2A1AA

Pkr kinase domain-eif2alpha complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
161
Chain Sequence
b'SHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
total genus 47
structure length 161
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a1aA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a1aA01
4DV3Q 2UXBQ 2I5LX 2K5HA 2BH8A 4DR1Q 4DV7L 3GTMH 2K75A 5BR8L 1RL2A 3PCOB 4DR2L 2ATWA 1VCIA 4GS3A 2B3GA 4P75A 4KHPL 1WCMG 1G51A 3EIVA 1IL2A 2I5MX 1K83H 5IYBH 1NE3A 2K4KA 4C3IH 3CCLA 1VQIA 3HOVH 3TS0A 4DKAC 5GQOA 4Y7NH 2EIFA 3A5UA 3AYHB 3UDFA 2ID0A 1XPUA 2QEXA 1HZCA 1FGUA 3J80i 3STBC 3G6EA 3RN2A 1OTCA 2NVQH 3CCQA 4DV7Q 1LUZA 3PO3H 4JYAL 2VQFL 2VS1A 1NBWA 4X65L 5LMNL 5BR8Q 3L2PA 3T1HQ 1YIJA 3CC2A 3CCEA 2A8VA 4B3RL 1KRSA 4HJ5A 3CCUA 2Z0SA 1H95A 5LMNW 4LF4Q 4KHPQ 1P16A 1Q82C 1A0IA 1Q1BA 4DV6L 1RIPA 4QJFA 5E7NA 3KFUA 1U5KA 3CCSA 2WP8J 2IX1A 2HQLA 4OWXB 2PNHA 1C0AA 1HNXL 2DUDA 1PHJA 1MKHA 3AFQA 1U0LA 2AKWB 3J81c 2IX0A 1I94Q 1FJGL 2R93H 4B3MQ 4DR5L 3S1NH 3A0JA 4JI6Q 1NTGA 4JYAQ 2VQFQ 4HIKA 2V1CC 4X65Q 2LSSA 5LMNQ 4OWWB 4B3RQ 3JAMc 2NVYH 2KHIA 5IWAL 5M5WH 3FKIH 3PO3G 1X54A 2K50A 4KLKA 4NXNQ 4DV6Q 2JE6I 2YTVA 1V9PA 1PVOA 4R4TA 1ASYA 4GLAC 3IRBA 4IPCA 1OXTA 4NB3A 3PIOA 4A3EH 3MEFA 1OXVA 3M4PA 3F2DA 2KHJA 3GDEA 1V1QA 2ZJPA 2VL6A 2JEAI 1QVFA 4POGA 4DV0L 3GO5A 4OWTB 1XTDA 3BZKA 4R4OA 3RZOH 1YHAA 3I7FA 2MFIA 1EIFA 3M3YH 4L5QA 1CKNA 3KF6A 5EAYA 2CCZA 1QZHA 2ZJQA 1L1OA 3ZJYC 4HIMA 3FP9A 4QY7A 5IWAQ 4H02A 1XPRA 3PUYA 4DR3L 4LFBL 3PUXA 2JK8A 4BY7H 2BA0A 4DAMA 2N3SA 1S72A 1YVCA 2Q2IA 4DK6C 3FKIG 3CPWA 1Q7YC 1HNWQ 1GD7A 3S17H 4LNQA 1BKBA 3K81C 1JJ2A 4R4CA 3CPFA 4A3FH 1VQKA 2KENA 2VUMH 3ICEA 1XNQL 1KXLA 1CSQA 4P74A 3SGIA 4DV0Q 1VQEA 4DK3C 5GADC 4A3EG 4WJ4A 3BJUA 4JI1L 3UE0A 4C3JH 3F1ZA 1HZAA 4X64Q 1KAWA 2WB1E 3HKSA 3CF5A 1AE3A 4YCUA 2KBNA 2DGYA 4DR3Q 5JJIA 1LYLA 4LFBQ 2OTJA 4JI0Q 3PO2H 4GN4B 2VNUD 5IP7H 4JCVE 1PH9A 3K8AA 1NY4A 3PUZA 1PV4A 4DPGA 1IBLQ 4JI2L 1UE7A 2Z6KA 2WAQG 2R6GA 4LF7L 1VS0A 2YYZA 3PF5A 2HT1A 2ZTEA 1XJVA 4BY7G 1TWFH 1XNQQ 1K8AC 1TWHH 3KF8B 4PZ6A 4LF9Q 3NBHB 2C35B 1W3SA 3K7UC 1HJPA 4O0AA 4JI1Q 5C4XH 4A3FG 2VUMG 4IOAA 4HIOA 1O7IA 3S14H 1WOCA 4IFDG 4LF5L 4A3BH 3W1BA 2ALYB 1TXYA 4R4QA 1VQDA 4JI4L 3D31A 2E2IH 1N33Q 1E22A 4A3LH 4OO1I 4JI2Q 4GOPB 4LF7Q 1A62A 1X3EA 2N78A 2A1AA 2RHSB 4AQYQ 5IP7G 3PO2G 3UDXA 3B6YA 3CMAA 2JEBI 5GAEC 2WAQE 5H1SE 5C44H 2K5VA 1MJEA 2PMZE 4P71A 1VQHA 1AE2A 4DUZQ 3KYHC 1B8AA 2B63H 2UUCL 1QUQB 3S1MH 4LF5Q 4K0KL 1VQJA 5C4XG 2I0QA 4JI4Q 2IHEA 1Q12A 4MZ9A 4APVA 1PH8A 1SROA 1KHIA 1A8VA 2CQOA 3H3VI 5M5XH 3T1HL 4GKKQ 1YZ7A 5LMUQ 1GO3E 1UEBA 4JI5L 4B3TQ 1GM5A 2Q2UA 2OTLA 4DV1L 4L5TA 4IFDJ 3W1GA 1NMGA 3F8TA 4DV5L 1VQOA 4LF4L 2F4VL 1X55A 3RR5A 4YHHL 5C44G 3PIPA 2UUCQ 4K0KQ 1N34L 5M5YH 1CKMA 3U50C 5IY0A 4GNXA 3NELA 4DUYL 4GNXB 1XMOQ 1Q81C 1I94L 3MXNB 3UDGA 4B3ML 2GVAA 4LFAQ 1UE5A 2JA8H 4HJAA 1YEZA 4JI6L 1G6PA 4RMFA 2NZOA 2IY5B 1Y1VH 3CP0A 3HOYG 4DR6Q 3G71A 4JI5Q 3EBEA 3HFZB 2UUAQ 4DV1Q 1BVSA 1IXRA 3A5ZB 1PYSB 4DV5Q 2F4VQ 4NXNL 3H15A 4YHHQ 3ULPA 4UP7A 4BBRH 4GKJQ 1SR3A 2E8GA 2QGQA 1N34Q 2HIXA 4JG2A 2KCMA 1Y14B 3W5OA 1NJIC 3ULLA 2OQ0A 4DUYQ 1YJ9A 1K3RA 3L7ZC 5IYBG 1D7QA 1PH6A 3F2BA 3HOVG 2CFMA 3CC4A 2E2JH 1TWAH 1YI2A 3L0OA 3S15H 2JA8G 2GN5A 1PH1A 4A4IA 1CUKA 4ME3A 1Y1VG 2UXCQ 3VDYA 4FDBA 3HOWH 3TEHB 4JI8L 2AHOB 1EWIA 1XMQL 4DR4Q 1M90C 4LFCQ 1HNWL 3PSIA 1SLJA 2CWPA 1SFOH 2UXDL 1Z47A 3M85A 4BBRG 1YZ6A 1E1TA 2FXQA 4LWCA 2BH2A 4A3DH 4JOIC 4UP8A 3KJOA 4NXML 1EQRA 4JBKA 2R93G 3J81i 1CKNB 3KF6B 3D0FA 4X64L 2VQEQ 1L1OB 4A3MH 1UWVA 2B29A 4B3SQ 3ERSX 4JI7L 1B7YB 4QIWE 2GVBA 4A3KH 4JI0L 2R7FA 3I4NH 1I3QH 5M3MH 3GD7A 1W2BA 1IZ6A 4JI8Q 3JAMi 1XMQQ 4UPAA 3AEVA 4LW1A 3UDIA 1KC8C 1IBLL 4IO9A 3I4OA 1XNRQ 2UXDQ 3HOWG 2AWOA 1X56A 1SN8A 2OCEA 1KD1C 4AIMA 1V43A 4LF9L 4BBSH 3HKZG 2MNAA 4JV5L 4NXMQ 3UE1A 2JJQA 1JJGA 4YWMA 1EQQA 3RN5A 1HR0Q 3AQQA 3DLLA 4IPHA 3T1YQ 4LF6L 4EQ5A 5IT9c 2UU9L 4JI7Q 3H3VH 4A3DG 3I56A 1VQ8A 2EQSA 5C4JH 3RLOA 2PQAA 2PQAB 2MO1A 4YCVA 3GTPH 1TWCH 4A3MG 1I6HH 2CWAA 5DLQE 2K5NA 4HJ9A 1N33L 1G291 2H5XA 4A3KG 2Q2HA 3I4NG 4QL5A 5M3MG 4AQYL 3M4OH 5ELNA 1PH7A 4BY1H 4JV5Q 2RF4A 2NVXH 2AMCB 2MQHA 2JQOA 4YWLA 3KJPA 4YY3Q 2AWNA 1Q8KA 2EXDA 2VW9A 3G4SA 4DUZL 4HJ7A 5JEAG 5AJ3L 2N49A 1S40A 1QVCA 1VQCA 1OXSC 1XPOA 2UU9Q 4LF6Q 4BA2I 4QGUA 4BBSG 1JMCA 4OO1G 3PF4A 4PZ8A 5GAGC 1VQGA 3WWVA 1PFSA 1MIUA 2PI2A 2ZTDA 1ASZA 1VQ7A 3CMEA 2R92H 3CW2C 1X3FA 3S1RH 2K14A 3HOXH 3J7A5 3PUWA 1VQLA 4HJ8A 4MNOA 1JT8A 1P8LA 2F3IA 1IYJB 5C0XI 1WFQA 1LTLA 1C7YA 5LMUL 3EN2A 4A3IH 3TRZA 2D0OA 4B3TL 4GKKL 4GLVB 4GN5A 4MTNA 2NZHA 4KI0A 4R4IA 1Q86C 5AJ3Q 1JJCB 4BY1G 4POFA 3S2DH 4AYBG 1VQNA 4A76A 3I55A 4X62L 1VQMA 4X6AH 2XTIA 4GN3B 1BBWA 1OXUA 2ZTCA 4PMWA 1XMOL 1M1KC 5HY6A 2Z6KC 3LGJA 4LFAL 4A3BG 2I5HA 1K9MC 4TQUS 5FJ8H 1PYBA 2E5LQ 2IT1A 3S16H 1UE1A 3K7AH 3J81j 2A19A 2R92G 1K73C 3H0GH 2IHFA 4PG3A 4DR6L 3HOXG 3ER0A 3KDFA 3GTOH 3HOZH 5JEAJ 3KDFB 1IBML 4A3LG 3KOJA 2UUAL 1GVPA 3BU2A 4PZ7A 1YJNA 2ASBA 4A3CH 2XGTA 3JC66 2UUBL 1JE5A 4A3IG 4GKJL 3J80c 2ES2A 4A93H 5C0XJ 3CCJA 4LUOA 3TS2A 3RLFA 1K0RA 4X62Q 4AYBE 3GTQH 2NVTH 4GOPC 3E9HA 2B63G 1OXXK 1VQ9A 3TREA 2HHHL 2JA6H 3F2CA 3CAMA 3S1QH 4JI3L 4BXXH 4A3GH 1HZ9A 4DR7L 2D62A 4WJ3M 2CKZB 4C3HH 5IYDH 1IBMQ 4TVAB 5IYCH 5FJ8G 5IE8A 2RHQB 2UUBQ 1NMFA 1CSPA 3H0GG 2L15A 2UXCL 3G48A 3S24A 3HOZG 3HOUH 2K52A 3E0EA 4OONA 2D0PA 4L5SA 4YCWA 4LFCL 4DR4L 4A3CG 5JJKA 2OWOA 2YTXA 5GAHC 4QQBX 1Q46A 4L5RC 2YTYA 4LF8L 1WJJA 2HHHQ 4A93G 2YU9H 4JI3Q 1EFWA 2JA7H 4DR7Q 1SE8A 4LUZA 4HIDA 1MJCA 1L2FA 1EYGA 4JOIA 1EIYB 1Q1EA 2VQEL 2JA6G 4BXXG 2MO0A 1I50H 4DR2Q 1JB7A 4NPSA 4B3SL 4A3GG 3NEMA 4R1JA 3PV0A 5IYDG 2HIVA 5IYCG 3I4MH 1BBUA 4DAYB 2LXKA 4GNXC 1N36L 1E7ZA 1XNRL 2WFWA 4DV4L 1C9OA 1KRTA 4LF8Q 1X3GA 4XIGS 4KHZA 3HOUG 4IOCA 3M9BA 5ELOA 4Y52H 5FLMH 3NENA 4IJHA 3U58A 1A63A 1R9TH 1HR0L 1SRUA 3T1YL 1YHQA 1TWGH 1KQSA 2E2HH 2VY3A 1YITA 2Q2TA 4C2MH 4X66L 2JA7G 5K36G 1X65A 1B70B 3PUVA 1HR0W 1HZBA 3BZCA 3K0XA 1VQPA 2JA5H 1LM0A 3STBD 2BA1A 4ALPA 3M4QA 1N36Q 1HNZL 1HH2P 2VZAA 5HGQA 1QZGA 1HNXQ 2JA9A 3U4VA 4DV4Q 1X9NA 1N8RC 4J15A 4OX9L 3OTOL 3I4MG 1FJGQ 3E9IA 2YV5A 1WI5A 2KCTA 4AH6A 3RLNA 5IP9H 4DR5Q 3GTKH 1AH9A 2WB1G 2OQKA 4YY3L 2Y0SG 4EX5A 1Z9FA 1Y1WH 1YHBA 1N32L 1D8LA 1VQAA 4A3JH 2ZM6L 1YJWA 3DM3A 1J5EL 4X66Q 5M3FH 5FLMG 3CCRA 5C3EH 2QA4A 3PGZA 4JBMA 1PH3A 3CCMA 1HNZQ 1EUJA 3RZDH 2JA5G 5J3BA 4OXPA 4P73A 3OTOQ 4OX9Q 3AFPA 3K80C 3GTLH 2PI2E 3A74A 3CD6A 5JJLA 1YNXA 4LUVA 3CC7A 4P72A 1L1OC 4JBJA 3ULJA 3CCVA 1VQFA 1N32Q 3HKZE 1I5FA 1FL0A 5IP9G 3Q8DA 2ZM6Q 1J5EQ 2R7ZH 3GTGH 4IJLA 3CXCA 2Y0SE 3CQZH 1N9WA 4DNIA 1VQ6A 1FVIA 1PA6A 1Y1WG 4YWKA 5C0XG 4A3JG 4DV2L 1E1OA 5M3FG 1KL9A 1VQ4A 3FHWA 1QVGA 2E5LL 5C3EG 1J6QA 3S2HH 2F52A 3KLWA 4IPGA 1PH4A 3M7NA 1K8GA 5GROA 4JBWA 1GKHA 2RCNA 1E24A 1L0WA 3I2ZA 1X6OA 4O2DA 1CKOA 3GTJH 1VQBA 1DGSA 4XTCS 4IPDA 4UP9A 1IBKL 5FLXc 4DV2Q 1SMXA 2R7ZG 3OYYA 4JC0A 4A75A 2NN6G 4BA1I 4DV3L 2UXBL 4GOPA 4GLXA 4IFDI 3TQYA 4DR1L 3RNUA 1PH5A 2ZJRA 1WCMH 2NN6I 3U4ZA 3J7ZC 1T9HA 1EOVA 1KIXA 1WYDA 4UY8C 1E3PA 1QUQA 1VQ5A 4RG1A 1UE6A 1PH2A 1YBYA 1IBKQ 1S3OA 2LXJA 3OW2A 2N8NA 2R7DA 3HOYH
chains in the Genus database with same CATH superfamily
4DL2A 5IGBA 8ICQA 4NWIA 2I5LX 2FJ2A 3RZDB 1TIID 2RQ5A 2BH8A 1RODA 4IR9A 3GTMH 4C1NI 3TN2A 1WTPA 4QW9A 1D5ZC 2HUGA 1NUCA 2KTQA 4LZDA 2K75A 3ERQA 3T3FA 5HHIA 4F4XA 3LWLA 1L3VA 4QWBA 1GXDC 1T8EA 1F9PA 5ALMA 2I5MX 4QW8A 5HR6A 1J9OA 1XTCD 4C3IH 3GTGB 3QNMA 1AZPA 4X5VA 2JH1A 4J6HA 3HOVH 5C3XA 4DFKA 2MU2A 2RKSA 3STBC 2BCVA 3G6EA 2KFZA 4FE3A 1DXMA 5KFTA 4DV7Q 2HHXA 1XO0A 2NTTA 1U4RA 1Z7TA 2OXPA 1HUZA 3PO3H 3JPRA 3HW8A 2VQFL 1UA1A 3L2PA 2LM1A 1JOOA 5LMNL 1YIJA 3CCEA 3S9WA 2BDUA 4EELA 1SYBA 2B21A 3I1YA 1H95A 5LMNW 4KHPQ 1P16A 4YQWA 5L1JA 4DV6L 1TY2A 7ICKA 5E7NA 2I6XA 4QJFB 2HQLA 4NM1A 2ENBA 3AFQA 5HGTA 5KEEA 8ICFA 4OJLA 3AUOA 3QO2A 2N55A 3ONNA 4B3TQ 4C3IG 4B3MQ 5NUCA 3S16B 4C4TA 9ICSA 5KFPA 5KFJA 3A0JA 3K7AB 3SEIA 4X65Q 3UPQA 1S10A 2KE7A 4UAUA 3C28A 8ICNA 1B3QA 4H13C 4F88A 5DM63 1CRXA 4G3IA 5IWAL 3FKIH 4ECVA 3RRHA 3PO3G 5J29A 4RGOS 4KLKA 1V97A 3PSTA 1F9RA 5E4WC 1S97A 2B2VC 4JUZA 1B0XA 3GIIA 2A6ED 4R4TA 4RPYA 2XGQA 4NB3A 4A3EH 3MEFA 8ICSA 3ZDEA 4DK1A 3V6HA 2JRZA 4ZH4A 4POGA 5AM3A 7ICEA 4OWTB 3HP6A 3BZKA 2P5ZX 2D8CA 3M3YH 1Y69U 3IP4B 4I65A 4CKBA 3M8RA 1PRTD 2KEDA 2HHWA 1XPRA 2JXMB 3ZI4A 1I4GA 3T53B 2NYVA 1V38A 2JK8A 4LFBL 2N88A 4BY7H 2N3SA 1S72A 3HOUB 5EPLA 2JGAA 3FKIG 1QG7A 4C3IB 4IQVA 2KV2A 3K81C 1LT4D 2DY7A 2PI4A 1WTHA 2EDGA 3ZD9A 1ZQFA 1XNQL 4Z6CA 8ICVA 1JQYD 3SGIA 3GIKA 4KTQA 3T5JA 5EJWA 4A3EG 4OO1H 3MFGA 1RJTA 2WB1F 1HZAA 4X64Q 2WB1E 2KSOB 4YCUA 1KAAA 3C21A 4DL4A 3NASA 4ZOHC 4DR3Q 1LYLA 2E1FA 3M6ZA 4QWDA 5JJIA 3BJYA 3M7DA 2HBLA 3PO2H 4GN4B 1RDFA 2VNUD 2L4NA 1EYAA 1YNNC 1PV4A 4R63A 3C2PA 3MDAA 2R6GA 5KT4A 4DSLA 1VS0A 5J0WA 4BY7G 3K1RB 2BPCA 1TWHH 1VF7A 5KFCA 3AM9A 1ZQLA 4UW9A 3JPQA 2KICA 1BF4A 1HJPA 2J6UA 5C4XH 1V1PA 2G07A 2IJ0A 2K8BB 4EYHB 3P1HA 3PMNA 3S14H 2E2HB 4GXIA 2OM6A 2ZIVB 5ALIA 1X3QA 1PVQA 3FKIB 2NO5A 2RQXA 3JAME 2J0TD 2F44A 4O3RA 1VQDA 2D2CC 2F0MA 1HA6A 5JVH3 4UAWA 2E2IH 1N33Q 1LLRD 5DEHA 4JI2Q 2I9GA 1EYDA 1X3EA 1S8OA 5JPMC 2A1AA 1EY7A 2RHSB 4AQYQ 3PO2G 1SBBB 3CMAA 4YN4A 1Y8PB 2JEBI 5AKJA 2XRQD 4ZUIA 1L3TA 5C5LA 4BX9C 5J2AA 4DL3A 1AE2A 4DUZQ 1RG6A 1B8AA 4O3NA 2B63H 2UUCL 1QUQB 4Y2UA 3KHGA 9ICFA 7ICHA 2LYBA 5C4XG 3HWTA 3N7SC 4APVA 4BY7B 1TV9A 1KHIA 2Y0SC 2Y9UA 4A3FB 3RB0A 2F03A 1ZXTA 2RRDA 4DGZA 2KKVA 1NNLA 5FO9B 4GKKQ 1YZ7A 5ALPA 1GM5A 3KZIU 1DYQA 1ICFB 3M4YA 4DV1L 2OF1A 1VQOA 2F4VL 4MFCA 4X3UA 2FMSA 3SI8A 1Y8OB 2WV6D 3URYA 4CF3A 3CQZB 3U50C 1J8IA 3LVWA 1AN8A 1LKYA 1XMOQ 1I94L 4HAIA 3PO2B 1O78A 3HPOA 3UDGA 2Z4HA 2GVAA 4LFAQ 2JA8H 2NV3A 3RF9A 2F0GA 3KFUF 2NZOA 3HOYG 3TAPA 1JX4A 2VIXA 4JI5Q 4I7ZC 4RGMA 1ZJMA 1KDHA 5BN5A 1SV4A 4R8UA 1SYEA 3A5ZB 4IUUA 2WIIB 3VCBA 5C4XB 2F8LA 4RQ8A 2HQEA 4KLUA 1TAQA 1ZQSA 4BBRH 4GKJQ 2QGQA 1N34Q 3S14B 2KCMA 2ZT9C 1K28A 3W5OA 4X3TA 4DUYQ 4MFAA 5IYBG 4KX3A 1LABA 1D7QA 4PGXA 2RHFA 2EOTA 2M2LA 2F3WA 3FVQA 4KV6A 4RQ2A 2AU0A 2YU9B 1XWLA 3V72A 3TACB 1TWAH 3SXHA 5IGCA 3S15H 4PZNA 1H38A 2K5QA 4CBVA 3CP8A 2JA8G 2ZJ8A 3MFIA 4I2IA 2J4XA 2E8NA 4RKBA 4ME3A 3VDYA 3TEHB 2AHOB 1EWIA 2XIWA 2CWPA 2UXDL 1Z47A 5HMMA 1BPYA 4BBRG 1TK0A 3HOYB 2HI0A 2W8LA 1E1TA 2MJ8A 3FAHA 7ICRA 5BOLA 2ZXOA 4LWCA 4R65A 3LK9A 4KD3A 1EQRA 5J2IA 4JBKA 4IUVA 1X2IA 1X9WA 1UCVA 3WKAA 2YB4A 3SAHA 3D0FA 2VQEQ 1FR3A 5KFZA 1S0OA 1NKCA 1IW7D 4A3KH 2F0NA 2R7FA 3A0HU 5M3MH 2K05A 5ELBA 4QWEA 1VLBA 1K83B 1EQVA 2A3VA 3UDIA 1KC8C 4YMOA 1KBUA 1XSPA 5HMLA 4K4HA 1GOZA 4Y7NB 2NZ1D 2JMGA 3RH4A 2HOQA 1JXLA 3B0XA 2OCEA 2FMPA 3OSNA 5JEAH 1UEAB 1V43A 4BBSH 4DF8A 2FINB 1TY0A 4NXMQ 5J2HA 1ZQBA 4K8JA 2JJQA 2M9VA 1PFNA 3AQQA 3DLLA 4BWMA 5C0XH 3J81L 5ALZA 1TE2A 4JI7Q 1VQ8A 5C4JH 2PQAA 3NUCA 4PHPA 2MO1A 4YCVA 2XY5A 4RA8A 1PXUA 2CWAA 5DLQE 2W9MA 4BBRB 3RTVA 5KNDA 3MBYA 4A3KG 1DRGA 4RHRA 4FS1A 2X69A 5GTIU 5J0QA 4LJXA 5M3MG 3IRUA 1X9SA 3M4OH 2QDLA 5ELNA 2CN1A 3OSPA 4JV5Q 2P35A 3S1NB 2MQHA 2KVCA 3G4SA 4HJ7A 4DNTB 2G06A 1BCPB 5JEAG 5AJ3L 3HKZF 2KHQA 1OXSC 2HBJA 2UU9Q 4BBSG 1RXWA 2FPLA 5M5WB 1BQQT 1PFSA 1ASZA 3A0BU 2FI1A 3RRGA 4KN4C 1VMPA 1JT8A 1X42A 4C7YA 2JEIA 1DD2A 4ME5A 5A2QL 1HTLD 1C7YA 2NRTA 1ZQTA 1WFQA 4P0PA 5J0YA 2K1BA 3NE5B 4OELB 4YP3A 2C28A 4MTNA 3SV3A 4QZFA 3WK9A 4N8X1 4R4IA 1H9RA 2AGOA 2L9HA 4POFA 1QCBD 4EEKA 4XDXA 4KLIA 3I55A 3N28A 5KAFU 4X62L 3FPPA 1A3VA 5I4DA 1VQMA 1ZQHA 3ICXA 1BBWA 4Q8EA 2IPKD 1M1KC 5M3MB 5ALQA 2LMCB 4DOAA 2JXJA 1K9MC 4YCXA 4O3PA 3WKEA 7ICUA 2O2LD 2W7OA 2KJXA 5G3LF 3H0GH 1NK7A 5TSSA 5ELCA 3E5SA 3ER0A 3ALRA 3HOZH 1ZYQA 1K0SA 3VYUA 1X32A 3KOJA 4PZ7A 1YJNA 5KG3A 5KT2A 4UQGA 1NJZA 4RNOA 2EZYA 3JC66 4B9UA 3UM9A 3NPPA 4BWGB 3EVQA 2K4HA 2VA8A 3NVYA 1N62A 4GOPC 2NVTH 1LKYB 4ZYSA 1Z19A 2B39A 5IGGA 3I90A 3ED5A 2BCQA 2L55A 2XGPA 3F2CA 3S1QH 3K58A 4DR7L 4KLSA 2NRZA 2D62A 4CDEC 5KFBA 4B9TA 2CKZB 4QZIA 9ICMA 3ONAB 5D46A 1UAPA 1LTSD 5EGTA 2UUBQ 4R8UB 1B22A 3LX0A 3H0GG 2UXCL 5DQGA 3NWTA 4O3MA 3HOZG 1WG8A 3KBGA 3PW5A 3E0EA 4OONA 3H6MA 4YCWA 4KX5A 3RR7A 4LFCL 4QQBX 1IW7C 2E75C 2YTYA 4YR2A 1O03A 2YU9H 1E2ZA 3VC8A 4ECQA 2AUJD 1EFWA 2JA7H 1PK1B 1STYA 4KN7C 1B44D 8ICHA 1Q1EA 7ICQA 3K57A 1FFUA 4B3SL 3SD7A 2MUTA 4F2SA 2RDJA 1V8QA 3U9SA 1ZQXA 3ND8A 2CH4A 3OGUA 2GO7A 2XI9A 3MVVA 1LTID 2ZXPA 4IS7A 4RT2A 4M47A 3TP8A 5KG1A 4IOCA 5J0UA 4I2DA 5ELOA 1T94A 1QB5D 5FLMH 3NENA 4F71A 4LZGA 1C20A 5KFUA 4F4WA 2F0VA 1J2MA 3H0GB 2DF4B 1ZJNA 5F3XB 5KFEA 2JA7G 3ISBA 2RVLA 4C2MH 4B9MA 3UMGA 1ZETA 4KLFA 2JA5H 3K0XA 1EY5A 5AHXA 5KAIU 1N56A 5KFAA 2KNJA 3I72A 1UHUA 4DQIA 3K5OA 3LWEA 3O13A 3D2SA 1HNXQ 3TFSA 2JA9A 4DV4Q 5CV5A 1ZKOA 1B2TA 1CZWA 2NVTB 4XYOA 2KK0A 1RHPA 1U47A 2F1IA 1ESFA 1WI5A 2H3ZA 2KCTA 5FOBB 4QCLA 1AH9A 3NTKA 4YY3L 2Y0SG 1T3QA 3GV5B 7ICSA 4J1MA 1YJWA 3HZXA 4X66Q 5FLMG 4Y2TA 3NVWA 1SL2A 4RU9A 3AN1A 1XWEA 3PGZA 2PO4A 4JBMA 2BHNA 2JA5G 2PI2A 1S5BD 5J3BA 3T13A 4R66A 3D3RA 1V85A 4KN4A 3UMBA 2IWHA 3CD6A 4FVMA 5EE1A 2KEYA 1NK8A 1L1OC 4BS9A 1M8AA 4NKLA 4XYQA 5M9OA 4G7ZC 3QU4A 2JA7B 2N1RA 2DBYA 5H2FU 4BDPA 1FL0A 4J9RA 1J5EQ 2FFKB 2W43A 4X3KA 5KG2A 4ZAIA 4DNIA 1FVIA 4GXKA 1KTKA 3BDLA 4WRDA 1NCVA 4KKSA 1E1OA 3M7GA 4U6PA 4EQPA 1VQ4A 2DNEA 5IIFA 3SMVA 5DG9A 8ICKA 2LI6A 2F52A 2Y0SB 3TFRA 1URJA 4LK1C 3TP6A 4IC9A 9ICPA 3NBHA 4ED6A 5KFOA 3J81E 3CRXA 5TISU 2NB0A 3H91A 4YR0A 1KSPA 2JEFA 2F0EA 1X6OA 4TQSA 3D2NA 4IL6U 3PY8A 4F4KA 2MRLA 3SK4A 1A6XA 4MTKA 3SEBA 1XO1A 5CV8A 4IPDA 3HJEA 2XY6A 2JA5B 1JWMD 1T4GA 3VR5A 3QZ8A 4JC0A 4O3OA 2BOSA 3THVA 4NLGA 4GOPA 4HMIA 5AI5A 4L63B 3A8IE 2R18A 3ETLA 4KLGA 1KFTA 3H40A 2F1MA 2NN6I 3U4ZA 4FXKC 3J7ZC 3QEAZ 1A15A 3Q8SB 3VYRA 2HHSA 1KIXA 2FMMA 4UY8C 3RAXA 5C44H 2A69D 1QQ6A 2A73B 4FO2A 3ZDBA 1S3OA 2M9NA 2N8NA 2CW0C 1TWCB 5ALRA 2DY8A 3HKZC 2R7DA 5AKXA 4DV3Q 5FO7B 4F4YA 3PW4A 4MEYA 1MSHA 4DV7L 2RSNA 4P0QA 4ZRZA 1JICA 4C56C 3WU2U 1Q8IA 5J8YC 4RKLA 4KN7A 3JPTA 2ATWA 4UHVA 4FF2A 2ES6A 4KHPL 2XIDA 5JTIA 3EIVA 1IL2A 1NE3A 5KFIA 5KG5A 2HBKA 4QZCA 4OD0A 3RJIA 5AKIA 1EXNA 1FD7D 3TBIB 4DKAC 3A5UA 1G91A 1XPUA 4M8AA 4ZK9B 1IKMA 4ECWA 1HZCA 1FGUA 3MXNA 4O1NA 3HOXB 2FPKA 3E6ZX 3DEPA 3CCQA 5KFVA 1LUZA 1NBWA 3SR6A 4X65L 4H0LC 2LY7A 5BR8Q 4NLKA 2A8VA 4FO6A 1L5UA 2Z0SA 3WKDA 2MUTB 2R8IA 4LF4Q 2GOLA 2XC9A 1Q82C 1A77A 1Q1BA 1RIPA 4WFN3 2P66A 4XA5A 5ALFA 4QJFA 5EPKA 4UARA 1U5KA 2JYOA 3KFUA 1A3TA 3KHRA 4CGYB 1C0AA 1TS3A 3NRWA 5CJ7A 2DUDA 2YMPA 1U0LA 2W8KA 5L37A 3J81c 1FJGL 2R93H 3DUZA 4DR5L 1NK6A 2UVWA 4J9OA 3F2UA 4OJ6A 3J80L 4PJ0U 2RDIA 2R8KA 1NTGA 4JI6Q 3PNCA 4OWWB 1UT8A 4B3RQ 3G7LA 1R4QB 1RTNA 2NVYH 4ZKBB 1K3BC 1X54A 3ORYA 2K50A 4HSVA 1H9MA 1V9PA 4PH5A 3Q23A 3HEJA 4K2LA 1SNMA 4CDCC 1BPZA 5I2XA 1KLGD 2FDRA 2NWGA 4GLAC 3IRBA 4OHJA 2W11A 1OXTA 1HHVA 5KT7A 4XUSA 2UVRA 3M4PA 3OPOA 3WK6A 2KHJA 3GDEA 2ZXIA 2KOBA 2C22A 3VYSA 3H8MA 2MFIA 4L5QA 4Q5VA 3KF6A 2ZJQA 4C3HB 2HHTA 1L1OA 3LNNA 5AKLA 5KG6A 1I4QA 1LT5D 1WWUA 3NTIA 2H1EA 5FO8B 2IBKA 4K2KA 4DR3L 5ALLA 9ICCA 4PPXA 3PUXA 4KJOA 2FLPA 3R93A 2Q2IA 3CPWA 1HNWQ 1GD7A 3S17H 1BKBA 3DWAA 3NK9A 1D2BA 4A3FH 1VQKA 3C46A 2VUMH 3AQEA 3H0RB 1KXLA 4P74A 3JPPA 2LYAA 2QCPX 4DK3C 4KLOA 2E8OA 4IFDH 2K03A 5IILA 3BJUA 1KLUD 1K8OA 1ZRMA 1RYSA 1PTOC 3F1ZA 3TP5A 3UE0A 1TAMA 4C3JH 3FRPB 1AE3A 2KBNA 1NAPA 4ZKCB 2DGYA 3ISCA 3PO5A 2OTJA 5AKZA 4DA2A 1QNKA 2B0CA 4Q45A 2EJMA 4NDXA 3K8AA 1NY4A 2WF7A 3A7AB 5KNBA 2WFAA 2EYHA 1WTRA 4RNNA 4ED3A 1IBLQ 4JI2L 1UE7A 2Z6KA 2F76X 4G9BA 2SNMA 2WB1B 3EROA 2HT1A 1S0VA 4ODGA 1XJVA 4U7CA 3G6XA 4K4GA 1HIWA 3QIAA 4ZUJA 4K5XA 4PZ6A 2K5DA 4DF7A 2FLNA 2LMRA 3NBHB 3I76A 4LF9Q 1W3SA 2EJFC 3K7UC 1MN8A 4A3FG 4YD2A 2A68C 2VUMG 3NUQA 4IOAA 4ECUA 1LACA 1VF5C 9ICJA 8ICAA 4IFDG 4QZGA 3MGVA 4A3BH 4F3OA 3LDAA 2ALYB 1EZ8A 4C3JG 1K5OA 1SNOA 2QARA 3D31A 1V1OA 3C1EA 8ICBA 4GOPB 4LF7Q 1A62A 1NR2A 5EQ0A 3NVVA 1I6VC 3WK5A 1X9MA 2N78A 4Y2VA 2ISOA 5CA7A 2QB1A 4C80A 1U9LA 5CHGA 1PRTF 5CORA 1LT6D 3OTQA 4Z6FA 1STHA 3AU7A 2PMZF 5FK9C 1LTAD 2PMZE 4DL6A 1SXEA 2K4EA 3FYHA 2WHEA 5J8YA 5ELDA 2DPIA 3SK6A 1Y1WB 4A3JB 1XYIA 4MF2A 4F93B 4RGTA 1OXJA 4KLLA 2ZXHA 1TK8A 1CFMA 3TDQA 3V2TA 1DZ1A 4C1NK 5C3EB 2NTSA 2ASJA 4BUGA 4MZ9A 1PH8A 1K1SA 1ZD5A 1Q3LA 4QZDA 4DL5A 2KJ8A 2V4RA 4ECSA 2AH5A 2G08A 7ICIA 5GTHU 5E4XA 2HMXA 4TUPA 4P0QB 2AUKA 4F92B 3T1HL 5LMUQ 1OO9B 2KECA 3KHLA 1PUZA 3MGHA 4M2YA 1CQFA 2PI5A 1D5MC 2E74C 2HDMA 4DK0A 4XXEA 2Q2UA 1KDAA 3W1GA 4J9MA 3F8TA 1TS5A 4C3JB 2ASLA 1ZQZA 1LTGD 2FMQA 3RR5A 5ALHA 5C44G 2R7ZB 1EY9A 1N34L 4M9LA 3D6CA 3NQTA 4DUYL 2JSOA 1Q81C 5C6AA 2C5CA 4EX7A 3BYTB 2EYLA 3L3OC 3MXNB 3OIQA 2DPJA 1L6NA 1YEZA 4HJAA 3M6KA 2BZFA 1Y1VH 1Q3UA 4DR6Q 1QQ7A 3D4RA 2W9CA 3EBEA 3HFZB 4X3SA 4CCHA 4R8IA 3SZ2A 2UUAQ 1SGGA 1PYSB 1JI7A 4NXNL 4I29A 1NSNS 3MAQA 3PW2A 3MR2A 1SR3A 3GTJB 2BE5D 4WORA 3U26A 4JG2A 1LTTD 1Y14B 2K33A 2MSNA 3UI2A 1YJ9A 4LAAA 1LTRD 5KFQA 4TURA 4O5CA 5JAVA 3HOVG 9ICOA 2EDUA 5DAUA 4DS4A 2E2JH 3L0OA 1IIPA 5ALUA 4F5QA 3NP8A 3T56B 1ZQJA 4KITB 5J0SA 3TQ1A 1MHWC 1U4PA 1A3UA 2B2UC 4N9PA 1CA6A 9ICRA 1X6JA 2BCOA 2A1JA 2JH7A 4O0IA 7ICMA 1Y1VG 1FIQA 1BUVT 4FDBA 3HOWH 1EEFD 1N60A 1ENAA 4DR4Q 1SSOA 3PSIA 3H8WA 1SLJA 1S4ZA 1C48A 5J0RA 9ICGA 4I2HA 3M85A 1YNJC 3BQ7A 3RB6A 3RJKA 4XRHA 1LT3D 3C1ZA 5B5EU 4Y2YA 1BR9A 4JOIC 1PLFA 4UP8A 2LBOA 4GZYC 5DQIA 5EKKA 4NXML 5EOZA 3GTMB 5KG0A 3J81i 1SWWA 3KF6B 3RJFA 3TZDA 1L1OB 3RD4A 9ICWA 1UWVA 1ZD3A 3ETRA 1HXYD 3G6VA 3EYZA 2B29A 4QIWF 2H4OA 3ERSX 4QIWE 3W2DA 3Q0AA 1WD0A 4JI0L 1ZQMA 3I4NH 1NJYA 1W2BA 1IZ6A 3V7LA 4JI8Q 1XMQQ 1UUPA 4GC7A 5ALNA 4UPAA 2B2TC 3HOVB 2R61A 3TAQA 2FHTA 3J80E 3HOWG 2PFOA 1KD1C 2V4DA 4AIMA 4JV5L 3HGBA 3M9MB 3HKZG 1F44A 5A35A 3PO3B 1JJGA 4TUQA 1UNSA 1EQQA 1NK4A 4ECRA 5DB6A 1D8BA 1JWSD 1JIHA 2UU9L 2GA4B 5KFWA 4BGDA 4DAPA 4DCCA 4MEXA 4YXJA 1K8MA 4NP5A 2KN7A 3AB9A 4EVOA 2KHSA 2PQEA 3GTPH 1I6HH 1HQMC 2K5NA 3DWPA 2RBMA 4KK7A 4F8MA 3L9AX 4M9HA 3I4NG 4UB1A 2AQ1B 4RQNA 1SXDA 5ALYA 2BQUA 1TR5A 5HR7A 4F4ZA 2IMWP 1PH7A 4BY1H 1VJ5A 5KFMA 2AMCB 3MZ5A 2JQOA 2Q8TA 4PNYA 1JB3A 4I2CA 1XPOA 1VQCA 5IIJA 1RD9D 3TI0A 3M9OB 3KLRA 3PQIA 1JMCA 4OO1G 2A6HD 4PZ8A 1EY6A 5DNFA 5GAGC 3PF4A 3R2TA 3VA5A 2E8PA 8ICOA 3IHQB 5AFWA 1VQ7A 4JI5L 3Q8KA 2QARB 3Q8QB 3HRZC 5DB7A 2Y1JA 2ATLA 3D6WA 1VQLA 4MNOA 5EKIA 5HNKA 3HKZB 4A3EB 5I6YA 1NK0A 1IYJB 4KKTA 5ALWA 3EN2A 3TRZA 1KQQA 3CHBD 4GN5A 5E3FA 5COYA 4HSPA 2KG5A 4FF4A 3M3YB 4XT1B 2ZUCA 5DGBA 4CRXA 1I4RA 3DEOA 2QDBA 1PZJD 3P20A 2EY1A 4BY1G 2DQNB 1BXTA 4RAUC 2ZIUA 1EY4A 2CXYA 4Z6DA 1PMRA 4X6AH 4PMWA 4YG2A 5J2FA 4DSEA 1OXUA 4KHVA 5HHHA 3I4NB 3LWMA 4PQXA 5CR3A 5BPCA 1HRJA 2IL8A 3B0YA 4YMMA 4EZ6A 4OJOA 1PYBA 1ENFA 1STBA 1UE1A 5J0TA 4RT3A 1RQLA 3J81j 3MFHA 2VB2X 1TS2A 5ALKA 1XNSA 1EQTA 2EANA 5EE9A 3GTOH 5J0OA 4Z9CB 1PTOH 2JHDA 3MXGA 5K5PA 2ASBA 3T4AC 4A3CH 2UUBL 4J9NA 1EOTA 1XC9A 2KQ3A 9ICKA 4DEZA 4IUPA 2C2DA 3J80c 3DDHA 1PFBA 2ES2A 1Z00B 1BNOA 2R8JA 3RH6A 3TMEA 3H8JA 4AYBF 4AYBE 3GTQH 2W55A 1SKWA 2UVVA 2AQ3B 2B63G 1ZQNA 1OXXK 3GTPB 2JA6H 2A6EC 4BXXH 9ICEA 1SNDA 3HG9A 4A3GH 1HZ9A 1YT3A 5C3WA 8ICMA 3PVXA 4TVAB 5IYCH 2W9CB 1TWHB 1DOKA 4BY1B 4F2RA 4NL9C 2HHUA 1NMFA 2B2UA 3G48A 1ILPA 2L5YA 2IOFA 7ICTA 2K52A 2RP5A 2KMDA 1F77A 1PRTC 2D0PA 4JV0A 3SDZA 4A3CG 2B2VA 2OWOA 1VDVA 2PMZC 2YTXA 4FXGC 4ULLA 2G5IB 4N8FA 1Q90A 1D5XC 2JV3A 2F0LA 2WF5A 2HHHQ 3SYZA 2E2IB 3P7JA 4JI3Q 1ZQYA 1PK1A 4DF4A 1SE8A 1MQ2A 3EQLC 2WKDA 2ODGA 4JOIA 1OW5A 1JUDA 1PVRA 3QEBZ 2JA6G 4BXXG 1CT1D 5IIKA 4A3GG 4DQSA 1RKNA 1GUWA 3NEMA 5KRUA 2A1JB 5ELFA 3T5KA 3M1YA 2HIVA 5IYCG 3I4MH 7ICLA 5KYIA 2B63B 5DDYA 5EWEA 4GNXC 3UQ0A 2K89A 2XO7A 1XNRL 3EWAA 4DV4L 2PYKA 1C9OA 1XSNA 5FKAC 4LF8Q 4XIGS 4PZOA 1COOA 1KABA 1U4MA 3WOEA 1SEBD 3M9BA 5KFXA 4CJ1B 2BCRA 1A63A 3GIMA 1R9TH 1HR0L 1SRUA 1KRPA 1F9SA 3T1YL 1YHQA 3V7JA 3WK4A 4K6LA 2Q2TA 4X66L 1WCNA 1X65A 1HR0W 4UAVA 4RH6A 3SVMA 4ALPA 3M4QA 4N9TA 1N36Q 1BPDA 1SE2A 2HVHA 4F87A 2WKCA 3OW7A 8ICTA 1CA5A 2PFNA 3U4VA 1X9NA 4NLNA 3DHQA 3I4MG 2YV5A 5JUMA 3GILA 2EXZA 5LL6S 3RLNA 2IA6A 2JA6B 3GTKH 2JA8B 2OQKA 1SYDA 3OPXA 4A3GB 4HYKA 4DXFA 1HFGA 5ALVA 5AI6A 4NY8A 1J5EL 1QNUA 4RUAA 3QUQA 5M3FH 4IRCA 2FJ6A 9ICAA 4R9WA 1U4BA 2BQ3A 3JPOA 1HNZQ 4ILWA 4KY6A 4ABNA 2JZBA 2LS01 2Z1CA 1MIUA 3D8GA 2Z7JA 4OX9Q 3OTOQ 2MGSA 1QSYA 1L7OA 8ICEA 1SMYD 2B8FA 3AFPA 5EWGA 2PI2E 4ED1A 2C2EA 4JV2A 3A74A 3CC7A 4P72A 5AI9A 4JBJA 1TWAB 2EYOA 3S15B 3K75D 2DGZA 3RB4A 5DQHA 3K5MA 3HKZE 4C7ZA 1I5FA 3MEHA 2ZM6Q 1N32Q 5IIIA 1HQRD 2XN9C 3PZPA 2HDLA 1CM9A 3CXCA 2K7VA 2VXWA 1TT2A 4US8A 3BVZA 5C0XG 3I4MB 4J9PA 2QB0A 5M3FG 2CHBD 2E5LL 3ZDAA 4QIWC 3I73A 3QR8A 1Z1BA 2V9WA 4DL7A 3S2HH 4H7BA 3FC4A 3KF8A 3PIO3 1K8GA 4RCNA 1DONA 4JBWA 2SDFA 4KLDA 1GKHA 3L3FX 4RWSC 1B43A 4J9QA 3PV8A 1O7YA 4DFDA 3I2ZA 4O2DA 5AI8A 2AGQA 2ZUDA 2IHMA 4C8OA 4JV1A 1VQBA 2E2DC 2ZIUB 2KP7A 3K1ZA 3IFTA 2D9UA 3IFDA 4UP9A 3T51B 4A3KB 3OMCA 5KNCA 1D1IA 2CPRA 3Q22A 1JCKB 5ISRA 9ICXA 3BS5A 2G9HD 4DV3L 1ECWA 5ELEA 4IFDI 3J7AV 5IT9L 4V0BA 4PGYA 1PH5A 4YFKA 1WCMH 3N52A 4F5OA 2G0AA 4BBSB 2W9AA 1WYDA 2VJ4A 4QB4A 4NL9A 1IG6A 3TKAA 1VQ5A 5AKKA 2CVRA 1PH2A 5EPJA 5M3FB 5C4JB 2DKXA 1IBKQ 3GU3A 3PX4A 5JU5A 3OW2A 5IIMA 5KYLA 4XQJA 1ZQRA 2UXBQ 4UASA 3HP3A 2F1HA 3KKAC 1L3UA 5DB9A 4J9SA 1T5XD 2K32A 5CV4A 3PW7A 1IM4A 2XRSD 3M4OB 2Q4TA 4P2HA 4EYIB 4LMQD 5BR8L 3SK8A 1RL2A 1EFID 4DR2L 4KKUA 1MD2D 3QU2A 1NJXA 2YMQA 1O80A 1WCMG 1G51A 4CE6A 2K4KA 5AI4A 5KFNA 1MI2A 1TKWB 1WTWA 3CCLA 4M9GA 2EY2A 2ICEC 1ENCA 2ID0A 3UDFA 2QEXA 2WINB 3VA7A 1JWUD 2BPGA 3J80i 5KFHA 1G2SA 3U9OA 2IW3A 2NVQH 2WF8A 2FMCA 5EBDA 2EZXA 2VS1A 3A55A 3CC2A 3MA2B 2KCNA 3NS1A 4B3RL 1KRSA 4HJ5A 2DNCA 1O08A 2VKQA 4DFPA 4C8LA 2K6AA 2RDFA 3HS0C 4QUCA 1SB3C 3A54A 2EJGC 4CGZA 4YIJA 3CCSA 2ZXRA 4OWXB 2EY6A 2W3RA 1PTOF 1CK1A 1WWVA 3H4BA 1KFSA 1D9DA 2AKWB 2IX0A 1I94Q 3KBXA 9ICLA 1TVXA 3SK5A 4FZMA 2F4IA 1ZYRD 4UB8U 2O5IC 1CTMA 1NR4A 2F0OA 1FO4A 4JYAQ 4AYBC 4HIKA 2V1CC 2LSSA 3QUTA 4PMCA 4F91B 3HOZB 4C8NA 2PXIA 1ZQVA 5ALEA 5L1KA 1LV9A 2KA7A 3H3VC 1IV8A 4Q8FA 3J7YW 1QILA 2ICIA 2JE6I 2YTVA 2DUYA 1PVOA 1QJOA 1KKXA 5BN3A 1OXVA 3I70A 7ICFA 1V1QA 2F0IA 4JB3A 1ZQKA 3C3LA 2JEAI 4DSJA 4US9A 3RZOH 3S1QB 1NKBA 4R4OA 1YHAA 3I7FA 2KFNA 2OEOA 2B6GA 1CKNA 2CCZA 2HD3A 3IG5A 3QB3A 3ZJYC 4HIMA 1PDQA 1SWVA 4QY7A 4ZQ3A 2PCFB 3IV6A 1BO0A 4H02A 5J2GA 3R3OA 3QUBA 5D65A 2A5HA 1SKSA 9ICHA 2VA3A 3MABA 4OJ5A 2F0SA 1YVCA 1SNCA 2HHQA 1Q7YC 2JZBB 5DLFA 2C9OA 3PO4A 3FEWX 1JJ2A 4LNQA 3CPFA 4IQZA 4B9NA 3ICEA 4DWIA 4RPXA 4FNFA 1S5FD 4DV0Q 4HAEA 1VQEA 1PVPA 3A8KE 3OWFA 1GUOA 1PK3A 3MTSA 2RLTA 4UB4A 4KLEA 1DK3A 5D3DA 3MR5A 2C2RA 1KW4A 2YTUA 1L3SA 4AP9A 1E0BA 2BCSA 4OEMB 3CF5A 4C8KA 1M6YA 2EQYA 1N63A 3FDTA 5IP7H 4JCVE 1PH9A 4RQ1A 1D8YA 3PUZA 2IHNA 2QB0B 5IODA 2WTFA 1C4QA 2R8HA 4LF7L 1M4VA 1EU4A 2ZTEA 2FPMA 3EZ5A 4HMJA 3C23A 3KF8B 1HEKA 1DJRD 3NHHA 4LJZC 1AW7A 4DSKA 3Q6SA 4JI1Q 3DV9A 2F8KA 4YD1A 1O7IA 2DWQA 4Y2JA 1I4PA 1WOCA 4FXDA 2PNRC 5J2BA 3SENA 4C2MB 2DL0A 3AQFA 4R4QA 1KDCA 2RCFA 5CV6A 1X3PA 2ZIWA 3L5KA 3NTUA 3BS5B 2W54A 1E22A 4OO1I 2BKEA 2QW7A 4A3LH 2ESEA 1KLNA 5IP7G 1TS4A 3UDXA 4NLCA 8ICUA 1EWCA 2WAQF 4DN4M 1KTQA 2WAQE 5GAEC 3GIJA 5IOCA 4DS5A 4QZ8A 1CQVA 3GDXA 4FF1A 1T5EA 4DAVA 2V4QA 3EA6A 3SAGA 5AK3A 2L12A 5L1LA 1SV0C 4LF5Q 3S1MH 5CBEE 1U48A 1QLNA 1T7PA 4UAYA 4R64A 1ZEQX 2I0QA 4JI4Q 1PRTB 5CV7A 2IHEA 3BDCA 2PMZB 5A2QE 3AU2A 4NM2A 1MBYA 5KG7A 2RDHA 5CWRA 3E0JA 3K6OA 4CDDC 5M5XH 2RSOA 2XCAA 1MC8A 5BOMA 3F5EA 1GO3F 3GZFA 1NKEA 1GO3E 5J2DA 1UEBA 3QJYA 3A8JE 1VMCA 4IUTA 3IKJA 2OTLA 3TARA 1ZYRC 4QZ9A 4C4SA 4L5TA 4ZCKA 4OO1J 3E3XA 3FPUB 3OJSA 1S0MA 2QEJC 3V6JA 4K0KQ 2CH4W 1TKDA 4MIUA 5JJZA 3PIPA 4K5VA 4UB5A 2G5HB 3EW9A 5M5YH 1UA0A 5TZVA 5C5MA 3RJGA 2E76C 5I6WA 4GNXB 5J1ZA 4C8MA 4KJNA 3GQBA 5CYUA 5J22A 4B3ML 4KD4A 3OSOA 3HX0A 3RH5A 3NRZA 5CC4A 1NJWA 2IY5B 3CP0A 3G71A 3TANA 4RQ4A 4ELUA 1TFRA 2IX3A 4F72A 1U45A 2H3QA 2BDPA 4CHTB 1BVSA 1IXRA 4DV5Q 4DO9A 4O3QA 3ZD8A 3H15A 3RBDA 4YHHQ 2KKPA 5J0XA 1DM0B 2OQ0A 1PH6A 2KHVA 4CNQA 3F2BA 1BCPD 2MPMA 1EIHA 1SYGA 1YI2A 2ZUBA 5AM4A 3P75A 2XY7A 4V190 4H44C 1NZPA 1X6IA 2ZJAA 3WDNA 4CF4A 4E6IA 1PH1A 2F3VA 5C5JA 3TP7A 4JVZA 1B4OA 2UXCQ 4WJWA 5I9PA 5KG4A 4JI8L 1XMQL 1M90C 4LFCQ 3S1MB 2JEGA 1SFOH 2JEJA 1WTVA 3KLSA 3C1YA 2BH2A 2H3FA 4A3DH 2DJGC 4XT3B 3N97B 1GHKA 5L1MA 2AQ4A 4JPBW 1MGSA 2R93G 4Y2RA 1CKNB 3RR8A 1W6JA 4X64L 4J9KA 4A3MH 5AK5A 1U49A 5AK4A 1ZQIA 4B3SQ 2O6KA 4J8QA 3WKCA 2KIWA 4KLMA 1ZOLA 4UAZA 4PGQA 3LWUA 5KFFA 5CEHA 3I4OA 4TQRA 2DJFC 2AWOA 1X56A 3TSSA 2OXOA 1B1ZA 4QIWB 1N2XA 4K4IA 4M0AA 3UE1A 3BQ2A 1SL1A 4IPHA 2ZIXA 5IT9c 4A3DG 4B9VA 3NTHA 3I56A 3N7PD 2EQSA 2MP1A 3RLOA 5D3IB 5ALDA 2B8GA 1HUOA 4A3MG 1N33L 2A69C 4RHSA 4HJ9A 4QZHA 1G291 2H5XA 3L4PA 5K4LA 3KHHA 3JAML 1QCKA 4QL5A 3QWNA 4AQYL 3RFAA 2M00A 1B4FA 2SOBA 5A0LA 4CF5A 3A7LA 3PW0A 2OT2A 4L6TB 2R93B 4RGNA 1T3NA 1P7DA 1ESRA 1N48A 1SJHD 4YWLA 3KJPA 4YY3Q 2AWNA 2EXDA 3H3VH 4DUZL 1LB2B 5DDMA 2N49A 5C0YA 4LF6Q 1EIGA 5J39A 2NVYB 2L11A 4BA2I 4Q44A 1GHJA 1VQGA 2UVUA 2W04A 2ZTDA 1IYUA 3QZ7A 4WJ3B 1SV0A 5G5HA 2G09A 3CW2C 2ZIWB 1CZGA 1X3FA 2K14A 3S1RH 3J7A5 1PZNA 3PUWA 3EPIA 2E3TA 1P8LA 1GUSA 4OIKA 2ZJ5A 5C0XI 2EZVA 1LTLA 4GKKL 5KNIA 4A3IH 2D0OA 5KFDA 1ZQCA 4RZRA 5I2YA 3CRKC 4A3DB 2F0KA 1ZQPA 2NZHA 1HPCA 2E8MA 4KI0A 4M1UB 3H94A 4R8NA 5KFLA 3PR5B 3MC1A 4AYBG 2K01A 1VQNA 1ICWA 2JR5A 5DBCA 4A3MB 4CKEA 3EJIA 3MC0B 4YXMA 2DFLA 1G8ZD 1DCZA 1XMOL 2IOFK 1RZTA 3KZXA 4LFAL 4A3BG 2I5HA 5AIBA 3S16H 2X6LA 2IT1A 3K7AH 3S17B 4IRDA 4PHAA 2A19A 3MXPA 5JVG3 4PG3A 3PX0A 2VUMB 2I46A 5JEAJ 3KDFB 3VR2A 4YVZA 1BCPC 1GVPA 3A56A 1L7MA 4B9XA 2XGTA 2Y1IA 4ZLTF 5DGAA 1JE5A 4KLJA 3CKIB 1KFDA 4FS2A 1KNAA 1RYUA 4A3IG 4GKJL 1Z00A 4K8IA 1YNND 2TMPA 3OWEB 1NNXA 4I2GA 4K14A 5C0XJ 3CCJA 3TS2A 5HURA 1E2WA 2K60A 2P6UA 5LHY1 2H3VA 5KFYA 1ZQAA 3TZUA 2HHHL 3NGDA 4JI3L 4NLZA 1DOLA 4FBTA 4I27A 5DM73 4WJ3M 4MN3A 5IYDH 3H7IA 1IBMQ 1C8CA 1S0NA 1QSSA 1F2MA 3GV6A 5AICA 4AYBB 3UXPA 4E0DA 1JOQA 1I4HA 1H9SA 1CSPA 4RUCA 3RUZA 2KD1A 4P4MA 4EBEA 3S24A 3X3MA 4CKCA 3HOUH 5JJKA 2WAQC 3NQIA 3BS7A 4A3BB 3GFKB 3H0MB 1Q46A 2VA2A 3G6JB 4I2BA 4L5RC 1PZID 3DWQA 4LF8L 1WJJA 2A74C 5EE3A 3S1RB 5JPNC 5K36H 1CI4A 2XCPA 1HA5A 3SHLA 1EYGA 4ECYA 4OIJA 2VQEL 5AIAA 4O5KA 1ONLA 4A3IB 1CHQD 1I50H 5C44B 1JB7A 4IUQA 2O4XA 1QTMA 2KZZA 1HUMA 5IYDG 2LM4A 4O42A 1BBUA 5AM2A 2EYPA 1N36L 1E7ZA 3QE9Y 2L1BA 1X3GA 1KN5A 5CRXA 3HOUG 3Q8MA 2L0CA 2QF7A 1MSWD 3U58A 4KY5A 2BDNA 4DLEA 4M6WA 4BXOA 2OEHA 1IHZA 3QX7A 4JWMA 2E2HH 4HN7A 2VY3A 5K36G 2KUMA 1WD1A 5J2JA 4PHDA 2HCIA 3KTQA 4F5RA 1JALA 5KL8B 1HNZL 5HGQA 5T14A 1S77D 4KY7A 4J15A 4OX9L 1NOMA 3OTOL 1FJGQ 3E9IA 1UPHA 4AH6A 5IP9H 4DR5Q 2QILA 4B9LA 5CV9A 1ZQUA 3BZDB 4L8JA 1CI3M 3HT3A 4IN3A 1Y1VB 1Z9FA 3QU7A 4EX5A 5IIOA 1N32L 3SQIA 2ZIXB 5CP2A 2ZM6L 5KGUA 2D3DA 3CCRA 3JPSA 1Y8NB 3V6KA 9ICNA 2QA4A 1JR0D 5KL1B 1D6EC 2EYFA 1F0MA 3NBIA 1EUJA 3UMCA 1H9JA 1B53A 4TKOB 1J97A 3M8SA 4MFFA 2KZ3A 9ICVA 4UBBA 2ALZA 3K80C 2BPFA 5JJLA 4EEYA 1YNXA 2E2JB 3CCVA 4XQNA 3BDPA 3J7AF 4EQOA 4DQPA 5IP9G 3Q8DA 2HCCA 4IJLA 3IDWA 2NN6H 1DXSA 1I50B 3CQZH 1N9WA 4MHEA 2XWBB 1VQ6A 5KIXA 1PA6A 4YMNA 2HOIA 1WTXA 5CB1A 3HOWB 1ZD4A 1XU4A 4F50A 1KL9A 2LKVA 2LPEA 3FHWA 1BPEA 3V96A 1QVGA 4KTAA 1J6QA 2BQRA 3KK7A 3Q8LA 1SZPA 3BS1A 1PH4A 4IPGA 3DEEA 3EFXD 1BPXA 1DGJA 2Z8LA 5GROA 1F9QA 2RCNA 4TRDA 5E1FA 2WACA 3E2EA 3WOFA 1EY8A 1E24A 1QQ5A 1L0WA 2LYHA 9ICUA 2YY6A 5F9LA 5ALSA 1DGSA 1BDOA 4QWAA 1Z4OA 4TSSA 4XTCS 1BNZA 2L5TA 4EX6A 1IBKL 4LVSA 2DKZA 4O3SA 3EUB2 3IL8A 4DV2Q 3OYYA 4A75A 3R9KA 1B9NA 2BE5C 2NN6G 2UXBL 4GLXA 4Y2SA 1L0YB 4CDFC 2RDGA 4KMOB 9ICQA 9ICTA 4XQQA 3BQ0A 4IRKA 3RBEA 4YR3A 1JRPA 5CMDA 2KJ5A 3KD3A 4RCOA 1EOVA 3NXWA 1WTQA 4IURA 1AEXA 3MXUA 2G5DA 2YMLA 1E3PA 1UE6A 3RJHA 1YBYA 2M0NA 2LXJA 5KFGA 2LHTA 1QH9A 1I6HB 2MUYA 1DK2A 2QKQA 3HOYH 1SL0A 1W6KA 1GUTA 1STGA 2K5HA 3QG1A 4DR1Q 1SE3A 2LFNA 1AP0A 2F0JA 1BPBA 3T5LA 4I28A 3PCOB 1VCIA 2Q8RE 2NRWA 2B3GA 4GS3A 5AKYA 1H9SB 4P75A 3C5FA 3DXJC 1AQ6A 4JW0A 3N4MB 1O7LA 5ALOA 1XSLA 1K83H 5IYBH 4JWNA 2K4PA 3UQ2A 1VQIA 2GH1A 3TS0A 3WK8A 5GQOA 2EIFA 2F0TA 3AYHB 4Y7NH 2NBFA 7ICOA 4G7OC 1G2TA 3C2MA 1DOQA 1GJXA 4QZAA 2P6RA 1ML0D 3RN2A 1OTCA 4BJQA 1QOHA 3CU7A 4PMBA 2PW5A 3N6RA 4JYAL 3T1HQ 1EWHA 3CCUA 1FNWA 2FE9A 1Z1VA 2EH9A 4JI7L 1A0IA 1L8OA 7ICVA 2WP8J 2JP1A 2IX1A 1IL8A 5G5GA 2PNHA 1HNXL 1HCZA 5AM0A 1MKHA 2KIVA 1PHJA 2B2TA 4UB2A 3FDSA 1RF2D 3BQ1A 4I2EA 3ITPA 3S1NH 3CNHA 4DNRB 1EYCA 2VQFQ 5DB8A 5LMNQ 4EBDA 4M6WB 4BXOB 3JAMc 3GTOB 1SDFA 2KHIA 1MA7A 1PTOB 5M5WH 2CRXA 2F0PA 2KJ9A 3NVZA 4GFJA 1U9RA 4DV6Q 2SEBD 1STAA 3K4GA 3BVMA 4NXNQ 2XSCA 3FM9A 2X6GA 2HHVA 2A6HC 3F53A 2I07B 3GQCA 4IPCA 3PIOA 1ASYA 4JK1C 1L7NA 5D49A 3GTQB 1CHPD 3F2DA 2CQAA 2ZJPA 4FZLA 3M9NB 2VL6A 1QVFA 4DV0L 2K8AA 3GO5A 1XTDA 3NSWA 1H9KA 5KT5A 3IN5A 1EIFA 1R4PB 4NXZA 1F5SA 4ED2A 1EU3A 5EAYA 1L8LA 2KVMA 4DU9A 1QZHA 1COKA 1BGXT 3FP9A 5IWAQ 1FFVA 1BOSA 5EBCA 1D9FA 3BQTA 3PUYA 3MHBA 3FMCA 3VR4A 3PMLA 2BA0A 5DBAA 4DAMA 4F8RA 3D4WA 4DK6C 4OJPA 4PL1A 4IR1A 4R4CA 2PPBC 3UXOA 5AKGA 2KENA 2PZUA 4Y2QA 5L1IA 1CSQA 1EZ6A 3C2LA 1FNUA 2TSSA 3E0FA 5GADC 4P4OA 3WKBA 4WJ4A 2YB1A 4K5WA 4PL2A 4JI1L 8ICIA 2H3IA 2HCFA 4RQ0A 1KAWA 3HKSA 4CJ0B 2RA4A 4DOCA 4RQMA 5J0PA 8ICZA 4LFBQ 1X9XA 3PSPA 1ED1A 1B3AA 4TUSA 2B2YC 4JI0Q 8ICGA 4QMGA 3KBBA 3HILA 4I7AA 4DPGA 3CYMA 2WAQG 1ZXIA 5DBBA 2YYZA 5BN4A 1JC7A 5CGKA 3PF5A 4J9LA 1TWFH 1XNQQ 4ED7A 1TAUA 1QWYA 4NW2A 1K8AC 3T79A 5KT6A 2F0UA 2E1EA 2C35B 3H8SA 4O0AA 2HW3A 2NYZD 3BG3A 1TQOA 1R9TB 1V1PB 1FEZA 4HIOA 2Y9TA 1D1KA 1LTBD 4OL7A 4HCSA 4LF5L 3LVVA 4DSFA 3W1BA 4FZNA 1TXYA 4QF4A 4JI4L 4RNMA 2AQ0A 4EQNA 4DSIA 3T16A 3D6JA 5JRTA 3ISDA 1N5XA 4IALA 3AU6A 4FF3A 5KTQA 5J2CA 3B6YA 5H1SE 2EZZA 3GTKB 2EVBA 2K5VA 2D5DA 1MJEA 4DXGA 4P71A 1VQHA 3KYHC 1SNQA 4K0KL 5B66U 1ZQWA 4ED0A 1VQJA 2EYJA 2EE1A 2R8GA 4EZ9A 2QKIC 2WAQB 2VANA 5F9NA 1Q12A 2WB1C 1SROA 1S5ED 5FP0A 1A8VA 2CQOA 3H3VI 1I4XA 1O7ZA 1PZKD 3OOCA 1HUNA 1ZQQA 7ICGA 5KFKA 2YN4A 2AXTU 1S76D 8ICJA 1Y88A 3IG8A 3C5GA 3I3CA 2KVSA 3SR1A 1NMGA 4HR7B 4DV5L 4LF4L 4IFDJ 4UB6U 5L9XA 2D6FC 1X55A 4YHHL 2UUCQ 2O5JC 1RQNA 3I4LA 1EL0A 3F5AA 4P4PA 2EAPA 9ICIA 3G6YA 1CKMA 5IY0A 2XNAC 4GNXA 3S6JA 1ZRNA 3NELA 3R2IA 2KOLA 3MR3A 3SAFA 1UE5A 1SJED 1FYCA 4JI6L 1G6PA 2PZTA 5CBAE 4M04A 4RMFA 3S2HB 1J2NA 1SYCA 1TWFB 3DMUA 3LYSA 4FBUA 5FLXL 4DV1Q 4DFMA 1NK9A 5CR0A 1FGBD 3MDCA 1B50A 2F0DA 2F4VQ 2Z9HA 2QLTA 3ULPA 3H4DA 4UP7A 4C0ZA 2E8GA 5AKEA 2HIXA 3D4DA 4F5PA 2XVSA 1NJIC 3ULLA 1K3RA 3L7ZC 2G9DA 5JOBA 4JK1A 1TK5A 2CFMA 3CC4A 4NLBA 2J7ZA 4UAIA 4NJ8A 5ALXA 1SMYC 4B6JA 1DOMA 1WCMB 2GN5A 4HEDA 4A4IA 4UB3A 3Q24A 1G6ZA 2PKEA 1CUKA 2W9BA 2B2WC 5HP4A 2ZG6A 1NK5A 4U673 5AM5A 2CW0D 1LVHA 4DAYA 2MHVA 2BDOA 1JXEA 1HNWL 3C1FA 2HSZA 4IUNA 1Q3VA 1WTOA 5KFSA 4C4RA 3AMZA 1ZQOA 8ICCA 3QUCA 1YZ6A 2FXQA 4EBCA 3VYTA 4IZ8A 1GUNA 3KJOA 3QXGA 7ICPA 1EEID 2F1JA 2EPBA 2YX8A 4F7XA 1A2UA 2PZWA 3ND9A 1B7YB 1VDZA 3X3NA 2GVBA 2KEEA 3H0LB 2Z6BA 4XQ8A 1OUQA 1I3QH 2E5SA 3GD7A 4S3SA 3JAMi 4QZBA 1MSGA 3AEVA 1E2VA 1QE6A 2B2YA 4LW1A 4ID6A 1IBLL 4IO9A 2YMMA 5J2KA 1XNRQ 2UXDQ 1AROP 4O9MA 4KLHA 1SN8A 2KZMA 1MQ3A 3OMGA 2I1QA 4LF9L 2GLEA 3UXNA 2OYYA 2MNAA 2NVQB 4OCZA 4ECXA 5G3LD 4YWMA 3RN5A 1HR0Q 1ZQ1C 4BWJA 4DQRA 3T1YQ 1Z3EB 2XWJB 4EQ5A 4LF6L 5ALGA 1STNA 1RDPD 3VR6A 1K1QA 1ZQDA 2AJQA 4EGVA 3K5NA 3E58A 4USAA 2F3NA 1GUGA 3BVGA 2PQAB 1AZQA 4MHVA 5J2EA 1TWCH 3QOLA 2ASDA 1BCPF 5KFRA 1XXGA 3RMHA 4Z6EA 3I8ZA 4PV1C 7ICJA 2Q2HA 5C4HA 2JN4A 5EKLA 5ALJA 1F2LA 2RF4A 4DOBA 1ET9A 2NVXH 7ICNA 2VW9A 2XICA 1Q8KA 4UATA 1RCVD 2PFPA 1WCLA 1S40A 3N7RC 1QVCA 4RFBA 2NO4A 3AMUA 4QGUA 5IGDA 1BNPA 5AI0A 3BYYB 5T1GA 3BDOA 3WWVA 2WF9A 2R92H 3OHXC 4RPZA 3CMEA 3WK7A 3HOXH 2NRXA 4HJ8A 2F3IA 1A76A 5AKHA 8ICRA 4FFDA 3JPNA 3SV4A 3KKAA 4G57A 5LMUL 1KNEA 4OGQC 4P0PB 1ET6A 3C2KA 1JE4A 4GLVB 3CRLC 1WVLA 4B3TL 3RZOB 1Q86C 5E79U 5AJ3Q 1JJCB 3S2DH 2W03A 3PX6A 3RB3A 1FNVA 4A76A 1PYWD 1A6SA 5T1IA 1XX8A 3K59A 3KLSX 2NUCA 4FP5D 2XTIA 4GN3B 2ZTCA 4DQQA 1ILQA 2KCCA 1I3QB 5HY6A 2Z6KC 3LGJA 3SE0A 1IYVA 4RQ6A 2F0QA 1U4LA 4ECTA 4KMUC 4TQUS 5FJ8H 8ICYA 2E5LQ 1WYGA 2R92G 1K73C 1RXVA 1PTOD 2IHFA 4DR6L 3HOXG 3C29A 3KDFA 4A3LG 2XVTA 1IBML 4HTHA 2UUAL 3BU2A 3W3AA 3MR6A 3GP7A 3PSFA 3B9JA 5DG8A 1JROA 4A93H 4LUOA 3I91A 2F2AB 1K0RA 3RLFA 4X62Q 1NI3A 2WF6A 4PHEA 5IT9E 5IINA 3TADC 3E9HA 3NWSA 4HCEA 1X66A 3RJEA 4RQ7A 3H09A 3TREA 1VQ9A 3CAMA 4I2JA 1F2ZA 9ICBA 2A68D 4C3HH 1TVAA 1JMSA 5FJ8G 4A8EA 4DFJA 4G4KA 5IE8A 2RHQB 1RM6C 8ICPA 2NVXB 1X40A 2GWSA 1S5LU 1CEZA 2L15A 3IM1A 1LV5A 4I2AA 3RJJA 1Z4NA 3OIPA 2B2WA 2Q8IB 2DN8A 3ZYYX 4L5SA 4DR4L 1HFNA 4M9NA 4Y2PA 1BBXC 2SNSA 4J03A 5GAHC 2HBMA 4DFAA 8ICLA 2R92B 1SYFA 4KLQA 4A93G 4B9WA 1N61A 3K0YA 4DR7Q 3QYPA 3AL0B 5IGEA 1RPLA 2EYMA 4LUZA 1S5CD 8ICXA 3V05A 4HIDA 1MJCA 1L2FA 1EIYB 2PFQA 2F77X 2MO0A 4DR2Q 4ELVA 4NPSA 2OH2A 3GV8B 4CJ2C 1EY0A 2W9BB 4R1JA 1QSLA 1PFMA 4ECZA 3PV0A 4C3HG 1IKLA 2W7PA 2K04A 3S2DB 4DAYB 3V7KA 2LXKA 4DLGA 4G7HC 3HRDD 4I2FA 1SE4A 2WFWA 1AFPA 1KRTA 3GV3A 4KHZA 4QWCA 2MAXA 1RTOA 3QOJA 3R8BA 4NMZA 3IAYA 4Y52H 4UBCA 5M5XB 4IJHA 5FLXE 2BGWA 4NV0A 2EAOA 2Q0ZX 4GIBA 1TWGH 1KQSA 1SZHA 2PW7A 1YITA 1Z6HA 1L7PA 3T5HA 1B70B 3PUVA 1HZBA 3BZCA 1VQPA 1LM0A 3STBD 3MGIA 2BA1A 2EAMA 4Y2XA 5DLGA 4A93B 1F2YA 1HH2P 2VZAA 2BR0A 1QZGA 1SNPA 5M5YB 2J6TA 5C4ZA 3PIP3 1N8RC 2YQEA 1WUDA 5AK6A 3I28A 4MF8A 3Q8RB 1TU2B 2EY5A 1KEJA 5KT3A 2F0WA 4ELTA 2WB1G 2NRVA 3EPGA 1Y1WH 1YHBA 3GTLB 1JORA 1D8LA 3RAQA 4O5EA 3OHAA 1VQAA 2K8CB 3DM3A 2Z4IA 2OHFA 4A3JH 4RQ3A 3K5LA 1STEA 5EE0A 1RYRA 1SKRA 1S9FA 5C3EH 2AQ2B 4ICAA 3QU9A 4RQ5A 3MFYA 1ZD2P 4IQTA 3CCMA 1PH3A 3RZDH 4Q43A 1B9MA 2K5WA 2LKYA 3MWYW 5F2DA 4OXPA 1SIJA 4P73A 4JMUA 1ZQEA 2AGPA 3GTLH 1L0XB 4LUVA 1JOKA 3ZDDA 3ULJA 1JN3A 1A0PA 2MA1A 1VQFA 4ACOA 2KSOA 4GC6A 2R7ZH 3GTGH 2Y0SF 2Y0SE 5D4BA 3KUPA 4K6DA 4B9SA 3GV7B 4UDUC 4P2CB 4CDGA 4U68A 3PMFA 4GXJA 2BCUA 2HVIA 4QNLA 1YNJD 4YWKA 4DV2L 4A3JG 1Y1WG 3D2QA 3OHBA 1ZQGA 3QU5A 1II3A 5C3EG 1SFOB 2K4IA 4KMUA 3KOOA 3KLWA 4Q0FA 3M7NA 5IGFA 2HDOA 2F0FA 2W3SA 5AM1A 3O0FA 1UQVA 1SAPA 1SXTA 5D14A 2VJ5A 1CKOA 3GTJH 1KDBA 4FYDA 5ALTA 1TWGB 2IOHA 2ZIVA 5EWFA 4M9JA 1N5WA 3OJUA 4ED8A 3PR4A 5FLXc 1SMXA 2R7ZG 2VB3X 4BA1I 4B08A 3TADA 2ISPA 1HTPA 3TQYA 4KLTA 5LL6X 4IQUA 4DR1L 3RNUA 4IQWA 4F5NA 4QZEA 1A2TA 2FLLA 5I9OA 2ZJRA 1UT5A 1T9HA 4EENA 5DKWA 3DM1A 3ZDCA 1XS9D 2J6SA 2K28A 1S5DD 3VR3A 1QUQA 2R3ZA 4RG1A 3Q8PB 2F0HA 2HOFA 5DG7A 1LO5D 8ICWA 1NZBA 4QUFA
chains in the Genus database with same CATH topology
4DV3Q 2UXBQ 2I5LX 2K5HA 2BH8A 4DR1Q 4DV7L 3GTMH 2K75A 5BR8L 1RL2A 3PCOB 4DR2L 2ATWA 1VCIA 4GS3A 2B3GA 4P75A 4KHPL 1WCMG 1G51A 3EIVA 1IL2A 2I5MX 1K83H 5IYBH 1NE3A 2K4KA 4C3IH 3CCLA 1VQIA 3HOVH 3TS0A 4DKAC 5GQOA 4Y7NH 2EIFA 3A5UA 3AYHB 3UDFA 2ID0A 1XPUA 2QEXA 1HZCA 1FGUA 3J80i 3STBC 3G6EA 3RN2A 1OTCA 2NVQH 3CCQA 4DV7Q 1LUZA 3PO3H 4JYAL 2VQFL 2VS1A 1NBWA 4X65L 5LMNL 5BR8Q 3L2PA 3T1HQ 1YIJA 3CC2A 3CCEA 2A8VA 4B3RL 1KRSA 4HJ5A 3CCUA 2Z0SA 1H95A 5LMNW 4LF4Q 4KHPQ 1P16A 1Q82C 1A0IA 1Q1BA 4DV6L 1RIPA 4QJFA 5E7NA 3KFUA 1U5KA 3CCSA 2WP8J 2IX1A 2HQLA 4OWXB 2PNHA 1C0AA 1HNXL 2DUDA 1PHJA 1MKHA 3AFQA 1U0LA 2AKWB 3J81c 2IX0A 1I94Q 1FJGL 2R93H 4B3MQ 4DR5L 3S1NH 3A0JA 4JI6Q 1NTGA 4JYAQ 2VQFQ 4HIKA 2V1CC 4X65Q 2LSSA 5LMNQ 4OWWB 4B3RQ 3JAMc 2NVYH 2KHIA 5IWAL 5M5WH 3FKIH 3PO3G 1X54A 2K50A 4KLKA 4NXNQ 4DV6Q 2JE6I 2YTVA 1V9PA 1PVOA 4R4TA 1ASYA 4GLAC 3IRBA 4IPCA 1OXTA 4NB3A 3PIOA 4A3EH 3MEFA 1OXVA 3M4PA 3F2DA 2KHJA 3GDEA 1V1QA 2ZJPA 2VL6A 2JEAI 1QVFA 4POGA 4DV0L 3GO5A 4OWTB 1XTDA 3BZKA 4R4OA 3RZOH 1YHAA 3I7FA 2MFIA 1EIFA 3M3YH 4L5QA 1CKNA 3KF6A 5EAYA 2CCZA 1QZHA 2ZJQA 1L1OA 3ZJYC 4HIMA 3FP9A 4QY7A 5IWAQ 4H02A 1XPRA 3PUYA 4DR3L 4LFBL 3PUXA 2JK8A 4BY7H 2BA0A 4DAMA 2N3SA 1S72A 1YVCA 2Q2IA 4DK6C 3FKIG 3CPWA 1Q7YC 1HNWQ 1GD7A 3S17H 4LNQA 1BKBA 3K81C 1JJ2A 4R4CA 3CPFA 4A3FH 1VQKA 2KENA 2VUMH 3ICEA 1XNQL 1KXLA 1CSQA 4P74A 3SGIA 4DV0Q 1VQEA 4DK3C 5GADC 4A3EG 4WJ4A 3BJUA 4JI1L 3UE0A 4C3JH 3F1ZA 1HZAA 4X64Q 1KAWA 2WB1E 3HKSA 3CF5A 1AE3A 4YCUA 2KBNA 2DGYA 4DR3Q 5JJIA 1LYLA 4LFBQ 2OTJA 4JI0Q 3PO2H 4GN4B 2VNUD 5IP7H 4JCVE 1PH9A 3K8AA 1NY4A 3PUZA 1PV4A 4DPGA 1IBLQ 4JI2L 1UE7A 2Z6KA 2WAQG 2R6GA 4LF7L 1VS0A 2YYZA 3PF5A 2HT1A 2ZTEA 1XJVA 4BY7G 1TWFH 1XNQQ 1K8AC 1TWHH 3KF8B 4PZ6A 4LF9Q 3NBHB 2C35B 1W3SA 3K7UC 1HJPA 4O0AA 4JI1Q 5C4XH 4A3FG 2VUMG 4IOAA 4HIOA 1O7IA 3S14H 1WOCA 4IFDG 4LF5L 4A3BH 3W1BA 2ALYB 1TXYA 4R4QA 1VQDA 4JI4L 3D31A 2E2IH 1N33Q 1E22A 4A3LH 4OO1I 4JI2Q 4GOPB 4LF7Q 1A62A 1X3EA 2N78A 2A1AA 2RHSB 4AQYQ 5IP7G 3PO2G 3UDXA 3B6YA 3CMAA 2JEBI 5GAEC 2WAQE 5H1SE 5C44H 2K5VA 1MJEA 2PMZE 4P71A 1VQHA 1AE2A 4DUZQ 3KYHC 1B8AA 2B63H 2UUCL 1QUQB 3S1MH 4LF5Q 4K0KL 1VQJA 5C4XG 2I0QA 4JI4Q 2IHEA 1Q12A 4MZ9A 4APVA 1PH8A 1SROA 1KHIA 1A8VA 2CQOA 3H3VI 5M5XH 3T1HL 4GKKQ 1YZ7A 5LMUQ 1GO3E 1UEBA 4JI5L 4B3TQ 1GM5A 2Q2UA 2OTLA 4DV1L 4L5TA 4IFDJ 3W1GA 1NMGA 3F8TA 4DV5L 1VQOA 4LF4L 2F4VL 1X55A 3RR5A 4YHHL 5C44G 3PIPA 2UUCQ 4K0KQ 1N34L 5M5YH 1CKMA 3U50C 5IY0A 4GNXA 3NELA 4DUYL 4GNXB 1XMOQ 1Q81C 1I94L 3MXNB 3UDGA 4B3ML 2GVAA 4LFAQ 1UE5A 2JA8H 4HJAA 1YEZA 4JI6L 1G6PA 4RMFA 2NZOA 2IY5B 1Y1VH 3CP0A 3HOYG 4DR6Q 3G71A 4JI5Q 3EBEA 3HFZB 2UUAQ 4DV1Q 1BVSA 1IXRA 3A5ZB 1PYSB 4DV5Q 2F4VQ 4NXNL 3H15A 4YHHQ 3ULPA 4UP7A 4BBRH 4GKJQ 1SR3A 2E8GA 2QGQA 1N34Q 2HIXA 4JG2A 2KCMA 1Y14B 3W5OA 1NJIC 3ULLA 2OQ0A 4DUYQ 1YJ9A 1K3RA 3L7ZC 5IYBG 1D7QA 1PH6A 3F2BA 3HOVG 2CFMA 3CC4A 2E2JH 1TWAH 1YI2A 3L0OA 3S15H 2JA8G 2GN5A 1PH1A 4A4IA 1CUKA 4ME3A 1Y1VG 2UXCQ 3VDYA 4FDBA 3HOWH 3TEHB 4JI8L 2AHOB 1EWIA 1XMQL 4DR4Q 1M90C 4LFCQ 1HNWL 3PSIA 1SLJA 2CWPA 1SFOH 2UXDL 1Z47A 3M85A 4BBRG 1YZ6A 1E1TA 2FXQA 4LWCA 2BH2A 4A3DH 4JOIC 4UP8A 3KJOA 4NXML 1EQRA 4JBKA 2R93G 3J81i 1CKNB 3KF6B 3D0FA 4X64L 2VQEQ 1L1OB 4A3MH 1UWVA 2B29A 4B3SQ 3ERSX 4JI7L 1B7YB 4QIWE 2GVBA 4A3KH 4JI0L 2R7FA 3I4NH 1I3QH 5M3MH 3GD7A 1W2BA 1IZ6A 4JI8Q 3JAMi 1XMQQ 4UPAA 3AEVA 4LW1A 3UDIA 1KC8C 1IBLL 4IO9A 3I4OA 1XNRQ 2UXDQ 3HOWG 2AWOA 1X56A 1SN8A 2OCEA 1KD1C 4AIMA 1V43A 4LF9L 4BBSH 3HKZG 2MNAA 4JV5L 4NXMQ 3UE1A 2JJQA 1JJGA 4YWMA 1EQQA 3RN5A 1HR0Q 3AQQA 3DLLA 4IPHA 3T1YQ 4LF6L 4EQ5A 5IT9c 2UU9L 4JI7Q 3H3VH 4A3DG 3I56A 1VQ8A 2EQSA 5C4JH 3RLOA 2PQAA 2PQAB 2MO1A 4YCVA 3GTPH 1TWCH 4A3MG 1I6HH 2CWAA 5DLQE 2K5NA 4HJ9A 1N33L 1G291 2H5XA 4A3KG 2Q2HA 3I4NG 4QL5A 5M3MG 4AQYL 3M4OH 5ELNA 1PH7A 4BY1H 4JV5Q 2RF4A 2NVXH 2AMCB 2MQHA 2JQOA 4YWLA 3KJPA 4YY3Q 2AWNA 1Q8KA 2EXDA 2VW9A 3G4SA 4DUZL 4HJ7A 5JEAG 5AJ3L 2N49A 1S40A 1QVCA 1VQCA 1OXSC 1XPOA 2UU9Q 4LF6Q 4BA2I 4QGUA 4BBSG 1JMCA 4OO1G 3PF4A 4PZ8A 5GAGC 1VQGA 3WWVA 1PFSA 1MIUA 2PI2A 2ZTDA 1ASZA 1VQ7A 3CMEA 2R92H 3CW2C 1X3FA 3S1RH 2K14A 3HOXH 3J7A5 3PUWA 1VQLA 4HJ8A 4MNOA 1JT8A 1P8LA 2F3IA 1IYJB 5C0XI 1WFQA 1LTLA 1C7YA 5LMUL 3EN2A 4A3IH 3TRZA 2D0OA 4B3TL 4GKKL 4GLVB 4GN5A 4MTNA 2NZHA 4KI0A 4R4IA 1Q86C 5AJ3Q 1JJCB 4BY1G 4POFA 3S2DH 4AYBG 1VQNA 4A76A 3I55A 4X62L 1VQMA 4X6AH 2XTIA 4GN3B 1BBWA 1OXUA 2ZTCA 4PMWA 1XMOL 1M1KC 5HY6A 2Z6KC 3LGJA 4LFAL 4A3BG 2I5HA 1K9MC 4TQUS 5FJ8H 1PYBA 2E5LQ 2IT1A 3S16H 1UE1A 3K7AH 3J81j 2A19A 2R92G 1K73C 3H0GH 2IHFA 4PG3A 4DR6L 3HOXG 3ER0A 3KDFA 3GTOH 3HOZH 5JEAJ 3KDFB 1IBML 4A3LG 3KOJA 2UUAL 1GVPA 3BU2A 4PZ7A 1YJNA 2ASBA 4A3CH 2XGTA 3JC66 2UUBL 1JE5A 4A3IG 4GKJL 3J80c 2ES2A 4A93H 5C0XJ 3CCJA 4LUOA 3TS2A 3RLFA 1K0RA 4X62Q 4AYBE 3GTQH 2NVTH 4GOPC 3E9HA 2B63G 1OXXK 1VQ9A 3TREA 2HHHL 2JA6H 3F2CA 3CAMA 3S1QH 4JI3L 4BXXH 4A3GH 1HZ9A 4DR7L 2D62A 4WJ3M 2CKZB 4C3HH 5IYDH 1IBMQ 4TVAB 5IYCH 5FJ8G 5IE8A 2RHQB 2UUBQ 1NMFA 1CSPA 3H0GG 2L15A 2UXCL 3G48A 3S24A 3HOZG 3HOUH 2K52A 3E0EA 4OONA 2D0PA 4L5SA 4YCWA 4LFCL 4DR4L 4A3CG 5JJKA 2OWOA 2YTXA 5GAHC 4QQBX 1Q46A 4L5RC 2YTYA 4LF8L 1WJJA 2HHHQ 4A93G 2YU9H 4JI3Q 1EFWA 2JA7H 4DR7Q 1SE8A 4LUZA 4HIDA 1MJCA 1L2FA 1EYGA 4JOIA 1EIYB 1Q1EA 2VQEL 2JA6G 4BXXG 2MO0A 1I50H 4DR2Q 1JB7A 4NPSA 4B3SL 4A3GG 3NEMA 4R1JA 3PV0A 5IYDG 2HIVA 5IYCG 3I4MH 1BBUA 4DAYB 2LXKA 4GNXC 1N36L 1E7ZA 1XNRL 2WFWA 4DV4L 1C9OA 1KRTA 4LF8Q 1X3GA 4XIGS 4KHZA 3HOUG 4IOCA 3M9BA 5ELOA 4Y52H 5FLMH 3NENA 4IJHA 3U58A 1A63A 1R9TH 1HR0L 1SRUA 3T1YL 1YHQA 1TWGH 1KQSA 2E2HH 2VY3A 1YITA 2Q2TA 4C2MH 4X66L 2JA7G 5K36G 1X65A 1B70B 3PUVA 1HR0W 1HZBA 3BZCA 3K0XA 1VQPA 2JA5H 1LM0A 3STBD 2BA1A 4ALPA 3M4QA 1N36Q 1HNZL 1HH2P 2VZAA 5HGQA 1QZGA 1HNXQ 2JA9A 3U4VA 4DV4Q 1X9NA 1N8RC 4J15A 4OX9L 3OTOL 3I4MG 1FJGQ 3E9IA 2YV5A 1WI5A 2KCTA 4AH6A 3RLNA 5IP9H 4DR5Q 3GTKH 1AH9A 2WB1G 2OQKA 4YY3L 2Y0SG 4EX5A 1Z9FA 1Y1WH 1YHBA 1N32L 1D8LA 1VQAA 4A3JH 2ZM6L 1YJWA 3DM3A 1J5EL 4X66Q 5M3FH 5FLMG 3CCRA 5C3EH 2QA4A 3PGZA 4JBMA 1PH3A 3CCMA 1HNZQ 1EUJA 3RZDH 2JA5G 5J3BA 4OXPA 4P73A 3OTOQ 4OX9Q 3AFPA 3K80C 3GTLH 2PI2E 3A74A 3CD6A 5JJLA 1YNXA 4LUVA 3CC7A 4P72A 1L1OC 4JBJA 3ULJA 3CCVA