2A1AA

Pkr kinase domain-eif2alpha complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
161
Chain Sequence
SHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
total genus 47
structure length 161
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a1aA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a1aA01
1SLJA 5ELNA 4GKKL 2PI2A 2R6GA 3F2BA 4A3LH 2JEBI 4DV0Q 1PH6A 5IWAQ 1G291 1OXTA 3HKZG 4P71A 2CKZB 3OTOQ 2LXKA 3CCVA 1N36L 4A3JH 3JAMi 2AWNA 3K81C 3NBHB 4PG3A 3IRBA 1U5KA 3RZOH 4APVA 3KJPA 3T1YQ 4YY3L 2NVTH 4GKKQ 1Q1BA 3E9HA 2A19A 2KCMA 3HOUH 2IX1A 4LF9Q 2A1AA 3GTKH 2CQOA 3I55A 1PH8A 3KFUA 2I5HA 4GLAC 2JJQA 1EIFA 1RL2A 1B70B 2K5HA 2OCEA 1ASZA 4JCVE 3KOJA 1X3EA 3H3VI 1JJ2A 5C0XJ 4DV2Q 1NJIC 4DV7L 2F4VL 2JA5H 4DR4L 1NBWA 1N34Q 1WI5A 3G48A 4YHHL 2F52A 2PMZE 4A3CG 2CWAA 1K9MC 4LF6Q 3HOYH 3J81j 2NN6I 1E1OA 3KLWA 4GLVB 4PZ8A 1Y1WG 5LMNL 2VZAA 4LF7L 1D8LA 1WYDA 1MJEA 4C3IH 3G71A 1O7IA 1PH3A 4LFBL 1H95A 4A3KG 1HZ9A 2K52A 5FLMG 4P73A 1VQ5A 5GADC 3F1ZA 1X9NA 4JBKA 3HOWG 2MO1A 4EX5A 4KHZA 4AQYQ 3FKIH 1SE8A 3SGIA 3S14H 3PO2H 2CWPA 3I7FA 3GD7A 1YHAA 4JI7Q 1E7ZA 4LUOA 2B29A 5H1SE 3CCQA 2KHJA 4A3FG 3TRZA 1VQDA 4PZ7A 3VDYA 4DV6L 2I5LX 4JYAQ 2OTJA 4DUYQ 1RIPA 1X56A 2FXQA 1N9WA 5C0XI 1HNZQ 3HOZG 2AKWB 2ID0A 4IPCA 5M5WH 1LYLA 1VQCA 1VS0A 4H02A 2ZJRA 1VQNA 4GOPB 1GO3E 2JA8G 3I4NH 1EOVA 4LF4Q 1WJJA 2VQFL 3CQZH 3J80i 2E2JH 4UP9A 2VS1A 4X65Q 1CKMA 5IE8A 1CKNA 2OWOA 4OO1G 1X54A 3UDXA 4PMWA 1KQSA 3CMAA 1XMOL 3ULLA 4YCWA 4A3IG 3GTMH 2Q2IA 5C3EH 3HOYG 3J7A5 1CKNB 3ULPA 1Y1WH 3J81c 4DUYL 4JYAL 2B3GA 4LF5L 1X65A 4HJ5A 2R7DA 2HHHQ 4L5RC 2GVAA 2HIXA 4BY7H 1V1QA 3KDFB 4Y7NH 3CCEA 1PH7A 3L2PA 4GS3A 1PHJA 4KHPL 2IX0A 1VQ8A 3HOWH 1X3FA 1PH9A 2ZM6Q 2N78A 4LUVA 1NE3A 1SRUA 1HZCA 3CC7A 1YNXA 2Q2TA 3H0GG 4X64Q 3KYHC 4DR1L 1VQGA 3GTQH 1YJ9A 1ASYA 1VQKA 4X66L 1Q8KA 2HQLA 4PZ6A 2R7ZH 4B3RL 2BH8A 3BZKA 3PUVA 4POFA 5AJ3Q 2E5LL 1VQ7A 4B3TQ 2BH2A 3HOZH 1PVOA 3HKSA 2VUMH 4JBMA 3STBC 3PO3H 2UXBL 1GVPA 4HIDA 1VQBA 2EIFA 3L7ZC 1N34L 4DR4Q 2H5XA 2PI2E 2RCNA 4R4OA 4DV2L 2UXDL 2MNAA 2V1CC 2D0PA 1J6QA 3M9BA 2C35B 5GROA 1HZBA 4R4TA 1Q81C 3S1NH 4DKAC 1Y1VG 5C44H 4K0KQ 3M4PA 2YTYA 1YEZA 1IBML 2A8VA 4IFDI 3CCRA 1IBMQ 1UWVA 4R4IA 4OX9L 4K0KL 3PV0A 4A75A 2K5VA 3S24A 3AYHB 3T1HQ 2VNUD 3S2HH 2UXDQ 4TQUS 3PF4A 3CPWA 3EBEA 1M1KC 2JA7H 3AQQA 3HKZE 1EYGA 3OTOL 1N36Q 3M85A 1KIXA 4P75A 2UXBQ 5JJLA 3H0GH 1YI2A 3TQYA 5GAEC 3PUWA 5AJ3L 1MIUA 1N32L 4JV5Q 3A0JA 3ZJYC 4BBRH 3K7AH 1S3OA 4B3MQ 1CSQA 2YYZA 1VQIA 2KENA 3U4ZA 2ES2A 4GKJQ 4JI5Q 4A3EG 1KAWA 1TWGH 4X64L 3S2DH 4LW1A 1WOCA 4HJ8A 2R93H 1PH5A 4JBJA 4UPAA 1VQEA 4J15A 1XMQL 3CCLA 5IP7H 4GOPA 4DR7L 3RLOA 1YHQA 1UE1A 1PH2A 2ZM6L 3OW2A 4UP7A 4JI8L 3G4SA 2QGQA 2N3SA 2WAQE 1BBWA 2JA5G 5IYCG 4BY1G 5DLQE 5C44G 3CCJA 4A3GG 4QQBX 4B3SQ 5JJIA 1VQ9A 1L1OB 1K0RA 1IZ6A 1YVCA 1GM5A 1YBYA 1P8LA 1SMXA 2UUCL 2JA6H 4HJ7A 1X6OA 2YU9H 1HNXL 5FLMH 2K5NA 3B6YA 4WJ3M 1T9HA 1IBLQ 4LF4L 3CXCA 3I4MG 4R4QA 1VQ4A 1Z47A 4DK3C 3FKIG 3E0EA 3HOVG 3CC4A 3PO2G 2UXCL 3RNUA 1Z9FA 3BJUA 1G51A 1YJWA 4IOAA 1FGUA 1AH9A 2JA9A 1VQOA 2YTVA 4LF8Q 3W1BA 4BBRG 3CW2C 4A3FH 3GTPH 1X55A 1K3RA 1QUQA 4DV6Q 1EWIA 3TS2A 4GN3B 1YZ6A 4JOIA 4A3EH 1K73C 1HR0W 2MQHA 4DR6Q 2LXJA 1MKHA 2NZHA 4JI7L 2UXCQ 1P16A 2E2IH 1XNQQ 3GTLH 1TWFH 5JJKA 4IPDA 1M90C 1IBLL 1U0LA 4NPSA 1VQMA 2JA8H 4A4IA 3I4NG 3CCUA 1IL2A 1OXXK 4JOIC 2UUCQ 2NVYH 3M4QA 5GAHC 2UU9Q 2I5MX 1VQLA 4BY1H 4OWXB 4HIMA 4IFDG 1XNRL 4A3IH 2ZTDA 5C3EG 4GNXC 4DAMA 4IOCA 1VQPA 1Q7YC 1JB7A 1Q12A 2JK8A 2NVQH 1E22A 4OO1I 1VQAA 4JG2A 3F2DA 4DV3Q 4JI8Q 4YHHQ 3W1GA 4NXML 4JC0A 3D0FA 5HGQA 3JAMc 2JEAI 1QVFA 1WCMG 1CSPA 2GN5A 3F8TA 3KF6B 1Q1EA 1KHIA 2KCTA 4YCUA 4C3HH 5FJ8G 3LGJA 4GNXA 1NTGA 1XPUA 3CC2A 5C0XG 1IBKQ 4A93H 4BBSG 3GTGH 2B63H 4IFDJ 2ATWA 1K83H 3BZCA 4JV5L 3K7UC 4YY3Q 3MXNB 4AYBG 2R7ZG 4DV4L 2UUBQ 3EN2A 2VUMG 2AWOA 4HJ9A 3PO3G 1CUKA 2BA0A 3ULJA 5IYDH 3PIOA 4DV4Q 2UUBL 4A3MH 1JMCA 1A62A 5M5YH 5IYBG 3PUZA 4AIMA 2Y0SG 1IBKL 2NN6G 4A3BH 1Y1VH 5IP9H 3UDFA 4LWCA 3U4VA 3GTOH 3CMEA 1KRSA 2WB1G 4LUZA 5M3MG 4X6AH 1YJNA 3HOXH 1VQJA 2Z6KC 1PH1A 4BXXG 1V43A 1AE3A 4IJHA 1HH2P 4NXMQ 3RR5A 2AHOB 1JE5A 4OWTB 4IPHA 4DV3L 3I4OA 1UE6A 2E5LQ 3S17H 4DR3Q 3ICEA 3TEHB 5FJ8H 4B3RQ 4OWWB 1XNRQ 4X66Q 2OQ0A 1XTDA 4DR2Q 1N33Q 2B63G 1G6PA 3ERSX 2UU9L 4DR1Q 2EXDA 4OONA 4LNQA 4NB3A 4JI0Q 4IPGA 1K8GA 1FJGL 3I56A 1BKBA 2L15A 1Y14B 3TS0A 2CFMA 4JI1Q 3CAMA 1CKOA 4LFAL 2R93G 3E9IA 1QZGA 1TWHH 3KF6A 4BA1I 1DGSA 4GOPC 5IP7G 1LTLA 1W3SA 4LFCL 1XNQL 3K0XA 1NY4A 4JBWA 4GNXB 4QL5A 4NXNL 1QVGA 1L2FA 1Q82C 2HHHL 1C9OA 3CCSA 4A3DH 2YV5A 4WJ4A 1VQFA 1SFOH 5IYCH 2BA1A 1OXVA 2WB1E 4LF8L 2OQKA 4DR5L 1KD1C 2D62A 4A3BG 1I5FA 4QJFA 4A3GH 1GD7A 2HIVA 3KF8B 4X65L 2JA6G 3HOXG 1XPOA 4IJLA 2K4KA 2K50A 4X62L 2VQFQ 4EQ5A 1KRTA 4L5QA 4QY7A 4BXXH 3H3VH 4AH6A 4YWLA 3CPFA 3FP9A 2NZOA 3I4MH 3BU2A 2ALYB 3HOVH 1HNWL 3FHWA 3G6EA 1EUJA 3CCMA 4DR5Q 3KDFA 2Z0SA 3AFPA 2WP8J 2Z6KA 5BR8Q 3CD6A 1QUQB 1W2BA 5M3FG 1HR0Q 2XGTA 1VCIA 4L5TA 3UE0A 4LFCQ 5JEAJ 4R1JA 1KXLA 2JE6I 1IYJB 5JEAG 5IY0A 4AQYL 3NEMA 1V9PA 1K8AC 3S1MH 4GLXA 3AEVA 1XMQQ 2IHEA 1OXSC 5E7NA 4JI5L 3JC66 3TREA 4LFBQ 4GKJL 4AYBE 5GQOA 1C7YA 4DV1L 4UP8A 1KL9A 1N32Q 4Y52H 2D0OA 4LF6L 4KLKA 4A3JG 2MFIA 1XJVA 1YITA 1YHBA 5GAGC 2QEXA 4DV7Q 2F4VQ 2N49A 5C4XG 4FDBA 2VL6A 4JI6L 1I94L 1L1OC 1X3GA 3K80C 3M3YH 3RZDH 2K75A 5LMUL 3T1HL 2HT1A 3MEFA 1WCMH 2I0QA 1OXUA 2OTLA 4OX9Q 4RG1A 1VQHA 1TWCH 2ZJQA 2RF4A 4BBSH 4A93G 4OXPA 5FLXc 2K14A 1E3PA 5IT9c 3T1YL 3A74A 1JJCB 5LMUQ 5M3FH 3M7NA 1B7YB 1R9TH 1I94Q 2AMCB 2KBNA 3HFZB 3PUYA 4DPGA 3RN5A 1E1TA 4JI6Q 1YZ7A 3S1RH 1N8RC 5HY6A 3UE1A 1BVSA 5IWAL 4DV0L 3AFQA 1AE2A 4HJAA 4GN4B 4R4CA 5IYDG 1WFQA 2MO0A 1QZHA 5J3BA 4DK6C 1UE5A 1UEBA 4TVAB 4JI3L 4DV1Q 4A3MG 1C0AA 4JI2L 1NMFA 3RLFA 1SR3A 1TXYA 4A3KH 1I50H 2VY3A 2N8NA 4HIOA 4DUZQ 4A76A 4RMFA 5IYBH 1JJGA 5IP9G 2VQEL 1YIJA 1J5EL 4B3TL 2R7FA 2YTXA 4DV5Q 1I3QH 5M3MH 2JQOA 1Q86C 4MZ9A 2ASBA 3OYYA 5C4XH 3UDGA 3S16H 4POGA 2ZTCA 1B8AA 1QVCA 3ER0A 2UUAQ 1EIYB 4QGUA 2PQAB 4JI4L 1HR0L 4KHPQ 3PUXA 3NELA 1A63A 2WFWA 3I2ZA 4P74A 5BR8L 3J80c 4LF5Q 2PQAA 1HJPA 3J7ZC 4QIWE 2QA4A 1FL0A 1BBUA 1KC8C 1HNWQ 1S40A 3WWVA 3D31A 2ZTEA 2DUDA 3UDIA 2F3IA 3CP0A 3KJOA 1XMOQ 3PSIA 2Y0SE 3S1QH 1OTCA 4YCVA 3H15A 2Q2HA 4YWMA 2RHSB 2WAQG 3W5OA 4X62Q 1EFWA 2R92H 4O0AA 1SROA 3F2CA 2VW9A 1XPRA 1EQQA 3U58A 1PA6A 1TWAH 4DR6L 3GO5A 1VQ6A 2LSSA 3CF5A 2KHIA 3Q8DA 1HNZL 2E2HH 2JA7G 1L1OA 2NVXH 3U50C 5LMNW 2EQSA 3STBD 4BY7G 1I6HH 5EAYA 4A3DG 1JT8A 1GKHA 5C4JH 1PH4A 4L5SA 5K36G 4A3LG 4DNIA 3NENA 1A0IA 4NXNQ 3DM3A 2E8GA 3GDEA 2PNHA 4ALPA 4DAYB 4XIGS 2DGYA 5M5XH 4KI0A 1FVIA 1PV4A 4C3JH 3J81i 4LFAQ 1NMGA 4JI1L 4UY8C 1HZAA 1HNXQ 3PIPA 3M4OH 3PCOB 4JI0L 5ELOA 1SN8A 1FJGQ 2IHFA 3A5ZB 3HOUG 4IO9A 4B3SL 2XTIA 4LF7Q 2GVBA 4DR2L 1N33L 4BA2I 1IXRA 5LMNQ 1LUZA 1PFSA 4DR3L 3PF5A 1PYSB 4ME3A 4O2DA 3RN2A 4JI4Q 3EIVA 2Q2UA 3K8AA 2UUAL 4GN5A 3A5UA 1E24A 1S72A 1D7QA 3S15H 1EQRA 3PGZA 4DV5L 2R92G 4MNOA 3RLNA 4DR7Q 1A8VA 2RHQB 2IT1A 4A3CH 4C2MH 4YWKA 2VQEQ 2ZJPA 1PYBA 1J5EQ 4MTNA 3GTJH 2CCZA 4DUZL 1Q46A 1LM0A 1UE7A 4HIKA 1L0WA 4LF9L 4B3ML 3DLLA 4JI2Q 3L0OA 1MJCA 4XTCS 4JI3Q 4P72A 2IY5B
chains in the Genus database with same CATH superfamily
3ED5A 2LBOA 2XVSA 4KHVA 2RLTA 1CTMA 2G07A 3BQ1A 4I28A 4M9JA 2JEBI 2NWGA 1OXTA 4F5PA 3JAMi 4A3JH 2C9OA 3OHAA 3W2DA 3K81C 3RH6A 1EY6A 2HCFA 4QZEA 3KJPA 4BWJA 4GXJA 4J9OA 4F8RA 4DF8A 5KT4A 3GV8B 1OXJA 2NVTH 2LYAA 1RCVD 4KLDA 9ICHA 4GKKQ 1ENAA 2M9NA 3EA6A 4XQNA 4F4KA 3R2IA 2F0PA 4LF9Q 4QNLA 3I55A 2LYBA 5KYLA 2ASJA 1KEJA 4DK1A 4G7OC 4UB8U 4R8UA 1SNDA 2WV6D 1EYDA 4Y2TA 1KFDA 2PMZF 4X3TA 1ASZA 5B5EU 2R8IA 1N60A 1X3EA 1O03A 3CNHA 5C0XJ 2NYZD 5JAVA 4DV7L 2JA5H 4YMNA 1KSPA 4ED2A 1WI5A 4C8MA 2NVYB 4LK1C 5J8YC 3ISCA 1IYVA 2LM4A 2ICIA 3L3FX 3J81j 1NUCA 3SK4A 5ELFA 4YG2A 3DEPA 2VZAA 1N61A 5E4WC 3E0FA 1D8LA 4DQPA 3ORYA 1MJEA 1O7IA 2UVVA 4NLZA 4A3KG 2UVRA 2X69A 3PO2B 2WIIB 9ICMA 3L3OC 1DXSA 5FO8B 2FLLA 5IWAQ 4XQJA 4QMGA 3GIIA 3V7JA 5ALEA 4H44C 2BOSA 3GD7A 3UM9A 2A6HC 1SYFA 4JI7Q 1CQVA 2B29A 5H1SE 4EEYA 1JE4A 1MQ2A 3DUZA 1S0MA 1GUSA 3M9OB 4DV6L 2OTJA 2ESEA 2EYLA 4FVMA 2EY2A 4WFN3 4KY5A 2EYHA 4IPCA 1RYUA 2JEFA 1VS0A 5KYIA 4RQ2A 4Q0FA 2ZJRA 5CV6A 4GOPB 1RDFA 1VQNA 4YD1A 3Q8RB 3AU7A 1EOVA 2F0FA 3J80i 5DGAA 3DXJC 1QSLA 4X65Q 2ZIXA 1I6HB 4XA5A 1KQSA 4RHRA 3ZD9A 4IFDH 4J9MA 3J7A5 3HOYG 2ZIXB 3ULPA 4KY7A 2B3GA 2KNJA 3FYHA 2FMQA 5JRTA 3QEAZ 2FLNA 1WD1A 1ZQNA 2HIXA 1ZXTA 9ICVA 1V1QA 5DAUA 1PH7A 3L2PA 1PHJA 2OT2A 5K36H 4DAYA 2JEGA 1ONLA 3ZYYX 1X3FA 3NUCA 1WCNA 1JICA 1IIPA 1J2NA 4KN4A 4QZGA 1PZKD 1SRUA 2V4DA 5DBAA 3OSPA 2B2WC 4KLTA 2LHTA 4G57A 4KN7A 3R9KA 5JUMA 2XICA 4DR1L 1SKWA 1T7PA 4FP5D 4RPXA 2XRQD 2GOLA 2FI1A 1A3TA 2R7ZH 3PUVA 4POFA 2BH2A 2E5LL 1PVOA 4F5QA 2SNSA 2UXBL 2NVXB 3PO3H 1ZQOA 3TACB 2H5XA 4R4OA 4DV2L 1URJA 3KBBA 3CKIB 2UXDL 5J22A 3MVVA 2BQRA 5DEHA 2L12A 1JROA 1BOSA 4P4OA 4IALA 2C35B 4K2LA 3MR5A 2E3TA 1HZBA 3HS0C 1Q81C 3S1NH 3AU6A 4ED0A 4RGNA 3SK8A 4CJ2C 1IBML 2KP7A 3EROA 9ICAA 2DKZA 1JUDA 1STHA 1IL8A 3AMZA 5CBAE 5KFPA 4K0KL 3NASA 3DWAA 2F0HA 2K5VA 2F0TA 2QW7A 2VNUD 9ICOA 1SMYD 1VF5C 2QDLA 4F7XA 3S2HH 1M1KC 2ZJ5A 1L7MA 3HKZE 2JXJA 4MEXA 5KG5A 2XWJB 2WTFA 4PMBA 3TQYA 2F77X 2Y9TA 2ZIWA 2A69C 3PUWA 5AJ3L 3I4NB 2IBKA 4BBRH 1TK0A 5G3LF 1Y8PB 1LV5A 4B3MQ 5JU5A 4NLBA 1EIGA 1KW4A 2AUKA 2R8KA 2BDUA 1X9WA 1NK6A 2KOLA 4IUPA 4LW1A 4X64L 7ICGA 1L3VA 7ICSA 3H8JA 1VQEA 2EDUA 1W6KA 4J15A 1OO9B 1QWYA 4QZIA 5IP7H 4DR7L 2RDGA 3NTHA 1YHQA 4IL6U 5KG3A 1SWVA 5F3XB 1UE1A 2N88A 1PH2A 3OW2A 9ICIA 2BKEA 8ICTA 2KIWA 2QGQA 2BQUA 2WAQE 2VJ5A 3N7SC 2JA5G 5L1MA 1F2MA 1I4GA 1WWUA 2DN8A 5M5XB 1B3AA 3S6JA 2G9DA 4RGTA 3Q8QB 1MSGA 5C44G 5DM73 5JJIA 3NVWA 4FF4A 1EL0A 1VQ9A 5F9LA 4P0PA 4JV0A 2UUCL 1SMXA 1PVRA 3GIKA 4IZ8A 5IIIA 4B9SA 3K59A 3MXNA 2YU9H 1JRPA 4FNFA 4MIUA 2K5NA 3B6YA 1MQ3A 2A69D 4LF4L 4ECUA 3T4AC 3BDLA 3I4MG 4R4QA 4RWSC 1VQ4A 1JORA 3AM9A 3I72A 1U47A 3GFKB 4FO2A 3CC4A 1K8MA 3HOVG 3PO2G 1ZQPA 4A3KB 3BJUA 1G51A 4IOAA 2W8KA 2VA3A 2KUMA 2JA8B 4DL4A 1AH9A 4LF8Q 2KHVA 4KY6A 1NK0A 1XNSA 2Z1CA 3W1BA 4BBRG 3GTPH 4I2EA 1EWIA 3HILA 5AI0A 3EQLC 3QXGA 4JK1C 4IR1A 4ZCKA 5AM4A 1LTSD 3MGIA 1DGJA 1Z1BA 2CRXA 2FHTA 2E2IH 4FF2A 1XNQQ 5JJKA 2K32A 4YD2A 4QZHA 4KKUA 1NJYA 1VQMA 4A4IA 2JV3A 4C7YA 1NAPA 3BS7A 2XNAC 1WTPA 4JOIC 3TSSA 3M4QA 4M9LA 3ETRA 2A6EC 4H0LC 2XO7A 1VQLA 5KFCA 4DSIA 2JA6B 5IGFA 5EE0A 4J9KA 2ZTDA 1Z1VA 3PO4A 4K4HA 4NY8A 4PQXA 4BBRB 4A3IH 4OJLA 1Q12A 2ZXOA 2BCUA 5AKJA 1E22A 1VQAA 4EGVA 4UAIA 2WB1C 4X3UA 4O3SA 3PSTA 5KFGA 1A2TA 3W1GA 4JC0A 5EJWA 2KVMA 4WORA 3LDAA 2DPIA 3WU2U 3A54A 5J0XA 5HGQA 2LKVA 2RDJA 3SZ2A 1QCKA 3S2HB 2E76C 2GN5A 3KF6B 3DM1A 1H38A 2XY5A 4RUCA 1NTGA 3NQTA 5E4XA 4IFDJ 3AQEA 2R8HA 3BQ2A 3SEBA 1WCLA 4XDXA 2IL8A 2C2RA 3LK9A 2UU9Q 4J9RA 2PKEA 3RJFA 1KDCA 1TR5A 3JPQA 2I07B 3MXNB 1TWCB 2R7ZG 4DAVA 2O6KA 4DV4L 4ECVA 5J2GA 3EN2A 2K6AA 2AWOA 3PO3G 4DLEA 3TMEA 1CUKA 1DK3A 2CHBD 3LVVA 5KNCA 1XO1A 2OYYA 4DV4Q 3TZDA 1SNQA 2JZBA 3H0LB 4BX9C 4NKLA 2J6TA 1SYCA 5EKKA 1S5LU 5T14A 4KD4A 1DD2A 2XRSD 4KX5A 5IIOA 3PUZA 4AIMA 1JOQA 5BOLA 1V97A 4F91B 3EVQA 5IP9H 2MA1A 4PGYA 4GKJQ 5KFZA 5K5PA 1K1SA 1Q3UA 1BPXA 4PHEA 2PQEA 5M3MG 1YJNA 4X6AH 1VQJA 3VA5A 5DDYA 1X32A 1KQQA 4PHAA 5C0YA 2FJ6A 2B8FA 2AHOB 1JE5A 1SYGA 1NR2A 4RKLA 2ASDA 1GXDC 2F0IA 2IJ0A 3BQ0A 2WB1F 5AK5A 3TEHB 5FJ8H 4KLJA 2LYHA 2OQ0A 9ICEA 4I7ZC 1OW5A 5HP4A 2A1JB 2NRWA 1KFTA 5AI8A 2HQEA 3ERSX 1WTOA 2EZXA 2XY6A 9ICXA 3NP8A 1CA5A 4ZRZA 1T5XD 2K28A 1QZGA 3KF6A 1DGSA 1N2XA 1ZQEA 1HQMC 1U4PA 4B9MA 3RB4A 4MHEA 1QG7A 4UATA 4F5RA 3C1YA 4WJ4A 4A3DH 1VLBA 2WB1B 1D5MC 5IYCH 3SR6A 2H3VA 1ET9A 5DG8A 1S5ED 2WB1E 4LF8L 4DR5L 5D65A 3Q0AA 4R8NA 1ZD4A 2JEJA 4OIJA 2Z4IA 3SV3A 2HIVA 1HXYD 4KMUC 2ZXIA 2OEOA 3T79A 2K89A 1XPOA 4IJLA 2K4KA 2K50A 2VQFQ 8ICSA 3GQCA 3HOZB 3CPFA 3FP9A 2KCCA 1NKCA 3BU2A 2MGSA 4JV2A 3TP7A 3X3MA 3F53A 2PMZC 3RJGA 2PZWA 3FHWA 1EUJA 2Z0SA 1RJTA 1WTQA 1P7DA 8ICPA 4K6LA 3CD6A 5CMDA 3QU4A 1KTQA 1QB5D 2XGTA 4KMOB 4QWCA 3M8RA 2L4NA 1CT1D 4LFCQ 1KXLA 1KDBA 2JE6I 3C21A 4AQYL 1V9PA 3KOOA 1BPBA 3AEVA 5A2QE 4RUAA 1RM6C 1XMQQ 4Q5VA 3WK6A 5CR0A 4Y7NB 3RH5A 1T4GA 1OXSC 5AIBA 2TSSA 1JWMD 5GQOA 1GHKA 1NK7A 1TWFB 2SOBA 3DEEA 1LTGD 2WAQB 1G2TA 5BN4A 1S10A 1N32Q 4Y52H 1E0BA 3RRGA 4RA8A 1X6JA 2MFIA 1XJVA 3QJYA 4Z6CA 4Y2XA 1HIWA 4Z6DA 1O7LA 4ODGA 5CEHA 1NK9A 1SBBB 2VL6A 4E6IA 4C7ZA 1X3GA 1AP0A 3C2LA 5AM2A 5LMUL 3NGDA 2QARA 1UQVA 4MF8A 3MEFA 1JQYD 2BCQA 4RG1A 1EWCA 4CDEC 1RXWA 1RYSA 3V7LA 8ICXA 2K4IA 3KZXA 5ALPA 3F2UA 3QB3A 2P66A 2A3VA 3HZXA 4OXPA 2E74C 2K14A 1E3PA 3ISDA 3T1YL 1NZPA 3A74A 4X3SA 5ALHA 2AMCB 1X3QA 2KQ3A 4DFPA 2RDFA 1E1TA 4K2KA 3M9NB 1A0PA 5J2CA 3S1RH 2KFZA 3OSOA 2P6RA 3ISBA 4IUVA 1QZHA 3M9MB 4GN4B 5IYDG 1WFQA 2MO0A 3OW7A 5KNIA 5J3BA 3JAML 4A3MG 3OGUA 3U9OA 4C3IG 4RT3A 3TZUA 1SGGA 1NMFA 2FPKA 8ICHA 3I8ZA 4DOBA 4KLUA 4RMFA 1B50A 4ELTA 1JJGA 5KFXA 4Q45A 2EYMA 3HKZF 3KHRA 3WK9A 3V2TA 1J5EL 3NWTA 4BY1B 7ICIA 1ZQXA 1SYBA 5CV4A 2L9HA 2I1QA 5IT9L 4DV5Q 1Q86C 1S5BD 4M9GA 3D6WA 2UUAQ 3KD3A 3OSNA 1T3QA 2PQAB 1II3A 3NVVA 5IGEA 1EIYB 1T8EA 1SNOA 2F0WA 4P74A 1XXGA 2R3ZA 5BR8L 2PQAA 1HJPA 1B9NA 1CHPD 2QA4A 2HOQA 4KKSA 1FL0A 1BBUA 3IG5A 1HNWQ 2KZZA 3Q23A 3S17B 3UDIA 1A3VA 2NBFA 1JXLA 4M8AA 2UVUA 1HUNA 2DKXA 3QR8A 1FNWA 1GHJA 1SXTA 1OTCA 1ZQTA 2Q2HA 1C48A 1KN5A 2WAQG 1GOZA 2E5SA 3RR7A 3FDSA 2D5DA 4K5WA 1EQQA 1ZQHA 3MA2B 4F4WA 4DR6L 1LB2B 4ED8A 3T5JA 1FNVA 2X6LA 2Q8IB 5L1KA 4IRKA 3Q8DA 4ULLA 3MDCA 4MF2A 5AK4A 2HCIA 4V0BA 4XXEA 4C3JB 2EQSA 4A3DG 1SV0A 2G5IB 2H3IA 4DSLA 4IQVA 4JK1A 3KFUF 4XRHA 1TKWB 1X3PA 2KD1A 4C8NA 1O7YA 1QE6A 3KLSX 4ALPA 2DGYA 3LWMA 5T1GA 2XI9A 3I91A 3J81i 2E2HB 1SYDA 4XUSA 1S0NA 2IHMA 5J29A 1E2WA 1YNND 2J7ZA 2IHFA 5CYUA 4LFAL 1ILPA 3E58A 2L5YA 2ZJAA 2W9BA 1PLFA 4DXGA 5CGKA 2GVBA 3K0YA 2NZ1D 5EPKA 3W3AA 1COOA 1NK5A 2PW5A 3FEWX 2FPLA 1RF2D 5AKHA 2DUYA 2EDGA 2EZVA 3QOLA 3FKIB 3RN2A 2XVTA 4YVZA 4ABNA 2JRZA 4BUGA 2L55A 1T94A 2Q2UA 3K5NA 2UUAL 3VYRA 3RAQA 1BPZA 4NLKA 1L6NA 3OPOA 3KK7A 4DL5A 2E1EA 7ICEA 1TE2A 1EU4A 4DV5L 5AKGA 3M6KA 5KT2A 9ICRA 2FPMA 2HCCA 4MNOA 3SAFA 3RLNA 2KHSA 1ZQAA 4YWKA 2VQEQ 4LVSA 4DS5A 2CCZA 1XSPA 4I2HA 5AKLA 2BCOA 2EAPA 3L0OA 4JI2Q 3PR5B 4XTCS 4JI3Q 4FXKC 2IY5B 1SLJA 4DQRA 2WKDA 2R6GA 3SK5A 3PIO3 5DB9A 3JPPA 4K8IA 1G291 4P71A 3OTOQ 1N36L 2LXKA 3CCVA 1EY0A 4PJ0U 4NLCA 4YQWA 2VA8A 4O5CA 5DB8A 4QZFA 4ECWA 1EYCA 3NBHB 3IRBA 3J80E 3RZOH 1K83B 3T1YQ 5J0UA 2P35A 3C28A 3C1FA 3JPSA 4RQ5A 2IX1A 4YMOA 2A1AA 1JXEA 1XC9A 5CA7A 2HBMA 4UQGA 3KFUA 2I5HA 5BOMA 1Z7TA 3SR1A 5KFBA 5KFEA 5J0QA 2L1BA 4JCVE 2MU2A 4JMUA 1H9KA 3H91A 1NJIC 2F4VL 4F3OA 3G48A 3TARA 1N34Q 2PMZE 5JVG3 1K9MC 2CW0C 4LF6Q 5ALMA 5EE3A 2NN6I 4PZ8A 3BVMA 4HMJA 5LMNL 4Y2PA 4TURA 3LWUA 4LF7L 3KHLA 4C3IH 3G71A 1JN3A 1PH3A 1STAA 3RAXA 2MJ8A 2K52A 1MSWD 1F2YA 2D3DA 3UMBA 3MXPA 1X9NA 4JBKA 4EX5A 5KAFU 2DJGC 3BVGA 4QWBA 4AQYQ 3FKIH 1SE8A 3SGIA 1SYEA 2F0VA 1V8QA 2RHFA 1FIQA 1YHAA 1G2SA 2AQ2B 2PW7A 2FDRA 3RJKA 4B9VA 2KHJA 5AK3A 4TSSA 3S2DB 2HDLA 5KFTA 1TVXA 4EBCA 4I2CA 3I90A 1BR9A 1GUTA 4JYAQ 1X56A 1IHZA 4Q8EA 5C0XI 2W11A 3QU5A 1G6ZA 1LABA 1TT2A 3B0YA 1ZQMA 1UA1A 1LYLA 1WTRA 3DV9A 2DFLA 1SSOA 2G9HD 2EE1A 2JA8G 1UCVA 4CHTB 2DF4B 4LF4Q 2VQFL 2F0EA 2B8GA 4PNYA 1ICFB 1PFBA 4C8OA 4NM1A 2B2UA 1DXMA 5ELBA 1X54A 3CMAA 5B66U 2JN4A 2Z4HA 3GTMH 3SAHA 1L3UA 1N5XA 1CEZA 3VR2A 4ZK9B 3BQTA 1CKNB 4OELB 1LKYA 3N7PD 4R8IA 4DUYL 3D2QA 4JYAL 4IQUA 3SMVA 2NB0A 4KV6A 2EY6A 2F44A 4L5RC 2GVAA 1EWHA 3KDFB 3PMFA 4CKCA 4AYBC 4KHPL 1U4LA 1HHVA 2W7PA 2IX0A 4RNMA 1EZ8A 4DAPA 2L5TA 4RQ8A 3NTKA 1ILQA 4KN4C 1YNXA 1B53A 3HOXB 4WJWA 5AKIA 4C8LA 1F2LA 5AI9A 4UHVA 1ZD3A 1PTOF 4ZUIA 4X64Q 3GTQH 1PK3A 2HHWA 1VQKA 2Q0ZX 1Q90A 4DWIA 3QUQA 2KN7A 4O9MA 3BZKA 2BGWA 1ZQRA 4FBTA 4EZ9A 4RU9A 2VUMH 1SMYC 1JWSD 4F50A 3PQIA 1TAMA 1SL0A 3DWQA 4DR4Q 3WKCA 4DCCA 1LT6D 4E0DA 3H3VC 1PDQA 4QZ8A 3HOWB 1Z3EB 3KHGA 4FXGC 3RR8A 5GROA 1SDFA 4OO1H 3GV5B 1Y1VG 5FP0A 3RB0A 1YEZA 3ITPA 4R4IA 1IBMQ 1MBYA 3PV0A 5HHIA 1SAPA 4A75A 4BWGB 3AYHB 3LWEA 2HHVA 1I4QA 4NM2A 2UXDQ 2XCPA 5L9XA 3HWTA 3EBEA 3HKZB 1D1IA 3HG9A 3BS5B 5G5HA 4YCXA 1DOKA 1MI2A 3OTOL 1N36Q 1AROP 4KMUA 5KFJA 3FDTA 1KIXA 2UXBQ 5JJLA 2IOFA 5ALTA 3ZJYC 3MDAA 1S3OA 1D6EC 1UPHA 4RQMA 2XCAA 1D8BA 1CM9A 2B2TA 2EY1A 2KENA 2YYZA 5HR6A 2ZT9C 4A3EG 4CE6A 1TWGH 1ZQWA 3KBGA 3S2DH 4HJ8A 2MHVA 1IW7C 1M8AA 1PH5A 3Q8LA 1H9SB 4UPAA 3CCLA 4GOPA 2R61A 1A76A 2DGZA 1KLGD 2ZM6L 4ZAIA 2G0AA 4GFJA 5J2KA 2LPEA 2EXZA 2CN1A 3QUBA 4AYBB 1U45A 1MGSA 4NL9C 4O3MA 1S9FA 3NHHA 2F8LA 5JPMC 1DOQA 1I3QB 3UI2A 4A3GG 1DCZA 2F8KA 3GILA 1L1OB 2XY7A 1IZ6A 1GM5A 1YBYA 2JYOA 2FMPA 4HJ7A 5G5GA 1HNXL 1ZQDA 3UXOA 1EFID 1HTLD 1IBLQ 2F1MA 3OMCA 2WINB 3CXCA 4J03A 3E3XA 1XX8A 1JC7A 3V05A 1EOTA 2UXCL 4C56C 1VMPA 7ICJA 4RQNA 1KKXA 1O80A 3ZDDA 1YJWA 1QLNA 1FGUA 5AM1A 1VQOA 1L3SA 1MSHA 4KLGA 7ICOA 2H1EA 5HHHA 1XTCD 4ILWA 4MFAA 4A3FH 4DEZA 4DV6Q 2RDHA 3SI8A 3KKAA 4IR9A 2EJFC 1ZETA 2K8CB 1YZ6A 1D5XC 1HR0W 2PO4A 1X9SA 3TBIB 2Q4TA 1QILA 4JI7L 5CRXA 4DR6Q 4KD3A 4BBSB 1U4MA 2WKCA 4CF5A 8ICVA 1WVLA 1M90C 3SHLA 1U48A 4M2YA 3IFTA 2JA8H 5D3IB 4XYQA 1BCPF 4CCHA 1IL2A 1NJXA 1TWGB 3OTQA 2C5CA 3RBDA 3VCBA 2ES6A 3H40A 1S8OA 4EENA 1YT3A 3NRWA 3MR6A 1BQQT 4HIMA 4PGXA 4RNOA 3QG1A 4IN3A 4PV1C 2KEYA 1VQPA 4IOCA 2OHFA 3UXNA 5TZVA 3C23A 4DV3Q 4KTAA 1J8IA 2JH1A 1PZJD 8ICUA 2KVCA 3D0FA 1A6XA 4DSJA 4B6JA 4A3EB 1WCMG 5DLFA 1S5FD 3F8TA 4KLIA 3MC0B 4YCUA 3T13A 4ELVA 1RKNA 2F0KA 2F3WA 3Q6SA 5C0XG 3EPGA 3JAME 2B63H 2ATWA 4DS4A 1LTTD 5AICA 3HJEA 2CH4A 4YY3Q 5I6WA 1XWEA 2RVLA 5IGGA 5AKYA 4ED1A 1YNNC 2VUMG 4HJ9A 3QZ7A 4Y2RA 2N1RA 1H9MA 3ULJA 3PIOA 5E3FA 3RRHA 4R66A 5M5YH 3C5FA 3UPQA 1PZNA 3AB9A 4ECXA 2Y0SG 3RB6A 2JEIA 2W3SA 2KECA 2D6FC 2HBKA 1S5DD 1WD0A 3GTOH 5AKZA 3J7YW 3S15B 4DOCA 1U4BA 1KRSA 2WB1G 1D9DA 4DXFA 2YMMA 2Z6KC 1PH1A 4DFJA 4BXXG 1FGBD 1VDZA 2M9VA 4IJHA 4B9LA 4NXMQ 4OJOA 4MHVA 5DDMA 4OWTB 4DV3L 4RQ4A 1F9QA 4FZNA 2PYKA 1PYWD 3E5SA 1NKEA 3I4OA 4NMZA 2R92B 1FEZA 1UE6A 3PMNA 7ICUA 3BYTB 3S17H 4DR3Q 3MR2A 4OWWB 2HHQA 1FYCA 4DR2Q 1N33Q 2YMLA 3T5HA 3M4OB 3GZFA 8ICNA 4YXMA 2RKSA 4DR1Q 2UU9L 4OONA 1FJGL 1TWHB 4LNQA 4JI0Q 3TP6A 1K8GA 1STYA 2L15A 1U49A 1COKA 2CFMA 1DK2A 1BO0A 1CKOA 2CH4W 2RBMA 3CAMA 4FBUA 3E9IA 4P2HA 3KF8A 2R93G 4GOPC 2YY6A 2W8LA 4LFCL 5CC4A 3VYTA 4CJ0B 3K0XA 1PRTB 4J1MA 4UB6U 4QL5A 2E8MA 2LKYA 1QVGA 2XIDA 1N56A 1TAUA 2YV5A 1VDVA 1Z4NA 4UAYA 1S0OA 1VQFA 4GIBA 3A55A 4KKTA 1OXVA 3TAPA 3SE0A 1HFNA 3OJUA 4R64A 2J6UA 5DLGA 4XQ8A 3BDPA 4C4RA 4QJFA 1EEID 4G4KA 1AFPA 3QZ8A 2PFPA 1WTVA 4KLMA 1UNSA 2JA6G 3HRZC 3ND8A 4X62L 4EQ5A 1PTOD 4AH6A 4C1NI 2W04A 4YWLA 4G7ZC 4G7HC 3N6RA 3H3VH 4FZMA 3PO3B 2K05A 2ALYB 4C4SA 1NI3A 5DB7A 3CCMA 3HW8A 4LAAA 3TP5A 2I6XA 4DR5Q 3AFPA 3H09A 5JPNC 2BCRA 1LTAD 1X9MA 3L9AX 3ONNA 1SJHD 2B2UC 4IC9A 4X5VA 3RZDB 3C2KA 2EYOA 8ICMA 5L1IA 1DRGA 2VANA 4G3IA 1XO0A 2RSNA 5JEAG 4GLXA 1WWVA 2Z7JA 5DG9A 4BXOB 2F0NA 5J0TA 1Y1WB 3DEOA 3NTUA 5J2AA 5ALVA 2IHEA 5E7NA 1STGA 4EEKA 3LNNA 2KZ3A 7ICFA 2F76X 1KDAA 3TREA 4AYBE 4GKJL 1F9RA 5CV7A 2Y0SC 3R2TA 5FK9C 1D5ZC 4M6WB 4UP8A 1LLRD 3PMLA 1QH9A 2YQEA 5LL6S 3RZOB 5EOZA 1SE3A 5KNDA 2QEXA 4DSEA 4DV7Q 5C4XG 2NVQB 2BR0A 4JI6L 2C22A 3GTPB 1I94L 1ZQQA 2A68D 4KX3A 5TISU 4EYIB 1JR0D 2K75A 1ZQGA 4LJZC 4RCOA 2HT1A 1WCMH 2Z6BA 4CF4A 2QF7A 3G6XA 3VYUA 2V4QA 4Q8FA 3M3YB 4OX9Q 4XT1B 1VQHA 2DQNB 2EJGC 2XC9A 5C0XH 2RF4A 1WTXA 4IUQA 3AQFA 1R4QB 3D3RA 3TDQA 1YNJD 3HGBA 4M9HA 3AL0B 1DZ1A 3OIQA 5AK6A 2O5JC 1DONA 4JI6Q 3T5KA 2MUTA 3T16A 5I9PA 4LMQD 5BN3A 1R9TB 1UUPA 3AN1A 5KFYA 4DV0L 3R93A 4ZLTF 8ICOA 4R4CA 4B3TL 1C0AA 1UE5A 1UEBA 4DV1Q 1Y69U 2XGPA 5KT7A 1F77A 2FJ2A 4A3KH 2N8NA 4CDCC 4A76A 5IYBH 4U6PA 2ASLA 3NVYA 1IG6A 3FM9A 3THVA 3ZDAA 3HKZC 2XGQA 1GJXA 4N9TA 2YTXA 3V6HA 3QU2A 5FOBB 4C2MB 4HCEA 5C4XH 4MFFA 4POGA 5EWEA 1I4RA 3G6JB 2F1IA 1ECWA 4KHPQ 1MA7A 2BHNA 4I2DA 2WFWA 2IW3A 4L63B 3J80c 4U7CA 3LWLA 5FO7B 3TFSA 3J7ZC 2LS01 4PL1A 1D8YA 1I4PA 4IUUA 1KC8C 1S40A 3D31A 2ZTEA 5EPJA 1XMOQ 3CP0A 2MSNA 3RFAA 4QZ9A 3PSIA 4KN7C 5DBCA 2Y0SE 4IQTA 1N62A 3PW5A 2BPFA 3H15A 1B4FA 3MR3A 4AYBF 3EPIA 3BDOA 3GP7A 4X62Q 2HVIA 3O13A 1FR3A 4O0AA 2G06A 1V1PA 2VW9A 2BZFA 2W55A 9ICKA 4DOAA 2EPBA 1PTOH 1ZYQA 1RQLA 1SJED 2LSSA 2KHIA 2YN4A 1WTHA 2NVXH 2FMMA 1I6HH 7ICQA 1GUOA 2P5ZX 5EAYA 1JT8A 5KFNA 5C4JH 3HOVB 3D2NA 5K36G 4DNIA 2AU0A 1WG8A 1A0IA 2E8GA 1ZQZA 4JUZA 1QNKA 2PNHA 3OHBA 2NTTA 3QYPA 4RH6A 4KI0A 1FVIA 4F4XA 1PV4A 1HUMA 4C3JH 4LFAQ 1NMGA 2DWQA 1KDHA 2JHDA 4RT2A 4EZ6A 3PCOB 1EEFD 4BGDA 1SN8A 1FJGQ 3HOUG 2SDFA 5IIMA 2QKIC 4HAEA 4OHJA 4B3SL 1CHQD 4DR2L 1N33L 1SE2A 5LMNQ 3GV6A 3BS1A 1LUZA 4KLSA 1K5OA 4O2DA 2H3QA 4PZOA 2B63B 4EBDA 5DKWA 5KL1B 4GN5A 1GO3F 5J0YA 2DNEA 4C3HB 3VR3A 4YR0A 4MEYA 4DR7Q 4ZUJA 2Z9HA 3KHHA 2IT1A 4IUTA 4C2MH 4EQOA 4A3CH 1TS5A 4JWNA 8ICKA 3GTJH 4H13C 4DUZL 1L0WA 2JH7A 1QJOA 2B2YC 4B3ML 1QQ7A 4PHDA 2R8JA 5J1ZA 1BXTA 5ELNA 1HQRD 3F2BA 1NZBA 3TI0A 2PI2A 5GAHC 1BF4A 4DV0Q 2XN9C 2XSCA 3BDCA 3SV4A 3HKZG 2RRDA 4FZLA 4TUSA 2NUCA 3VYSA 2EAOA 3RMHA 2KEDA 2AWNA 2F3VA 5BN5A 2HBJA 2Y1IA 3PW4A 4PG3A 3H4BA 3FMCA 3OMGA 5LHY1 4FO6A 3CU7A 5KG1A 2K60A 1Q1BA 4YY3L 3GTLB 2KCMA 3MEHA 1SB3C 2AQ4A 5KFFA 3HOUH 4US8A 4Y2QA 3GTKH 4AP9A 1JCKB 2CQOA 3LX0A 1YNJC 2JJQA 1RL2A 2K5HA 1B70B 2EZYA 3DHQA 2C2DA 1X40A 1ET6A 2PMZB 3KOJA 8ICAA 3ONAB 1JJ2A 2M2LA 2K8AA 1EY4A 3J81E 3PW2A 4DV2Q 1EY8A 5M5WB 3J7AF 5ALIA 4R65A 2ALZA 1NBWA 4YHHL 1IM4A 4A3IB 2K8BB 4A3CG 1NKBA 5J0WA 3HOYH 2DNCA 3D6JA 1EYAA 1GUWA 1Y1WG 1FD7D 1L0YB 2VKQA 1H95A 3HT3A 4Y2UA 5FLMG 1Q3VA 4ACOA 1VQ5A 5GADC 3F1ZA 1UAPA 4GC7A 4DSKA 1EY7A 4HCSA 1NNXA 1RDPD 3PO2H 4F87A 4QB4A 2BDNA 3I7FA 3IG8A 1F5SA 1E7ZA 3CCQA 4A8EA 4GXIA 3MTSA 3OPXA 1VQDA 1Z00A 5CJ7A 8ICBA 1BNPA 2I5LX 3Q8PB 2J0TD 2JSOA 1JALA 1RG6A 2BCVA 4HAIA 2GO7A 2AKWB 3RB3A 1T3NA 5IIKA 1VQCA 2W54A 3P7JA 1ZRNA 3UXPA 1BDOA 2HVHA 5J2DA 2W3RA 3N97B 1R4PB 4ID6A 3C46A 3CQZH 3TADC 1PK1A 2VB3X 2VS1A 2ODGA 2AXTU 2OWOA 1QQ6A 5EKLA 3UDXA 3L5KA 1XU4A 4PMWA 1SNMA 4DA2A 3VA7A 4TQRA 4O3RA 4A3IG 2OF1A 2KVSA 3OIPA 2ZIWB 1Y1WH 4WJ3B 2QILA 4LF5L 4KTQA 1X65A 1AZQA 4HJ5A 3MABA 5J2FA 2R7DA 1PZID 4CJ1B 4EBEA 2HHHQ 2KFNA 4Y7NH 3CCEA 2PFOA 4GS3A 1VQ8A 5DQHA 1SV0C 2VJ4A 2RQ5A 4F71A 1LTRD 1TY0A 3C1ZA 2SEBD 1NE3A 2ZM6Q 3NPPA 3H0MB 2LI6A 2Q2TA 3K4GA 3K7AB 2WF5A 1UT5A 3UQ0A 1FNUA 1Y8NB 2Y1JA 1VJ5A 5KFRA 2BQ3A 4K6DA 5IT9E 2ZUDA 5AM5A 1B0XA 4NLGA 2HHUA 2AQ1B 3K6OA 5I2XA 5KIXA 1YJ9A 1O78A 1ZQSA 3P1HA 4DO9A 4I2JA 2K5WA 9ICGA 4X66L 1Q8KA 2HQLA 4PZ6A 2KICA 2BH8A 5C4ZA 2NRXA 5KG7A 3GDXA 3J81L 1B4OA 3HKSA 1VQ7A 3GTKB 3T51B 1STNA 4HIDA 4QIWC 4O42A 1RXVA 4NP5A 2W7OA 2RCNA 3NBHA 2W9MA 1JB3A 4G9BA 1L7PA 2RCFA 5J2JA 2D8CA 2MNAA 2D0PA 1K1QA 4JB3A 2V1CC 3M6ZA 2HUGA 3M9BA 2KE7A 3IL8A 4DKAC 5C44H 3M4PA 2A8VA 4YR3A 4IFDI 1F2ZA 4ECYA 5HR7A 5AM3A 3DMUA 4M9NA 4K14A 4DL7A 2DL0A 4UAUA 4P2CB 4UDUC 5JJZA 1CA6A 4QZBA 4YP3A 3IKJA 9ICLA 3TP8A 3GU3A 4BDPA 3T1HQ 3CCRA 3UQ2A 4Y2YA 2R7ZB 4TQUS 3PF4A 5J2IA 4B9TA 3AQQA 2MUTB 2HBLA 5NUCA 1ZQYA 1YI2A 1MIUA 1N32L 1U9LA 3A0JA 4JV5Q 3TADA 3Q8KA 4P0QB 3HP3A 4XQQA 3U4ZA 1D1KA 3C3LA 5KTQA 3QU7A 4RQ7A 3MFYA 1SL2A 4EYHB 4PMCA 4RQ0A 3F5EA 2E8NA 3URYA 5AKXA 4F2SA 1D9FA 4QW9A 4ECTA 1G8ZD 4QWEA 3RJEA 4JI8L 2NTSA 2FINB 5IYCG 5ALKA 1HCZA 1STEA 3S14B 2JGAA 4BY1G 4QIWF 1N5WA 3CQZB 3CCJA 3ETLA 1EXNA 3HPOA 4QQBX 4B3SQ 2QLTA 2EY5A 2GWSA 3S16B 1K0RA 2K5QA 5M5YB 4PHPA 1P8LA 5J39A 3WK7A 5KT5A 1X6OA 5FLMH 2WF9A 4O5KA 5D3DA 2JMGA 4KLHA 4LZDA 1TK5A 2PI5A 5BPCA 3MBYA 4NLNA 4B9WA 2K33A 3DDHA 2P6UA 5COYA 4ECRA 3RNUA 1Z9FA 5KFAA 1XSLA 2BCSA 3PZPA 1ZJMA 2O4XA 1LTID 2YTVA 4MTKA 3U9SA 3S1QB 2CVRA 4I65A 2FMCA 1X55A 1K3RA 4Y2VA 1QUQA 3NRZA 5AI6A 1TFRA 3D8GA 5C3XA 3TS2A 3E6ZX 2E2IB 2NVTB 1S0VA 4JOIA 1K73C 5ALWA 1LVHA 1MKHA 2NZHA 5J8YA 2UXCQ 3BVZA 3GTLH 4L6TB 4I27A 9ICJA 5D14A 1IBLL 4A3FB 2TMPA 1U0LA 2K03A 1MC8A 2ZG6A 3VC8A 4NPSA 4BJQA 2W03A 1M6YA 3A8KE 2ICEC 8ICIA 4UB2A 3CCUA 3P75A 4DL2A 2E8PA 5EE1A 1QOHA 3K5MA 5KFUA 3WK4A 1NK8A 2KA7A 3GIJA 2SNMA 4OWXB 4BY1H 2JA5B 5CV8A 3HEJA 4IFDG 1XNRL 3R3OA 3FPPA 4GNXC 2KSOA 4UW9A 3GTJB 5EWFA 4QJFB 2JK8A 2NVQH 4OO1I 2JXMB 5I9OA 3CRLC 3FAHA 1ESRA 1TS3A 4RHSA 4JPBW 4UBBA 3DWPA 3JAMc 2JEAI 1QVFA 2F0MA 7ICLA 1CSPA 4MFCA 1Q1EA 3MHBA 3ZI4A 1KHIA 5L1LA 1NR4A 4C3HH 3L4PA 3EUB2 4Q44A 1ZQIA 5FJ8G 4GNXA 3CC2A 1JOKA 1UT8A 1TY2A 1IBKQ 3J80L 4A93H 3GTGH 1MN8A 3EJIA 4BBSG 3QEBZ 3A56A 2YTUA 4M0AA 1HRJA 1K83H 1ENCA 2EH9A 2YB1A 2KOBA 3D4RA 3K7UC 4HSVA 3S1MB 4O0IA 4CDFC 5ALDA 3IN5A 2QKQA 4DGZA 2UUBQ 4X3KA 2ZIUB 4FYDA 3NWSA 5KAIU 1SIJA 2F03A 4GZYC 2BA0A 5IYDH 4NWIA 5J0SA 5A35A 4NJ8A 4A3MH 2UUBL 4IS7A 1JMCA 2FLPA 3QNMA 5CORA 2OEHA 1HEKA 4FF1A 2D2CC 4KLEA 1IBKL 9ICNA 3WDNA 7ICPA 2O5IC 4LWCA 3MGHA 3H94A 1WUDA 3U4VA 1QQ5A 4DL6A 2M0NA 2O2LD 1A3UA 4LUZA 3SK6A 3I4LA 3HOXH 3A8IE 1LACA 2WAQC 4K5XA 2A6HD 3RR5A 4U68A 5ALXA 2HD3A 1I6VC 3PSFA 3IHQB 3KZIU 5D4BA 1RZTA 1B44D 1EU3A 4B3RQ 4TQSA 1XNRQ 8ICZA 2F0JA 1XTDA 2EZZA 3IP4B 4FXDA 1G6PA 3N28A 4IQWA 3GTMB 3T53B 4Y2SA 4NB3A 2C28A 3ZDBA 5KFDA 1BKBA 1Y14B 2BPGA 2QB0A 5KFOA 3ZDCA 4JI1Q 1TQOA 9ICFA 5KG2A 4YFKA 1ZQJA 4F4ZA 2J4XA 5IP7G 1W3SA 1XNQL 1SZPA 4JBWA 4GNXB 4NXNL 1B22A 1L2FA 3ICXA 4EQNA 1H9RA 5DG7A 1C9OA 1Q82C 9ICQA 1SFOH 2B2TC 1EQVA 2EOTA 4IURA 2KSOB 5HGTA 2OQKA 5JVH3 1KD1C 5EWGA 3G6YA 8ICRA 3D6CA 5KFMA 4ZYSA 2F0QA 1ZQLA 1KBUA 1GD7A 3KF8B 1FFUA 5C3EB 5ALRA 3HOXG 1HA5A 4B9UA 1AQ6A 2IOFK 3GTOB 1GUGA 4ZOHC 4YXJA 3HP6A 5M3FB 2WFAA 3FPUB 3I4MH 2QB1A 3FC4A 5IIJA 3CYMA 5KFHA 3HOVH 1HNWL 3PX4A 3G6EA 2IMWP 2B2VA 3KDFA 3MXGA 5KG0A 3RUZA 2Z6KA 5BR8Q 1QUQB 2K5DA 4N8X1 4RGOS 3H4DA 4FS2A 1Q8IA 5M3FG 3H6MA 4HR7B 3MXUA 1TWAB 1VCIA 2K4PA 4L5TA 3UE0A 1HR0Q 3PX0A 4NXZA 1TS4A 1L3TA 4M04A 4ECZA 4I2GA 5JEAJ 3Q24A 1IYJB 5IY0A 3NEMA 3S1MH 2JZBB 4RQ1A 1PTOC 5KFVA 4QWAA 5AI5A 4RFBA 2QDBA 3JC66 4LFBQ 3B0XA 1CRXA 2RQXA 3WKBA 4DFMA 2ZJ8A 4N8FA 1SXEA 1RTNA 4CRXA 2F0LA 2D0OA 4LF6L 4KLKA 3SDZA 2X6GA 3NVZA 3WKAA 1YITA 4DL3A 4USAA 1YHBA 3VR6A 1ZD2P 1BPDA 5GAGC 2HDOA 4OGQC 3N7RC 4DNRB 2F4VQ 4O3NA 2N49A 4FDBA 3RBEA 2HHTA 2CW0D 5L37A 1DJRD 1IW7D 1L1OC 3K80C 1IYUA 4S3SA 3T1HL 3WOFA 4LJXA 1SE4A 5G3LD 4J9LA 5D49A 1C4QA 5FKAC 1HFGA 2LMCB 2DPJA 4M6WA 3RJHA 1QCBD 3KLRA 4C3HG 5KNBA 1TWCH 2ZUBA 2W9BB 4TUPA 4QUCA 3MFGA 4CBVA 4BBSH 3F5AA 3EYZA 4RKBA 4A93G 5FLXc 1TKDA 3ERQA 5LMUQ 5M3FH 3GQBA 4DN4M 2KBNA 3QUCA 4UB3A 4BXOA 4I2FA 3HFZB 5EBCA 3RN5A 1KRPA 4QZDA 1PH9A 3PNCA 3N52A 5I6YA 1YZ7A 3HOUB 4DFKA 1N8RC 5HY6A 3CP8A 1BVSA 3EFXD 4PZNA 1RODA 3UE1A 1D2BA 4HJAA 3WK8A 1N48A 3G7LA 2LY7A 3ALRA 4TVAB 3KTQA 4JI3L 1ZQBA 4JI2L 1SNPA 1I50H 1TU2B 1ZRMA 2R8GA 4C80A 4ECSA 4JVZA 4OEMB 4EVOA 1NJZA 4KLOA 5IP9G 2VQEL 3MFIA 1SFOB 2R7FA 3NBIA 3Q8SB 2W9CA 2ZXRA 5H2FU 1I3QH 1L7OA 1S77D 7ICRA 5KFSA 2I46A 3H0GB 3ND9A 4IQZA 1PRTF 4MZ9A 5M3MH 1B8AA 1QVCA 3ER0A 3WKEA 4QGUA 5EBDA 2KIVA 1HR0L 3PUXA 3NELA 4JI4L 1PXUA 3I2ZA 4QIWB 1KTKA 4LF5Q 1TIID 4QIWE 3I4MB 2WF6A 3WWVA 2F3IA 3PVXA 3P20A 3UMCA 3WK5A 3A0HU 4YWMA 2KG5A 1U4RA 3W5OA 3PW7A 2OM6A 4I2IA 4A3GB 2E2JB 1SROA 2NRZA 3RJIA 2IA6A 4A3DB 1TWAH 3IDWA 7ICMA 8ICGA 3CF5A 2JA7G 1F44A 1JOOA 2YU9B 1L1OA 3NK9A 3U50C 1ZEQX 5LMNW 3STBD 4BY7G 4UB5A 4ICAA 2KJ5A 4OD0A 5KG4A 1PH4A 4A3LG 4US9A 3NENA 2IPKD 4NXNQ 3DM3A 1UHUA 4DAYB 5M5XH 3E2EA 1Y8OB 2MP1A 3PIP3 5AM0A 3RF9A 4JI1L 4UY8C 2PNRC 4TKOB 1HNXQ 2PFNA 1BCPC 3M4OH 2B6GA 4UAVA 2PCFB 5IOCA 3SD7A 3NTIA 2AQ0A 3A5ZB 3SYZA 3SENA 4IO9A 4HTHA 2F0UA 4BA2I 2ZXHA 5KFKA 4K8JA 4ED3A 3J7AV 4L8JA 3PF5A 1VF7A 1K28A 3FRPB 4N9PA 4P4MA 5F9NA 4JI4Q 1S97A 1XWLA 3K8AA 2FE9A 3NQIA 4KITB 1F9PA 1STBA 1NOMA 5ALSA 3BS5A 2BE5D 1S72A 3S15H 1WTWA 5GTIU 1BCPD 5J0PA 2RHQB 4RGMA 1J5EQ 2ZJPA 4YR2A 1PYBA 1PFMA 5JOBA 1AZPA 4UB1A 3I70A 4MN3A 3CRXA 2MUYA 1CK1A 1Q46A 1LM0A 5C4JB 4HIKA 2XIWA 1ZQVA 5C4XB 4LF9L 5ISRA 2EAMA 1E2ZA 1MJCA 1J97A 3F2DA 4P72A 2NVYH 4F5NA 3K5LA 4GKKL 4A3LH 3C1EA 3MGVA 1PH6A 3ZD8A 3IV6A 4QW8A 2F0GA 1L7NA 2CKZB 4ZQ3A 5DM63 1ZYRD 2I0QA 2G5DA 1I50B 3D4WA 4DF4A 2HHXA 2LFNA 1BNZA 2BPCA 2KHQA 1KABA 1U5KA 4APVA 2GH1A 3E9HA 2A19A 4DU9A 3T5LA 2K04A 3T56B 4NDXA 1G91A 1TAQA 3PW0A 9ICCA 1PH8A 3PV8A 4J9QA 4GLAC 2NRTA 5J0RA 1QTMA 1EIFA 1ENFA 1RQNA 4IUNA 2A1JA 3M8SA 2OCEA 2UVWA 1DYQA 4UASA 2G09A 1HPCA 2A5HA 4RQ6A 1PUZA 3H3VI 3QU9A 3OWEB 1CQFA 5M9OA 3EW9A 4OCZA 2PFQA 4CGZA 5ALOA 1ZJNA 1V1PB 4CDDC 4DR4L 3I28A 4O3OA 2F52A 1KNAA 2FFKB 2CWAA 2WHEA 2GA4B 3V96A 2RDIA 3SQIA 4P0QA 1IKMA 4GLVB 1E1OA 3KLWA 4Z9CB 1LV9A 1CI4A 1ZXIA 1WYDA 4LFBL 1A6SA 1HZ9A 4P73A 1LTBD 3HOWG 3RH4A 2MO1A 5CHGA 3NXWA 3S1RB 4C3IB 4KHZA 4FFDA 2K4HA 3S14H 5ALLA 1ZQFA 4V190 5E79U 2CWPA 2EQYA 1EIHA 1PVPA 3JPOA 2RSOA 4LUOA 5DB6A 2M00A 3LYSA 1L0XB 4A3FG 3TRZA 3B9JA 2KZMA 4PZ7A 3VDYA 5AKKA 2XWBB 1WCMB 2RP5A 2EANA 1RIPA 2FXQA 4DUYQ 5IILA 2R93B 1N9WA 4NL9A 4RCNA 5EQ0A 1HNZQ 3HOZG 1PMRA 2KTQA 2ID0A 4UAWA 2AQ3B 3QX7A 5M5WH 3EWAA 4H02A 3EZ5A 4XT3B 3SVMA 2ZUCA 1GO3E 3I4NH 1FFVA 1WJJA 1JIHA 4QZAA 8ICFA 2E2JH 4UBCA 3C2PA 4QZCA 4UP9A 1CKMA 2W43A 5IE8A 1CKNA 4OO1G 4CKBA 1RTOA 3ULLA 1XMOL 4YCWA 5CP2A 2ISOA 2Q2IA 5LL6X 3J81c 4A3JB 1DM0B 4RAUC 4BY7H 4GXKA 5DQIA 1HTPA 3HOWH 1BGXT 5CV9A 2F1HA 2N78A 3A0BU 4LUVA 1SWWA 2F1JA 1HZCA 1Q3LA 5EE9A 1VMCA 3CC7A 2E2DC 2PI4A 4K5VA 2NYVA 3H0GG 3MC1A 1F0MA 1ZQCA 2CQAA 2DY8A 3KYHC 1VQGA 4J6HA 4F4YA 1BPEA 1ASYA 2DY7A 2VUMB 1ZD5A 5DQGA 5J2EA 5IINA 4F88A 3ZDEA 4B3RL 4ED6A 1RYRA 2K7VA 4B3TQ 5AJ3Q 4P4PA 3HOZH 2BE5C 4OL7A 3PX6A 4JBMA 2W9AA 3STBC 3S9WA 1GVPA 5ALUA 1VQBA 2EIFA 3L7ZC 1ZOLA 1N34L 5ALQA 3MAQA 1ESFA 2PI2E 1PTOB 5KFIA 7ICHA 1J6QA 2WAQF 5KFQA 3T3FA 8ICQA 2B39A 1A77A 4R4TA 4BY7B 3MZ5A 4K0KQ 4OJ6A 4KLQA 3Q8MA 4ELUA 1SZHA 9ICUA 2YTYA 2E8OA 2YMQA 1N63A 3H8MA 4RZRA 1UWVA 2MAXA 4ME5A 4OX9L 4OJ5A 5C3WA 2E1FA 3SEIA 2F3NA 5A0LA 2ENBA 2YB4A 3S24A 1S5CD 1V85A 3BQ7A 5AHXA 2YMPA 2DBYA 3CPWA 4DQSA 2YX8A 2B21A 2PZUA 4J9PA 2E75C 2JA7H 3QOJA 1EYGA 3M85A 2A68C 1BPYA 4P75A 3H0GH 5IGBA 1KLNA 5M3MB 1L5UA 5GAEC 3BZDB 3H7IA 2A6ED 4DNTB 4QCLA 3K7AH 4O3PA 2Z8LA 5AFWA 3WKDA 5CR3A 5FO9B 3TKAA 1CSQA 1H9SA 1VQIA 9ICPA 5IIFA 3K57A 1AN8A 2ES2A 5ELDA 4JI5Q 1KAWA 1V1OA 5DGBA 1WOCA 1PVQA 1E2VA 2IWHA 3NUQA 5KEEA 4A93B 4JBJA 2R93H 1TS2A 3I3CA 1B2TA 3RLOA 4NV0A 5AI4A 5C6AA 4UP7A 2Y0SF 1HUOA 1Y1VB 2K01A 3G4SA 2N3SA 3JPNA 2G5HB 4DLGA 1BBWA 2F4IA 4F72A 2DJFC 2V9WA 1CZGA 5EGTA 5E1FA 1LT4D 7ICTA 1CZWA 4YMMA 5DLQE 4B08A 4F5OA 1S4ZA 3I73A 3QIAA 3V6JA 1IV8A 2HSZA 1O08A 1NNLA 1YVCA 3I76A 4U673 2ATLA 2JA6H 2OH2A 3TFRA 3PO5A 2OXOA 4WRDA 1IKLA 4WJ3M 3SXHA 1T9HA 4FE3A 2AGOA 1I4HA 2L11A 1T5EA 8ICJA 1SKRA 1KNEA 1Z47A 4DK3C 3FKIG 3E0EA 2KKPA 5C5JA 1JWUD 1LO5D 5I4DA 1ED1A 1XMQL 1CFMA 4DFAA 3BYYB 2JA9A 1UEAB 4BS9A 3CW2C 3O0FA 5J2BA 4XYOA 3IM1A 3MWYW 5ALZA 5ALFA 1TK8A 4GN3B 2W9CB 4M47A 4A3EH 4KJOA 2MQHA 2LXJA 3IFDA 5K4LA 2KJ8A 4ECQA 1ZQKA 2IHNA 1P16A 1Z6HA 2WACA 1X2IA 1TWFH 2HOIA 3FVQA 4IPDA 2KMDA 2JP1A 1U9RA 2B2VC 1TVAA 4JWMA 1BNOA 3I4NG 1V38A 5JTIA 3D2SA 1OXXK 2UUCQ 2I5MX 7ICKA 1ZKOA 2B0CA 4PL2A 3QWNA 1LKYB 2EYJA 3TAQA 5C3EG 2IOHA 1PRTC 4DAMA 4HSPA 1Q7YC 5HMLA 1JB7A 3U26A 2NO5A 3HX0A 2C2EA 1K3BC 4PGQA 4JG2A 4B9XA 3JPTA 2A74C 4JI8Q 4YHHQ 4NXML 5IGCA 1UA0A 8ICCA 1QSYA 3TN2A 1BUVT 2KCTA 2PXIA 4O5EA 1WYGA 5ELCA 2ZIVA 3LGJA 1XPUA 3D4DA 4C4TA 5KGUA 2F0OA 3K1ZA 3BJYA 3BZCA 3S1NB 4JV5L 4DK0A 4Z6EA 1XYIA 4AYBG 4M1UB 9ICTA 4K4GA 3PSPA 1OUQA 1BBXC 1X42A 3AMUA 1B9MA 2AUJD 2B2WA 2HW3A 2HMXA 3NSWA 5C3EH 3OWFA 4FS1A 4I2AA 3Q22A 4J8QA 3H8WA 4HN7A 3M7DA 1L8OA 1A62A 1X6IA 3NE5B 3JPRA 5EPLA 3AUOA 5KT6A 5IYBG 1K8OA 1ZQ1C 2NN6G 4A3BH 1Y1VH 3UDFA 1X9XA 3K1RB 1EY9A 2WF8A 5CBEE 3GTQB 1NJWA 3CMEA 4DF7A 3R8BA 2KJ9A 2HHSA 4B9NA 2G08A 1AE3A 1V43A 1W6JA 2QCPX 3OHXC 1HH2P 3IRUA 1SKSA 4CNQA 3GV3A 4IPHA 2QARB 2L0CA 3SAGA 1ZQUA 4EELA 3GTGB 1JMSA 1KLUD 4J9SA 3RTVA 2E5LQ 3RD4A 3OOCA 3ICEA 4EQPA 4X66Q 4JV1A 1SXDA 4R8UB 2EYPA 2B63G 4CF3A 2KK0A 5C5MA 2LMRA 2EXDA 1L8LA 2ZIUA 4IPGA 4F93B 1FO4A 3I56A 2MRLA 1EZ6A 2WF7A 3KKAC 3TS0A 1M4VA 3KBXA 7ICVA 1PFNA 3V6KA 2VA2A 2K1BA 1TWHH 2HOFA 4BA1I 1DOMA 1LTLA 1NY4A 1EQTA 3VR4A 5J2HA 2HHHL 3CCSA 1XS9D 4H7BA 2Q8TA 1Z19A 2BA1A 3A7AB 1C8CA 5C44B 3VR5A 2D62A 2NN6H 4A3BG 5I2YA 2QB0B 1I5FA 1Y88A 7ICNA 2BDOA 4QUFA 1SL1A 4HYKA 3MFHA 4A3GH 4X65L 2BDPA 1TV9A 1ZYRC 2JA7B 1GUNA 4BXXH 1KFSA 1JX4A 2B2YA 1KRTA 4L5QA 4QY7A 2EYFA 2F0DA 5KT3A 2KV2A 8ICWA 2PZTA 4Q43A 4A3BB 2H4OA 2AGQA 2NZOA 2ISPA 3NS1A 1AW7A 2AGPA 4TUQA 4CGYB 1RPLA 3E0JA 2WP8J 4A3MB 4LZGA 5DBBA 4KLFA 5KRUA 1J9OA 5T1IA 5FLXE 1W2BA 3LVWA 4ZKBB 1A15A 3K75D 1PK1B 4R1JA 3TANA 3WOEA 5ALNA 4ED7A 1H9JA 1ML0D 2F2AB 5DNFA 5F2DA 4OJPA 1K8AC 1K0SA 2NO4A 5HMMA 4K4IA 1KAAA 1SNCA 2MPMA 4UARA 1B3QA 2NRVA 4JI5L 1J2MA 3V7KA 3M7GA 4HEDA 2CPRA 1C7YA 4JW0A 2GLEA 5ALJA 4ZH4A 4DV1L 1QNUA 1KL9A 4EX6A 5CWRA 4UAZA 4PH5A 4A3JG 5CV5A 4P0PB 5CB1A 2AH5A 4I29A 3N4MB 3PY8A 4F2RA 2Q8RE 2KEEA 5ALYA 4KLLA 3M3YH 3A7LA 4RPYA 3RZDH 3C29A 3A8JE 2PPBC 1B1ZA 4CDGA 3QUTA 4CKEA 2AJQA 4YIJA 1A2UA 2H3ZA 1OXUA 2H3FA 4EX7A 5FLXL 2OTLA 2ZJQA 4FF3A 3TQ1A 5KFLA 4GC6A 3M1YA 5IT9c 4DQIA 1HA6A 1JJCB 4RNNA 3C2MA 8ICLA 1B7YB 1SEBD 2V4RA 1R9TH 1MD2D 3M7NA 1I94Q 3PUYA 4DPGA 3AU2A 2VB2X 4DQQA 2A73B 4R9WA 1B43A 2R18A 4I2BA 5JEAH 5HURA 2OXPA 3KUPA 1DOLA 5IWAL 3AFQA 1AE2A 5ELEA 2KCNA 4DK6C 5AKEA 2J6SA 3RLFA 1SR3A 1TXYA 1EY5A 2VY3A 4IRDA 4DUZQ 4HIOA 3HOYB 1LT5D 1AEXA 2F0SA 4PPXA 1CI3M 2HI0A 1YIJA 2Y9UA 3QE9Y 9ICBA 2FMSA 1ICWA 1MHWC 4BWMA 2I9GA 4C3JG 2JQOA 3CRKC 2ASBA 3OYYA 3C5GA 3UDGA 4RPZA 1C20A 3S16H 2ZTCA 2ZXPA 4O3QA 8ICYA 5EKIA 1A63A 3X3NA 5IODA 1XSNA 5GTHU 2EVBA 4Y2JA 5D46A 1S76D 1HUZA 9ICWA 5KG6A 3GV7B 2DUDA 3KJOA 4ZKCB 3H8SA 4F8MA 2K4EA 3S1QH 2KJXA 3K5OA 4YCVA 4DFDA 9ICSA 2RHSB 1EFWA 3GIMA 2R92H 2EJMA 4RQ3A 4QWDA 3F2CA 4C8KA 1SV4A 2Y0SB 1XPRA 3CHBD 3QO2A 4O1NA 3U58A 1PA6A 2QEJC 3GO5A 1VQ6A 4IRCA 3G6VA 1I4XA 4I7AA 5KL8B 2E2HH 1HNZL 5C5LA 2VIXA 4C1NK 2CXYA 1JI7A 3V72A 2IX3A 1NCVA 1GKHA 4L5SA 2VXWA 4KJNA 1PRTD 2NV3A 1Z4OA 1QSSA 1RD9D 5IGDA 5KFWA 3GDEA 4HMIA 4R63A 4XIGS 4Z6FA 5J0OA 1BCPB 2LM1A 3BG3A 4YN4A 3I1YA 3OJSA 1HZAA 4OO1J 3PIPA 4JI0L 5ELOA 3K58A 4DSFA 2HDMA 2RA4A 3IAYA 1LT3D 5C4HA 2XTIA 4LF7Q 1IXRA 1Z00B 3M4YA 1RHPA 1O7ZA 4F92B 1PFSA 4DR3L 4OIKA 3H0RB 3RJJA 1PYSB 1F9SA 3KLSA 4ME3A 2KKVA 1NK4A 2JR5A 1NSNS 3EIVA 3A5UA 1E24A 5A2QL 1D7QA 2D9UA 5ALGA 4UB4A 1EQRA 5TSSA 3PGZA 2R92G 4NW2A 5L1JA 1X66A 1A8VA 3HRDD 4KK7A 5HNKA 4MTNA 2N55A 5AIAA 1UE7A 3UMGA 4C0ZA 3DLLA 4J9NA 4QF4A 3PR4A 8ICEA 2ZIVB 4TRDA
chains in the Genus database with same CATH topology
1SLJA 5ELNA 4GKKL 2PI2A 2R6GA 3F2BA 4A3LH 2JEBI 4DV0Q 1PH6A 5IWAQ 1G291 1OXTA 3HKZG 4P71A 2CKZB 3OTOQ 2LXKA 3CCVA 1N36L 4A3JH 3JAMi 2AWNA 3K81C 3NBHB 4PG3A 3IRBA 1U5KA 3RZOH 4APVA 3KJPA 3T1YQ 4YY3L 2NVTH 4GKKQ 1Q1BA 3E9HA 2A19A 2KCMA 3HOUH 2IX1A 4LF9Q 2A1AA 3GTKH 2CQOA 3I55A 1PH8A 3KFUA 2I5HA 4GLAC 2JJQA 1EIFA 1RL2A 1B70B 2K5HA 2OCEA 1ASZA 4JCVE 3KOJA 1X3EA 3H3VI 1JJ2A 5C0XJ 4DV2Q 1NJIC 4DV7L 2F4VL 2JA5H 4DR4L 1NBWA 1N34Q 1WI5A 3G48A 4YHHL 2F52A 2PMZE 4A3CG 2CWAA 1K9MC 4LF6Q 3HOYH 3J81j 2NN6I 1E1OA 3KLWA 4GLVB 4PZ8A 1Y1WG 5LMNL 2VZAA 4LF7L 1D8LA 1WYDA 1MJEA 4C3IH 3G71A 1O7IA 1PH3A 4LFBL 1H95A 4A3KG 1HZ9A 2K52A 5FLMG 4P73A 1VQ5A 5GADC 3F1ZA 1X9NA 4JBKA 3HOWG 2MO1A 4EX5A 4KHZA 4AQYQ 3FKIH 1SE8A 3SGIA 3S14H 3PO2H 2CWPA 3I7FA 3GD7A 1YHAA 4JI7Q 1E7ZA 4LUOA 2B29A 5H1SE 3CCQA 2KHJA 4A3FG 3TRZA 1VQDA 4PZ7A 3VDYA 4DV6L 2I5LX 4JYAQ 2OTJA 4DUYQ 1RIPA 1X56A 2FXQA 1N9WA 5C0XI 1HNZQ 3HOZG 2AKWB 2ID0A 4IPCA 5M5WH 1LYLA 1VQCA 1VS0A 4H02A 2ZJRA 1VQNA 4GOPB 1GO3E 2JA8G 3I4NH 1EOVA 4LF4Q 1WJJA 2VQFL 3CQZH 3J80i 2E2JH 4UP9A 2VS1A 4X65Q 1CKMA 5IE8A 1CKNA 2OWOA 4OO1G 1X54A 3UDXA 4PMWA 1KQSA 3CMAA 1XMOL 3ULLA 4YCWA 4A3IG 3GTMH 2Q2IA 5C3EH 3HOYG 3J7A5 1CKNB 3ULPA 1Y1WH 3J81c 4DUYL 4JYAL 2B3GA 4LF5L 1X65A 4HJ5A 2R7DA 2HHHQ 4L5RC 2GVAA 2HIXA 4BY7H 1V1QA 3KDFB 4Y7NH 3CCEA 1PH7A 3L2PA 4GS3A 1PHJA 4KHPL 2IX0A 1VQ8A 3HOWH 1X3FA 1PH9A 2ZM6Q 2N78A 4LUVA 1NE3A 1SRUA 1HZCA 3CC7A 1YNXA 2Q2TA 3H0GG 4X64Q 3KYHC 4DR1L 1VQGA 3GTQH 1YJ9A 1ASYA 1VQKA 4X66L 1Q8KA 2HQLA 4PZ6A 2R7ZH 4B3RL 2BH8A 3BZKA 3PUVA 4POFA 5AJ3Q 2E5LL 1VQ7A 4B3TQ 2BH2A 3HOZH 1PVOA 3HKSA 2VUMH 4JBMA 3STBC 3PO3H 2UXBL 1GVPA 4HIDA 1VQBA 2EIFA 3L7ZC 1N34L 4DR4Q 2H5XA 2PI2E 2RCNA 4R4OA 4DV2L 2UXDL 2MNAA 2V1CC 2D0PA 1J6QA 3M9BA 2C35B 5GROA 1HZBA 4R4TA 1Q81C 3S1NH 4DKAC 1Y1VG 5C44H 4K0KQ 3M4PA 2YTYA 1YEZA 1IBML 2A8VA 4IFDI 3CCRA 1IBMQ 1UWVA 4R4IA 4OX9L 4K0KL 3PV0A 4A75A 2K5VA 3S24A 3AYHB 3T1HQ 2VNUD 3S2HH 2UXDQ 4TQUS 3PF4A 3CPWA 3EBEA 1M1KC 2JA7H 3AQQA 3HKZE 1EYGA 3OTOL 1N36Q 3M85A 1KIXA 4P75A 2UXBQ 5JJLA 3H0GH 1YI2A 3TQYA 5GAEC 3PUWA 5AJ3L 1MIUA 1N32L 4JV5Q 3A0JA 3ZJYC 4BBRH 3K7AH 1S3OA 4B3MQ 1CSQA 2YYZA 1VQIA 2KENA 3U4ZA 2ES2A 4GKJQ 4JI5Q 4A3EG 1KAWA 1TWGH 4X64L 3S2DH 4LW1A 1WOCA 4HJ8A 2R93H 1PH5A 4JBJA 4UPAA 1VQEA 4J15A 1XMQL 3CCLA 5IP7H 4GOPA 4DR7L 3RLOA 1YHQA 1UE1A 1PH2A 2ZM6L 3OW2A 4UP7A 4JI8L 3G4SA 2QGQA 2N3SA 2WAQE 1BBWA 2JA5G 5IYCG 4BY1G 5DLQE 5C44G 3CCJA 4A3GG 4QQBX 4B3SQ 5JJIA 1VQ9A 1L1OB 1K0RA 1IZ6A 1YVCA 1GM5A 1YBYA 1P8LA 1SMXA 2UUCL 2JA6H 4HJ7A 1X6OA 2YU9H 1HNXL 5FLMH 2K5NA 3B6YA 4WJ3M 1T9HA 1IBLQ 4LF4L 3CXCA 3I4MG 4R4QA 1VQ4A 1Z47A 4DK3C 3FKIG 3E0EA 3HOVG 3CC4A 3PO2G 2UXCL 3RNUA 1Z9FA 3BJUA 1G51A 1YJWA 4IOAA 1FGUA 1AH9A 2JA9A 1VQOA 2YTVA 4LF8Q 3W1BA 4BBRG 3CW2C 4A3FH 3GTPH 1X55A 1K3RA 1QUQA 4DV6Q 1EWIA 3TS2A 4GN3B 1YZ6A 4JOIA 4A3EH 1K73C 1HR0W 2MQHA 4DR6Q 2LXJA 1MKHA 2NZHA 4JI7L 2UXCQ 1P16A 2E2IH 1XNQQ 3GTLH 1TWFH 5JJKA 4IPDA 1M90C 1IBLL 1U0LA 4NPSA 1VQMA 2JA8H 4A4IA 3I4NG 3CCUA 1IL2A 1OXXK 4JOIC 2UUCQ 2NVYH 3M4QA 5GAHC 2UU9Q 2I5MX 1VQLA 4BY1H 4OWXB 4HIMA 4IFDG 1XNRL 4A3IH 2ZTDA 5C3EG 4GNXC 4DAMA 4IOCA 1VQPA 1Q7YC 1JB7A 1Q12A 2JK8A 2NVQH 1E22A 4OO1I 1VQAA 4JG2A 3F2DA 4DV3Q 4JI8Q 4YHHQ 3W1GA 4NXML 4JC0A 3D0FA 5HGQA 3JAMc 2JEAI 1QVFA 1WCMG 1CSPA 2GN5A 3F8TA 3KF6B 1Q1EA 1KHIA 2KCTA 4YCUA 4C3HH 5FJ8G 3LGJA 4GNXA 1NTGA 1XPUA 3CC2A 5C0XG 1IBKQ 4A93H 4BBSG 3GTGH 2B63H 4IFDJ 2ATWA 1K83H 3BZCA 4JV5L 3K7UC 4YY3Q 3MXNB 4AYBG 2R7ZG 4DV4L 2UUBQ 3EN2A 2VUMG 2AWOA 4HJ9A 3PO3G 1CUKA 2BA0A 3ULJA 5IYDH 3PIOA 4DV4Q 2UUBL 4A3MH 1JMCA 1A62A 5M5YH 5IYBG 3PUZA 4AIMA 2Y0SG 1IBKL 2NN6G 4A3BH 1Y1VH 5IP9H 3UDFA 4LWCA 3U4VA 3GTOH 3CMEA 1KRSA 2WB1G 4LUZA 5M3MG 4X6AH 1YJNA 3HOXH 1VQJA 2Z6KC 1PH1A 4BXXG 1V43A 1AE3A 4IJHA 1HH2P 4NXMQ 3RR5A 2AHOB 1JE5A 4OWTB 4IPHA 4DV3L 3I4OA 1UE6A 2E5LQ 3S17H 4DR3Q 3ICEA 3TEHB 5FJ8H 4B3RQ 4OWWB 1XNRQ 4X66Q 2OQ0A 1XTDA 4DR2Q 1N33Q 2B63G 1G6PA 3ERSX 2UU9L 4DR1Q 2EXDA 4OONA 4LNQA 4NB3A 4JI0Q 4IPGA 1K8GA 1FJGL 3I56A 1BKBA 2L15A 1Y14B 3TS0A 2CFMA 4JI1Q 3CAMA 1CKOA 4LFAL 2R93G 3E9IA 1QZGA 1TWHH 3KF6A 4BA1I 1DGSA 4GOPC 5IP7G 1LTLA 1W3SA 4LFCL 1XNQL 3K0XA 1NY4A 4JBWA 4GNXB 4QL5A 4NXNL 1QVGA 1L2FA 1Q82C 2HHHL 1C9OA 3CCSA 4A3DH 2YV5A 4WJ4A 1VQFA 1SFOH 5IYCH 2BA1A 1OXVA 2WB1E 4LF8L 2OQKA 4DR5L 1KD1C 2D62A 4A3BG 1I5FA 4QJFA 4A3GH 1GD7A 2HIVA 3KF8B 4X65L 2JA6G 3HOXG 1XPOA 4IJLA 2K4KA 2K50A 4X62L 2VQFQ 4EQ5A 1KRTA 4L5QA 4QY7A 4BXXH 3H3VH 4AH6A 4YWLA 3CPFA 3FP9A 2NZOA 3I4MH 3BU2A 2ALYB 3HOVH 1HNWL 3FHWA 3G6EA 1EUJA 3CCMA 4DR5Q 3KDFA 2Z0SA 3AFPA 2WP8J 2Z6KA 5BR8Q 3CD6A 1QUQB 1W2BA 5M3FG 1HR0Q 2XGTA 1VCIA 4L5TA 3UE0A 4LFCQ 5JEAJ 4R1JA 1KXLA 2JE6I 1IYJB 5JEAG 5IY0A 4AQYL 3NEMA 1V9PA 1K8AC 3S1MH 4GLXA 3AEVA 1XMQQ 2IHEA 1OXSC 5E7NA 4JI5L 3JC66 3TREA 4LFBQ 4GKJL 4AYBE 5GQOA 1C7YA 4DV1L 4UP8A 1KL9A 1N32Q 4Y52H 2D0OA 4LF6L 4KLKA 4A3JG 2MFIA 1XJVA 1YITA 1YHBA 5GAGC 2QEXA 4DV7Q 2F4VQ 2N49A 5C4XG 4FDBA 2VL6A 4JI6L 1I94L 1L1OC 1X3GA 3K80C 3M3YH 3RZDH 2K75A 5LMUL 3T1HL 2HT1A 3MEFA 1WCMH 2I0QA 1OXUA 2OTLA 4OX9Q 4RG1A 1VQHA 1TWCH 2ZJQA 2RF4A 4BBSH 4A93G 4OXPA 5FLXc 2K14A 1E3PA 5IT9c 3T1YL 3A74A 1JJCB 5LMUQ 5M3FH 3M7NA 1B7YB 1R9TH 1I94Q 2AMCB 2KBNA 3HFZB 3PUYA 4DPGA 3RN5A 1E1TA 4JI6Q 1YZ7A 3S1RH 1N8RC 5HY6A 3UE1A 1BVSA 5IWAL 4DV0L 3AFQA 1AE2A 4HJAA 4GN4B 4R4CA 5IYDG 1WFQA 2MO0A 1QZHA 5J3BA 4DK6C 1UE5A 1UEBA 4TVAB 4JI3L 4DV1Q 4A3MG 1C0AA 4JI2L 1NMFA 3RLFA 1SR3A 1TXYA 4A3KH 1I50H 2VY3A 2N8NA 4HIOA 4DUZQ 4A76A 4RMFA 5IYBH 1JJGA 5IP9G 2VQEL 1YIJA 1J5EL 4B3TL 2R7FA 2YTXA 4DV5Q 1I3QH 5M3MH 2JQOA 1Q86C 4MZ9A 2ASBA 3OYYA 5C4XH 3UDGA 3S16H 4POGA 2ZTCA 1B8AA 1QVCA 3ER0A 2UUAQ 1EIYB 4QGUA 2PQAB 4JI4L 1HR0L 4KHPQ 3PUXA 3NELA 1A63A 2WFWA 3I2ZA 4P74A 5BR8L 3J80c 4LF5Q 2PQAA 1HJPA 3J7ZC 4QIWE 2QA4A 1FL0A 1BBUA 1KC8C 1HNWQ 1S40A 3WWVA 3D31A 2ZTEA 2DUDA 3UDIA 2F3IA 3CP0A 3KJOA 1XMOQ 3PSIA 2Y0SE 3S1QH 1OTCA 4YCVA 3H15A 2Q2HA 4YWMA 2RHSB 2WAQG 3W5OA 4X62Q 1EFWA 2R92H 4O0AA 1SROA 3F2CA 2VW9A 1XPRA 1EQQA 3U58A 1PA6A 1TWAH 4DR6L 3GO5A 1VQ6A 2LSSA 3CF5A 2KHIA 3Q8DA 1HNZL 2E2HH 2JA7G 1L1OA 2NVXH 3U50C 5LMNW 2EQSA 3STBD 4BY7G 1I6HH 5EAYA 4A3DG 1JT8A 1GKHA 5C4JH 1PH4A 4L5SA 5K36G