYA 3RQIA 1LSUA 1P9WA 4JYZA 4C6HA 1OLXB 4WDRA 1IBRA 4LE0A 2VZ0A 2W6IA 3I42A 1QC5A 3NBUA 1N5LA 1L7PA 2J09A 3P2KA 3P5BA 3UMSA 2XEDA 1X7ZA 3AU9A 2R00A 3DV2A 3PUYA 3X3HA 5BXQC 2WJPA 2XD4A 2REQA 3KT0A 5LYJB 1E8DA 5EHQA 2ECQA 3A1DA 1QVRA 1NNLA 2IK8A 3ADOA 4FJ2A 4FVTA 5FWXA 3V8VA 4ISBA 4MARA 4MEJA 4WLOA 2PGIA 3NHKA 2BFDB 2P6MA 4RSMA 4YY3B 1EXVA 1J5PA 1O95A 3ONDA 1CVLA 3AKDA 2ZRMA 1QQ7A 3PKJA 1GZ6A 3ZBPA 3KAPA 1P0CA 1GPUA 4ESEA 2RHDA 2X42A 4LZOA 4EY8A 2AZXA 4WACA 1ULTA 3E9NA 4KLCA 4XQCA 4FB4A 3HFJA 1FYDA 5AUOB 4KBYA 1IJEA 3E27A 3PTLA 3VDQA 3KKPA 3C6KA 4ZQHA 1P1KA 2IHBA 4PYQA 4BYMA 2R6ZA 4H7FA 3PHJA 1M6EX 2PAFA 1RZUA 3S4YA 3O1IC 4FE3A 1E6MA 3ZKWB 2OA0A 4D5EA 3L6CA 4IGIA 4C76A 4C3UA 2QVCA 2ZIEA 5DCWA 3S70A 1O95D 1JG6A 2ZANA 4BEBA 3HJFA 1MTOA 1NR7A 3W5BA 4MIOA 1NPDA 3ESQA 3FFXA 4MI6A 2W42A 3DKVA 3QMVA 3FCUB 2FFQA 3K1TA 2XPCA 3L1JA 4NWIA 2G8NA 4AI6A 1YZLA 2H00A 2X6TA 1EBBA 1MKYA 2G0NA 5C32A 2P6OA 3Q7PA 3GB9A 3DKRA 2IYVA 4MPTA 4YJ3A 3OEWA 5F9FA 3O4GA 1J2JA 4D4KA 4MUYA 4IIVA 5CTAA 4XRGA 3LXRA 5C8VA 4MKZA 4QQ8A 3KNZA 1PW7A 5THQA 3JVIA 3EEOA 3L4KA 1UANA 5DGXA 1PT6A 1WXXA 3WXMA 3WV5A 3HZZA 3RI3A 2VRBA 4QVGA 1QK5A 1Y3AA 2R6AA 4G8BA 5AKEA 4F60A 3IE1A 3DBHA 3D43A 1KSJA 3E82A 4L0CA 3IH5A 2QE7A 3NHZA 2QQ0A 4D9GA 1OZGA 5EAIA 1GDTA 1UBTS 3LCMA 4C14A 5IASA 1XHEA 2E21A 3NXKA 1R4MB 2BFNA 2JC3A 1ZA1A 2RHRA 3B1ZA 3HRKA 4CCYA 2XI4A 1QE5A 4RKEA 2C7QA 1UFVA 2QMEA 3QA9A 5J4VA 3ACCA 1YDEA 3JQ9A 3X1KA 3V4SA 3HHPA 3ZWMA 4UOZA 4EJMA 3EGDA 4KLAA 4YUXA 2ALJA 1R10A 3W78A 4AKIA 5DYWA 2VHQA 2YWFA 2Z5LA 4H15A 4YAUA 4WQMA 4XFKA 1OTXA 4PQFA 1II0A 3W9BA 5HIKA 2ZXEA 5DM0A 4DCVA 5EHXA 4BU0A 1VA5A 3TL6A 4KR6A 1YGPA 2ZB8A 2MU1A 4CIYA 4DA0A 1XZCA 4ZI2A 3O1JC 2ZYTX 3OUUA 4RPGA 2GKGA 3V97A 1GFWA 2AMJA 1RQPA 1DV1A 3AU8A 3H17A 1E9VA 3E1KA 4LQCA 1OIWA 4R83A 4RYLA 4F1KA 1H0KA 1P73A 2JGFA 2Q5OA 1EUZA 3R5JA 3SAJA 3U2QA 1CXZA 2G9RA 1OT5A 3OM1A 3PG5A 4LYGA 4ZMBA 4M38A 2FSVC 4FOOA 5JZSA 1Z13A 4YCJA 4PYJA 2GD6A 2WTBA 1W36C 2X4IA 5C7YA 1Z7EA 3IUMA 1E3WB 3Q0TA 1HTBA 4YIHA 2G40A 3QHAA 2LTAA 4G0VA 2EFDB 3GJ5A 1NUAA 3HSYA 2CWDA 2PL5A 4HEQA 3AR9A 4G4SO 2Z09A 1B00A 3LECA 1CDOA 3G49A 5CG1A 3K5WA 5KOYA 3GLIE 1AV6A 4JZKA 3L82B 1N6NA 1A8UA 1RZVA 2YBDA 3PQDA 3KLBA 2CMHA 1M6HA 1D2NA 3LQ1A 1JKIA 4GWGA 3DDWA 1XALA 3FW1A 4RD2A 1JL3A 1MC1A 3CRRA 3JQQA 4ZPJA 2G0TA 4BKOA 5KHOC 5MN6A 4LFBB 4B0PA 4MP6A 2H2GA 1DAFA 1DFIA 4TT3A 1SXJD 4LJ6A 5LN1A 1JU4A 4OQZA 2ZBVA 2ZWIA 5A4KA 2XOKD 4DRZA 1I3MA 2C78A 3M1IA 3DTVD 4IUCS 3VR5H 2ZT7A 3ILYA 2CDAA 2DBQA 3EDOA 1VYTA 3ZTWA 3R7WA 1E2BA 4TKVA 4RD1A 1BDBA 5TPZA 4ZDIA 4TL7A 3F8WA 5C7IO 1QZZA 3AV3A 1I6LA 2BDUA 4YO8A 1IDOA 1WPGA 4WJLA 4I2VA 3TN7A 3QELA 1Q3HA 3GLVA 4TYYA 4WX2B 3BK7A 2WUDA 2DQZA 1AS0A 3LL4A 3K8YA 4DIEA 3KC2A 5LCXA 4J29A 1E5TA 1WZEA 3IP5A 4GYKA 4QPZA 1XKXA 3EXIA 1U5CA 3TOSA 4PHTA 2QYSA 1LWOA 1VDMA 4OL0A 2BM0A 3W9YA 2RGXA 2NACA 3CONA 3A6PC 3O84A 3IUQA 5GZ1A 3WKCA 5F1OA 4WNAB 1CRQA 1B3BA 3DCNA 1L9XA 2I7TA 1A76A 3JQAA 2ZAGA 3G2NA 4ZEVA 3OD5A 5FLXA 2ADOA 4W5JA 4ZGBA 1KSGA 1N3BA 5TLSA 4HDRB 1VG9B 2VDMB 1GAJA 4B44A 4HJXA 1JN0A 1QLWA 3QE3A 1DCTA 1HKHA 1MIOA 1YI1A 2ZS7A 2C61A 3IA7A 1XCBA 1XEAA 1GSHA 1L6IA 2C88A 4K87A 4CMBA 4YMWA 4TRNA 2Q2VA 4JITA 5EIAA 3LRPA 3PLNA 2SECE 3BMQB 3M5DA 1KFEB 1P60A 1PNVA 2PQ6A 3AEKB 3DDHA 4XEUA 4GI5A 5CLHA 1DNPA 2WF5A 4F56A 2M9MA 2ZCVA 1B6RA 4H1HA 1EDDA 1WW3A 1EKXA 1ZL0A 5HA5A 2PX3A 4NBUA 4X7BA 2WY2D 1K98A 2O4UX 1IN4A 1I0ZA 2QGFA 1T0PA 3ZY6A 2ASVA 2FUEA 2X6QA 4DY6A 4Z2AA 1MB4A 2FXIA 3ADBA 1G9SA 1H22A 3L18A 1UMBA 3LK7A 3L77A 4ALNA 4E5PA 3QLUC 3CG4A 4G0ZA 4EF5A 5LQKA 5AW3A 2H0AA 2IHJA 2ZWAA 3C4QA 5CEEA 3KRTA 5DKFA 5J4YA 3FTPA 1LQUA 2DR3A 1L9KA 1ZGZA 4KN8A 3