2A1AA

Pkr kinase domain-eif2alpha complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
161
Chain Sequence
SHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
total genus 47
structure length 161
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a1aA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a1aA01
1N32L 1Y1WH 3KJOA 2Z6KA 1KQSA 2GVAA 3M85A 2VUMG 4A3DH 1YHAA 1SLJA 4JI2L 2LSSA 2MFIA 4IOAA 1E22A 4B3TQ 3HOZH 1WJJA 2XGTA 2YTVA 4LFAQ 2QA4A 1D8LA 4A3JH 1I5FA 5FLMH 2JA8G 3HOUG 2K4KA 4X65Q 2KHJA 1PH9A 4DUYL 3ULJA 3J80c 4GOPB 1KL9A 1AH9A 4UY8C 1PA6A 1LUZA 4A75A 2HT1A 4BBSG 3G6EA 2A1AA 2B63G 1MIUA 2N78A 3ICEA 5FLXc 2UXBL 4NXML 2UXDL 3RN2A 4A4IA 1CSQA 1YNXA 4OWTB 3STBD 1K8GA 1N33Q 5M3FH 1PH7A 2IX0A 3KF6A 1EIYB 3G48A 3PF5A 2K75A 4JI5L 3EN2A 2VQFQ 2JA6H 1X56A 3STBC 4A3DG 3GO5A 2YV5A 3BU2A 4DK3C 3VDYA 1KC8C 4JYAQ 1I94Q 4EQ5A 1NTGA 2JA8H 1J5EQ 1VQJA 2NN6I 1VQEA 2WAQE 1TWFH 3S1NH 3U50C 2BH8A 5M5WH 1YEZA 3K80C 4A3MH 3RZDH 4Y7NH 1VQ9A 1QVCA 3S2HH 3I4NG 2KENA 4P72A 3W5OA 2NVXH 3IRBA 2ZJRA 3H15A 3CMEA 4RMFA 4BY7G 1Z9FA 5JEAG 2E2IH 2N49A 4DV7L 3HOVG 3K81C 3GTJH 2K5VA 2HIXA 4DR4L 1O7IA 4DV5L 4DNIA 1HZAA 2JA5G 1WI5A 4PZ6A 1OXVA 2AMCB 3CCUA 2PNHA 4DV6L 3T1YQ 3S15H 4GKKL 4C2MH 4X66L 3ULPA 1L1OC 2IHEA 1MJCA 4GNXB 4JYAL 4YHHQ 4IFDJ 1YZ7A 1N9WA 1FVIA 1TWHH 3TQYA 3A74A 4X64Q 2VQFL 4GOPA 1PH8A 1HNWL 1B70B 1Y1VH 4A3IG 1IBLL 5C4XG 4IOCA 4B3MQ 2I5HA 4HJ8A 1CKMA 3A5ZB 4HIKA 1YJWA 2ATWA 4IO9A 3KF8B 4A3LG 1BBUA 3UE1A 5IYBG 5JJKA 3PO3H 1Q86C 2ASBA 4EX5A 1FJGQ 1IZ6A 4JI0L 1TWGH 5ELNA 1XTDA 3KF6B 1UE1A 1S40A 3DM3A 1SRUA 3CW2C 2LXKA 2R7ZG 2IT1A 4TVAB 4AIMA 2YU9H 2IHFA 4DR4Q 3ZJYC 1VQ8A 5IE8A 4OONA 5ELOA 4DR5Q 5M5XH 2UUCQ 1L1OA 1U5KA 4OXPA 1Q46A 4R1JA 1X3FA 4JC0A 2K5HA 4PG3A 4PZ8A 4GS3A 2HQLA 5FJ8H 4RG1A 3ULLA 4JG2A 4DPGA 1UEBA 3E0EA 3F2BA 4DAMA 4DUZL 3KDFB 4KLKA 2AWNA 3OTOQ 1IBML 4MNOA 1S72A 5C44H 1JT8A 3AFQA 3HOVH 2UUAL 1XMQQ 1D7QA 4GKKQ 1Y1WG 2NN6G 1HNZL 2ZM6L 2VQEQ 1QZGA 1NJIC 4DUYQ 2MO0A 4DK6C 3KJPA 1VQDA 3SGIA 2Q2HA 3W1GA 1Q82C 3KDFA 1HR0L 4A3BH 1UE5A 1VQFA 3I55A 2NVTH 4LUZA 4JI1Q 4IPDA 3HOZG 4KHPL 1PYSB 4A93G 2UUBQ 4IPGA 3HOWG 2YTYA 5IP9H 5C0XI 3D31A 1JB7A 1KAWA 4XTCS 3M4PA 2VZAA 3FKIG 1PV4A 3CCEA 4WJ3M 1VQKA 1NMFA 5C3EG 2R92G 4DR6Q 3CQZH 2ZTDA 2FXQA 3TREA 4C3IH 4LFAL 4DV2L 2B63H 4IJHA 4HIMA 4A3LH 4QIWE 3UDFA 3HOXH 3OYYA 2E2JH 3OW2A 1MJEA 3PCOB 3UDXA 4DV3Q 4L5TA 1QZHA 4OWWB 3PUYA 4DV5Q 1V9PA 5LMNL 4JI6Q 1X3EA 2MNAA 1Q7YC 3CC2A 2C35B 4LF6Q 1SR3A 5BR8Q 4GN5A 1C9OA 2EQSA 1CSPA 4IJLA 4YCWA 3CF5A 4K0KL 4A3KH 2R7FA 5LMNW 2I0QA 2Z6KC 2MQHA 3RR5A 1HNZQ 3AEVA 1CKNB 1VQ6A 4X62L 4LF5L 5FJ8G 3UDGA 3KFUA 4GKJL 2RHQB 3GTQH 3S1MH 4GN3B 3JAMc 4Y52H 3BZKA 4DR1Q 1HNXL 3MEFA 2ES2A 3L0OA 1YHQA 2IY5B 2R7DA 3GTPH 2JEBI 4YY3Q 1WFQA 2E5LQ 4DAYB 5IYCG 1SN8A 1XMOQ 1PH6A 4A3GG 2LXJA 1K73C 2OTJA 4A3EG 4DV3L 1N36Q 2UU9Q 4NXNQ 3F1ZA 1W3SA 1UE7A 1VQMA 4A3FG 4JOIA 1VQIA 4L5RC 2JA7G 1GO3E 3H0GH 3Q8DA 1TWCH 1X3GA 4LUOA 1W2BA 1OXTA 3U58A 1GM5A 4AYBE 2OWOA 2ALYB 4UPAA 2BA1A 1E24A 2CWAA 4K0KQ 2ZM6Q 2VQEL 1YVCA 3FKIH 1VQBA 2R6GA 3T1HL 2WB1E 3M4QA 2KBNA 4HJAA 1Y14B 1XPOA 3F8TA 2R93H 2R92H 4LNQA 3NEMA 3CMAA 3PSIA 3CCRA 1U0LA 2B29A 3J80i 2ZTCA 1EFWA 1FL0A 3K7UC 4POFA 2A19A 1PH1A 4B3ML 4H02A 5BR8L 2R7ZH 1WCMG 4YWLA 2NVYH 1QVFA 4BXXH 2K5NA 4JBKA 4JV5Q 4DR2L 4LF9L 4WJ4A 2ZJPA 1OXSC 3MXNB 3ERSX 3WWVA 2N8NA 3AYHB 4OO1G 4J15A 2K14A 4R4CA 4DV4Q 4LF8L 3HOUH 4JOIC 5FLMG 2Y0SE 4B3SL 1VS0A 1JJCB 3I7FA 2F52A 1PH4A 4GLXA 3CCVA 3CC4A 1Q12A 1AE3A 3GDEA 1Q8KA 1VQHA 4BY1H 4QY7A 2GN5A 2OCEA 4R4TA 4UP7A 1FGUA 4OX9L 1SFOH 2R93G 1K8AC 4HIOA 1PH3A 4JBWA 1IXRA 1EOVA 4DR3Q 5E7NA 2F3IA 3GTOH 4KHPQ 2JJQA 1A0IA 3K7AH 2QEXA 2D0OA 4AQYQ 3A5UA 5IYCH 1YI2A 1YZ6A 3S14H 1B7YB 2OQ0A 2JQOA 2YTXA 4UP9A 4JI3L 2PI2A 3RNUA 4A3EH 1C7YA 4JI4Q 4MZ9A 3NENA 4P71A 1VQ4A 1XNQQ 2F4VQ 1FJGL 1XPUA 2JA9A 4C3JH 1JJ2A 3PIPA 4LF4L 4LF4Q 3GTLH 3PUWA 3H0GG 4C3HH 4PZ7A 1VQ7A 1B8AA 1EIFA 4NB3A 2ZJQA 3M4OH 4B3RL 1NE3A 1KXLA 3H3VH 4X6AH 3B6YA 1HNWQ 1KD1C 1XJVA 1OXUA 1QUQA 2I5MX 3HKZG 5HGQA 3CCJA 1V43A 3K8AA 3S1RH 1QVGA 2NVQH 4A3CH 3KLWA 1WOCA 5M3MH 3PO2H 1SE8A 1K83H 1X6OA 5IWAL 1HNXQ 2E2HH 4DR5L 1CKOA 4LFCL 3GTKH 1PYBA 1KHIA 1PFSA 1KRTA 4JI3Q 3U4ZA 1VCIA 3T1YL 1LTLA 4JI4L 1YJNA 4GLAC 3T1HQ 4BY7H 1WCMH 1L2FA 1YIJA 1E1TA 1P16A 1JE5A 1S3OA 4JCVE 1E1OA 3M9BA 2Q2UA 4JI7Q 1K9MC 1IL2A 3NELA 4MTNA 3PV0A 1X65A 4DV0Q 2VW9A 4GOPC 2IX1A 4JI2Q 1J5EL 3G71A 3RLOA 5K36G 4BBRH 3PIOA 2CCZA 3CCLA 1Z47A 2BA0A 3H3VI 3S24A 1Y1VG 2RF4A 1I50H 1TXYA 4OX9Q 3S2DH 1PH5A 4BBSH 3J81i 5IYBH 1G51A 3NBHB 5IP7H 3PO3G 3TEHB 1VQCA 5LMUQ 1PH2A 1Q81C 2K52A 2D0PA 1HZBA 2RCNA 4R4QA 4PMWA 4JI8L 1G6PA 4LF5Q 1E3PA 3PUZA 5J3BA 1HZ9A 4O2DA 2F4VL 1YBYA 4HJ5A 1HR0W 4A3GH 1EWIA 1DGSA 3M3YH 1BBWA 3ER0A 3I4OA 3GTMH 1G291 2ID0A 4YY3L 5C4JH 2UXDQ 4X65L 1YITA 3FHWA 1V1QA 4FDBA 1VQLA 3AFPA 4GLVB 1JJGA 3CPFA 4BBRG 3RN5A 4OWXB 4NXNL 2UU9L 1K0RA 4A3MG 1TWAH 3CCQA 1XMQL 5IYDH 2JEAI 1QUQB 4LFCQ 2WB1G 4LF7Q 4QQBX 4A3CG 5IWAQ 4DR7Q 1A62A 3W1BA 4DV2Q 4LFBQ 2NZOA 5LMUL 3HOYG 1N36L 4QGUA 1K3RA 3BJUA 1OXXK 2WAQG 3I56A 2PI2E 1T9HA 3KOJA 3RLNA 1IBKL 4A3BG 2XTIA 4O0AA 4A93H 2Y0SG 4NXMQ 3HOWH 2UUCL 1KRSA 3PF4A 3GD7A 5IP9G 1NY4A 4DR7L 4LF7L 3KYHC 4DR6L 1E7ZA 2KHIA 3K0XA 4XIGS 1X55A 3CP0A 4BY1G 2HHHQ 1HH2P 1N32Q 4AQYL 5IYDG 4YWMA 3J7ZC 3E9HA 3F2CA 1I3QH 4YCVA 1BKBA 2VY3A 2WP8J 2Z0SA 1PHJA 4DUZQ 5IY0A 5GROA 1ASZA 2CFMA 3RLFA 1P8LA 2JK8A 2ZTEA 4R4IA 4LF6L 2AHOB 4P75A 3D0FA 2EXDA 1A63A 5AJ3Q 3S1QH 3J81c 1VQOA 2E5LL 4B3SQ 1EQRA 4IFDI 5H1SE 4P74A 4LFBL 3I2ZA 4YHHL 3G4SA 1NMGA 2UXBQ 4DV0L 4A3KG 2UUBL 2MO1A 4JBJA 2D62A 1EQQA 1N34L 1M1KC 4TQUS 2Q2TA 4KI0A 4JI7L 2AKWB 3TS0A 1XNQL 1L1OB 3CPWA 1RIPA 2KCTA 2PQAB 4DV6Q 2BH2A 2OTLA 1L0WA 4JI0Q 2NZHA 4HIDA 4LWCA 1PVOA 1Q1EA 2N3SA 3E9IA 1HR0Q 3I4MH 3HFZB 5GAHC 3TS2A 3TRZA 3CCSA 2H5XA 4IPHA 3HOYH 4POGA 2JE6I 3HKZE 3S16H 2UUAQ 3HKSA 5GAGC 2VL6A 4JI8Q 1N34Q 1HJPA 4BA1I 3U4VA 2RHSB 3UDIA 4A3FH 3OTOL 3EIVA 1MKHA 4IFDG 2KCMA 3CC7A 3GTGH 2K50A 4R4OA 5DLQE 1UE6A 1VQAA 2OQKA 5AJ3L 3F2DA 3PUXA 4LUVA 4KHZA 2UXCL 1XNRQ 2UXCQ 2PMZE 1VQNA 1IYJB 1GKHA 2YYZA 5IP7G 4X64L 2HIVA 5C3EH 2CKZB 5M5YH 1LYLA 5JEAJ 2Q2IA 3A0JA 1LM0A 3I4NH 5GAEC 4DR3L 3HOXG 1GD7A 3AQQA 1GVPA 1HZCA 3CXCA 2DGYA 1KIXA 3JC66 2GVBA 4X66Q 1XPRA 4GNXA 1UWVA 4JV5L 1I6HH 4A76A 5C0XG 2EIFA 1C0AA 2JA5H 2VUMH 2DUDA 5C0XJ 2CQOA 4JBMA 1BVSA 2AWOA 4DV4L 4LF8Q 4P73A 4DV7Q 4HJ7A 1IBMQ 3BZCA 1WYDA 4NPSA 1ASYA 3M7NA 4B3TL 4YWKA 3CCMA 3L2PA 4AH6A 2PQAA 5JJIA 3UE0A 5GADC 2E8GA 4B3RQ 5C4XH 4A3IH 2WFWA 1XNRL 1XMOL 1VQ5A 1YJ9A 1A8VA 1CKNA 1CUKA 1R9TH 1OTCA 2B3GA 4YCUA 4GN4B 2VNUD 5EAYA 4BA2I 5M3FG 3CAMA 1Q1BA 1RL2A 4ALPA 3I4MG 1YHBA 4L5SA 1SMXA 1AE2A 4DR2Q 4LF9Q 2JA6G 1H95A 3J81j 1X54A 2HHHL 3RZOH 1N8RC 3PGZA 4JI1L 4AYBG 2QGQA 3CD6A 4APVA 4QL5A 3FP9A 4DV1L 4DV1Q 2JA7H 1J6QA 1X9NA 4A3JG 1I94L 4QJFA 1EUJA 4HJ9A 4GKJQ 5JJLA 4X62Q 1IBKQ 2I5LX 2VS1A 3J7A5 2V1CC 2CWPA 4L5QA 1M90C 1IBLQ 5LMNQ 3LGJA 4GNXC 4JI6L 1JMCA 3JAMi 1VQPA 5M3MG 1N33L 3L7ZC 4LW1A 5IT9c 5HY6A 4DR1L 1EYGA 3EBEA 3PO2G 4IPCA 4UP8A 2A8VA 5GQOA 1VQGA 1SROA 4DKAC 1NBWA 5C44G 4ME3A 4JI5Q 4OO1I 3PUVA 2L15A 3DLLA 3S17H 4BXXG
chains in the Genus database with same CATH superfamily
1Y1WH 4IR9A 1LKYA 4F92B 1KQSA 1B3QA 1K1SA 2XY5A 1S0MA 2AGOA 2F0OA 3M85A 2VUMG 3HJEA 4ZH4A 4M04A 1GUOA 2EZVA 4IOAA 2MFIA 3UMCA 4J9NA 4Y2QA 2QA4A 2JA8G 1SV4A 1ZQTA 3VYSA 2K4KA 5CEHA 2KHJA 4LZDA 3ULJA 1KEJA 1BPDA 1KL9A 1JX4A 1MSHA 5J0UA 2KVMA 1PA6A 4UY8C 2CN1A 1EOTA 5CB1A 1QCKA 4IUUA 2K33A 1X6IA 3GV6A 3RBDA 2WTFA 2EYJA 3N97B 3RN2A 2YMQA 4HTHA 2LM1A 2KTQA 2MAXA 4JI5L 3EUB2 3ITPA 2VQFQ 4R8IA 2YV5A 5L1LA 3BU2A 1KC8C 1AP0A 2OT2A 3KLRA 4RQ7A 4EQ5A 3Q24A 5H2FU 1NTGA 1NJXA 1J5EQ 5KFBA 2HOFA 2C5CA 3WKBA 3PW4A 1TWFH 5E79U 1HQRD 4QZEA 1L7NA 4IN3A 2BH8A 2IL8A 5M5WH 3LWLA 1TWFB 1MQ2A 2A74C 2E8MA 2FLPA 2NO4A 5DDMA 5J2HA 1QVCA 4RT2A 5KT4A 3S2HH 2YU9B 5J2FA 1EYDA 3IRBA 5E1FA 1FIQA 2KJXA 4UB6U 3MGIA 3A8IE 1NJYA 2N49A 2E2IH 1CTMA 1TQOA 4QW9A 4ED7A 3CKIB 1LO5D 2HIXA 4NMZA 2W03A 2XO7A 1PVPA 4DV6L 5C5JA 5EWGA 2PNHA 3T1YQ 4R66A 1WCLA 4C2MH 2SEBD 1L1OC 5EE9A 4QWCA 4FBTA 3GIKA 4GNXB 1N9WA 1EXNA 4ECWA 3A74A 1HNWL 1WTWA 4ECZA 4QIWB 3PO4A 4LAAA 7ICRA 1CKMA 1ENFA 2A69D 2LMCB 1BBUA 5JJKA 4QUCA 3KZXA 3PO3H 2BGWA 4EX5A 2E8OA 4CDDC 5F9NA 1IZ6A 1BNOA 2PXIA 5CV7A 1XTDA 3MDCA 5ALEA 3AL0B 3D6JA 1DGJA 1KLNA 3PO5A 3CW2C 4UBCA 1STYA 4Y7NB 1D2BA 1T8EA 4TVAB 2IHFA 2QEJC 4XDXA 2ZUBA 2QCPX 4RA8A 3I72A 3QX7A 3BVMA 5M5XH 5KFTA 4FE3A 1I6VC 4WFN3 4OXPA 4R1JA 5DQHA 1XTCD 1L3TA 4GS3A 4L63B 2HQLA 1U4MA 5FJ8H 3PW2A 4RG1A 2JEIA 3EW9A 2ATLA 2UVWA 4M9JA 3GZFA 2LKVA 1QWYA 2WAQF 4O3MA 2MHVA 2AWNA 4KLKA 3OTOQ 1IBML 1S72A 2NRTA 5J2IA 5ELBA 4ACOA 1PTOD 4QZBA 2ISPA 2A68C 2L0CA 5KFFA 1XMQQ 1HNZL 4CDEC 1NZPA 1RYUA 3MDAA 1Q90A 1S8OA 2H1EA 3DM1A 4K8IA 4GFJA 4ZCKA 3HOZG 3MBYA 2F0LA 4XT1B 1O03A 4EZ9A 1IM4A 1PYSB 4IPGA 4KN4C 5KNDA 3D31A 1AN8A 4XTCS 3BVZA 2YMLA 2EYFA 1PV4A 4KLGA 4YMMA 4ZUJA 4WJ3M 4ECYA 1NMFA 4AYBB 1HA5A 2BCOA 4PHDA 3BQ1A 2W3RA 3C23A 2M9NA 2FXQA 4LFAL 4DV2L 2B63H 9ICPA 4A3LH 3L5KA 4QIWE 2F1IA 4KHVA 2UVVA 2NRVA 3B0XA 3BS5B 5M5XB 1QZHA 3NVVA 4QZAA 1SWWA 4DQIA 1EY5A 2Y0SF 4UBBA 1D9FA 2KEEA 4JI6Q 3A55A 3I70A 3X3NA 1Y69U 4DF4A 4GN5A 5DQIA 2EQSA 4KTQA 3L3OC 4KJNA 4XQQA 1SKWA 1EIGA 4QZ8A 5KL1B 3RR5A 3ZDCA 2JMGA 3KHGA 5J0SA 3AEVA 3TP8A 1CKNB 2BKEA 2BDNA 3KFUA 2EYPA 7ICNA 1OUQA 3T53B 3MWYW 2AUKA 2L5YA 1HEKA 2JA8B 1I4QA 1BQQT 4Y52H 3BZKA 4KLFA 4A3FB 4DR1Q 4U673 1XYIA 1HNXL 2NTSA 2XWBB 4EYHB 5EKLA 5IIKA 1DD2A 2Y1IA 1IHZA 1U9RA 1PH6A 3LVVA 2B2YA 4DSEA 4NLGA 3VR6A 1HA6A 1GUWA 4IR1A 3HOZB 4A3FG 4JOIA 3WK4A 1QOHA 3BS7A 1F2MA 1X3GA 3QJYA 2KCCA 3SEIA 4LUOA 5IODA 3P7JA 3OPOA 1GM5A 2OWOA 3HG9A 4O9MA 3UQ2A 3T1HL 1YVCA 3FKIH 2R6GA 5I6YA 5ALNA 3VCBA 1TK8A 1ZQBA 4IRDA 2OEOA 2B8FA 4LJXA 1BPEA 2ZTCA 4DU9A 4K8JA 3K7UC 2B39A 4POFA 4H02A 4YWLA 3IG5A 4JBKA 4JV5Q 1NUCA 3QEBZ 2KJ8A 1SL1A 5J0PA 5J0WA 4C0ZA 5KFDA 1VF5C 4YR2A 4J15A 3GTMB 4B9VA 2K14A 2RHFA 4LF8L 2KUMA 4YR3A 4F50A 3CC4A 3FVQA 1Y8OB 3PMNA 2PFNA 9ICBA 1Q8KA 1VQHA 2P6RA 1S5FD 3CQZB 4UP7A 1FGUA 3KBGA 4I2FA 3GFKB 2HCFA 1SNOA 4JBWA 1EOVA 1RQLA 4FFDA 5E7NA 4ZOHC 2EYMA 4UB8U 8ICIA 5DB8A 5L9XA 2IOHA 3H8JA 4G7HC 5D4BA 1QQ7A 5KFOA 4F88A 3A5UA 1LTAD 3E6ZX 2K7VA 1YZ6A 4O1NA 5IGFA 3SK5A 3S14H 2EYHA 3BYTB 2OQ0A 5ALFA 2YTXA 4A3EH 4QQBX 5AI6A 3TFSA 4ZYSA 2NRXA 1VQ4A 4FNFA 2DJGC 2JA9A 1A77A 1JJ2A 2JV3A 1ZQXA 5ALOA 1DK2A 2IW3A 2OYYA 2K89A 1NK5A 1FR3A 1DOMA 1Q3LA 2EY6A 3QUCA 1EIFA 2RSOA 3RBEA 3M4OH 5FO8B 1NE3A 3BG3A 1XJVA 1OXUA 4DR4Q 4ZRZA 3S1RH 4A3CH 5KRUA 3EJIA 1LV5A 1ZQYA 4P4OA 1LABA 4N9PA 4CGYB 1SMYC 2HOQA 2WB1B 4FO6A 5L37A 3HRZC 4EGVA 5D49A 1IYUA 2E2HH 3AM9A 4KLDA 4LFCL 2Y0SC 4DL6A 1KRTA 5KFAA 5ALKA 1K3BC 2WF8A 4Y2PA 1STNA 3HT3A 1JQYD 2KOBA 8ICZA 1ML0D 1NAPA 3SD7A 3BDCA 3DEEA 4MTNA 4QMGA 4MHVA 4YMNA 4F4YA 1S0OA 2F0GA 1S4ZA 4X3TA 3I90A 4GOPC 3G71A 1B50A 4FF3A 2LFNA 5K36G 3PIOA 5C3WA 2PFOA 2CCZA 4UB3A 3H3VI 2KIVA 4FF2A 4UB2A 2R93B 4A93B 2BQ3A 4KKSA 1PH5A 1ZQKA 4KTAA 2I9GA 3J81i 1G51A 4PJ0U 3TEHB 3N4MB 4KLQA 4IS7A 3FDTA 3RJKA 2MJ8A 2F0TA 2RCNA 2RQ5A 5CWRA 2RRDA 4OGQC 4RQ5A 4JI8L 4BY7G 3PUZA 1IKMA 1HZ9A 1JXLA 3KLSA 4O2DA 3GIJA 1EWIA 3IL8A 1HTPA 3UPQA 4RGNA 5HURA 2KSOA 2A68D 1B53A 3K57A 4QWEA 1NK8A 4GLVB 3C3LA 4DSLA 2I07B 4MF2A 2I1QA 3IV6A 3KHRA 1B2TA 4J9PA 1BPZA 2CQAA 4HSVA 5CR3A 4OWXB 2W7PA 4FYDA 1MQ3A 4JV0A 4I29A 1TWAH 5KG2A 1ZQPA 3PZPA 2Z4IA 4C8OA 2WB1G 3DXJC 4BWGB 4DR7Q 2RDIA 4RHSA 4YN4A 2RSNA 1KDBA 2H3ZA 5LL6X 2K32A 1FNWA 5IGDA 1OXXK 2TSSA 2WAQG 4XYQA 3I56A 2PI2E 3KD3A 3MC0B 5ALGA 3JPPA 3RLNA 4P4PA 5KYIA 4KLOA 3DDHA 3DWPA 3VYUA 5LHY1 4QCLA 4EELA 3H8WA 2ZXOA 4DWIA 2AQ2B 1AQ6A 2W55A 2KKPA 1JWMD 1JICA 3TDQA 5IP9G 3RH6A 2WF6A 5AI8A 1DOQA 2CXYA 3B9JA 1EZ6A 4XIGS 2HHHQ 1X55A 2FINB 4AQYL 5IYDG 3M9OB 3J7ZC 4EX6A 1I3QH 5M5WB 1WD0A 1ILPA 5DQGA 1T3QA 4A3IB 2Z0SA 5C4XB 3SK8A 2F3WA 1ET9A 5IY0A 1BCPF 4C3IB 1ASZA 1KFTA 3KTQA 1P8LA 2RQXA 2G5IB 3Q8LA 3WOEA 2AHOB 4P75A 1NR2A 5IIIA 1D9DA 1SNCA 3P75A 3PSTA 4MF8A 5DBAA 4O0IA 2J4XA 2H3IA 3S1QH 2KSOB 4B3SQ 4P74A 4LFBL 4YCXA 4C8LA 3I2ZA 3QU9A 1SIJA 2K8BB 3IP4B 4DV0L 8ICUA 1EQQA 1KKXA 4JI7L 1I6HH 1N34L 1M1KC 4FVMA 1MBYA 3KZIU 3N6RA 4RT3A 4TUSA 3JPNA 1H9JA 2H4OA 4DN4M 4ZKBB 4KX3A 1RIPA 2K04A 4QZHA 1QSYA 4FS2A 2A6HC 7ICSA 1SYEA 1L0WA 4HIDA 2LMRA 5K5PA 1RM6C 3E9IA 3H8MA 3I4MH 2FLNA 2EOTA 4J9QA 4POGA 2P5ZX 2JE6I 8ICOA 1UPHA 2XNAC 2F0VA 2HCIA 2PQEA 3S16H 3TADA 2F0EA 5GAGC 2VL6A 2UVUA 1HJPA 4I2CA 4P0PA 1TU2B 2JN4A 4NKLA 2PZWA 1N34Q 3OTOL 1YT3A 3IFTA 4RAUC 5EBCA 2IJ0A 3NVYA 4QJFB 4KITB 4F5RA 5DLQE 1UE6A 3PX6A 2OQKA 2F0DA 3F2DA 3PUXA 4O3PA 1NK7A 4JV2A 2PMZE 5EKKA 3OW7A 2VA3A 2LYAA 4PHEA 2ZIWA 3A8JE 3A0JA 3I4NH 3GQBA 1QSSA 1GVPA 4F91B 4QWDA 2KZMA 3K75D 4RQ6A 2HVIA 3JC66 4X66Q 4GNXA 1L3VA 1B4FA 4F5OA 2F0JA 3WKCA 3BYYB 5C0XG 3TMEA 1C0AA 2DUDA 2NVYB 4JBMA 3E0FA 1JC7A 5CA7A 1U45A 1CZWA 4MHEA 4DV7Q 4HJ7A 1X42A 2JH1A 2Q8RE 3ND9A 4FXGC 3H0RB 3I4MB 3I8ZA 3MFYA 3Q0AA 5JJIA 3PVXA 1Q3VA 5CP2A 4DO9A 2A1JA 3UM9A 5J0QA 1SYCA 1YJ9A 1CUKA 4RNMA 5AM1A 1VQ5A 2B3GA 5CV8A 4G9BA 4P4MA 4J9RA 1NNLA 4YCUA 3RH4A 5IT9L 2DN8A 2O4XA 1KQQA 4BA2I 5KNCA 4YXJA 3FRPB 4ULLA 1ZKOA 3C2PA 3EQLC 1EYCA 5D3IB 1SMXA 3MC1A 1X9MA 4L6TB 2GLEA 4EEYA 2R18A 2F0SA 5KGUA 5F9LA 1SYGA 3PGZA 1EWCA 2FLLA 5HGTA 1EY0A 1LT4D 3FP9A 4DV1L 4DV1Q 5M3FB 1I50B 1S77D 1URJA 1LTID 2BE5C 2I5LX 2VS1A 2V1CC 3GV8B 1IBLQ 3V72A 9ICLA 1GXDC 4P0QB 4GNXC 1ZD2P 4JI6L 4B6JA 1ZJNA 1TR5A 2G06A 3C1FA 4DFKA 4DSJA 3EBEA 5FO7B 1ZJMA 1S76D 1ZYRD 5KG7A 3FEWX 4QIWC 3GDXA 2DJFC 3RR7A 2XVSA 4MFFA 5GQOA 3WKAA 1NBWA 3TACB 4RHRA 4JI5Q 2L15A 2FPMA 4BXXG 4U7CA 3MVVA 2B2UC 3RJGA 1SLJA 2K8CB 1CFMA 4JI2L 3SK4A 1E22A 2BH2A 5E4WC 1LT6D 4B3TQ 4RPZA 3HOZH 2YTVA 1A76A 2F3NA 2ZUDA 5KG1A 1CQVA 1I5FA 1NCVA 2YMPA 4A3JH 3IAYA 3M9MB 2XC9A 1R4PB 4Q8FA 2AXTU 4GOPB 3K4GA 2HT1A 4JWMA 1L3SA 1TAUA 4DOBA 3MR5A 1YNNC 1D1IA 1L7OA 3G6EA 1QCBD 1UAPA 3N52A 4H0LC 4GXIA 2B63G 1MIUA 3K5OA 5IIJA 3ICEA 4RQ4A 4IQTA 3QE9Y 1CSQA 5J2AA 4HMIA 1K8GA 5M3FH 2LPEA 1EIYB 4ECQA 2K4PA 1EQTA 3PF5A 4K2LA 4KLIA 3EN2A 2BQUA 1X56A 5L1JA 3WK6A 3NWSA 3ISBA 1NR4A 3VR2A 1SZPA 3M3YB 2YB4A 1EFID 1KDAA 9ICXA 1VQJA 3P20A 3C46A 3AB9A 1O80A 2WAQE 2KVSA 3KKAA 3S1NH 5EOZA 2EJMA 1YEZA 4JPBW 3TBIB 2LYHA 3A0BU 4X3KA 1VQ9A 5ELFA 5IIFA 5B5EU 1ENCA 4YQWA 2KENA 3W5OA 1L5UA 3CMEA 2PMZB 1Z9FA 3X3MA 5I6WA 1COOA 3K81C 2B6GA 2BCQA 4C1NK 3GTJH 4GXJA 2K5VA 4DR4L 7ICEA 4J9OA 1A2UA 2DNCA 1OXVA 2AMCB 2EAOA 3GP7A 4IUTA 4R63A 4PZ6A 1EY9A 3CCUA 1ZQMA 3I4NB 3ULPA 4X66L 4K5XA 2EQYA 1RD9D 3QU2A 3MGHA 1MJCA 4ZQ3A 1ENAA 3JPOA 4ED8A 1YZ7A 4QIWF 1FVIA 1U4LA 2ZT9C 3TQYA 5KFNA 2MRLA 1Y1VH 1TE2A 4XQ8A 4M0AA 4B3MQ 3ORYA 4HJ8A 1XO1A 3A7AB 4C3IG 5ALSA 4F72A 3A5ZB 4E0DA 4HIKA 1PZID 4A3LG 3UE1A 2BDOA 3PY8A 1Q86C 2ASBA 1ZQQA 1ZETA 3KF6B 1S40A 1KDCA 1SRUA 2WKCA 3OIQA 3GTPB 1ESRA 1I4HA 4AIMA 3ONAB 2GO7A 3H7IA 4RQ3A 4RNOA 3K1RB 3KHLA 4DR5Q 1L1OA 3K1ZA 4OELB 3H91A 4HSPA 2XGPA 5B66U 3H4BA 2E2JB 2K5HA 3ALRA 4PZ8A 2GWSA 2B2UA 3D4DA 3PX0A 4WJ3B 2B0CA 3NP8A 1H9MA 1Z4NA 4FS1A 4WJWA 4DPGA 3F2BA 4DUZL 3LDAA 2KA7A 1CHQD 5AKIA 4MNOA 4UQGA 5CMDA 1CA5A 3AFQA 4EQPA 3HOWB 3UMBA 4DS4A 2JA5B 2UUAL 4ABNA 5JUMA 4DQQA 4GKKQ 4CCHA 9ICHA 4EEKA 3IDWA 2VQEQ 1QZGA 1NJIC 3GTKH 4I65A 3KJPA 4QF4A 1C48A 1Y1VB 2Q2HA 3SGIA 1Q82C 1HR0L 3H3VC 4A3BH 2G5HB 1I3QB 1PFMA 1ICWA 3NSWA 4CJ0B 4QZCA 3HOWG 4Q43A 4FF1A 2H3QA 2KE7A 5ALYA 1JB7A 1KAWA 1STHA 5AKZA 3FKIG 3I28A 4OJPA 4DOAA 3T5HA 3D4RA 3CCEA 1VQKA 2OM6A 1FGBD 1TKDA 5TSSA 1IYVA 3HOYB 4PPXA 3HOXB 2R92G 4DR6Q 3TREA 4M9LA 3C5GA 5AKYA 3UDFA 3CHBD 3GV7B 3HOXH 3OYYA 1ZQEA 1MJEA 3PCOB 3UDXA 5I4DA 4DV5Q 3AQFA 3F53A 1CEZA 3TP6A 4C8KA 4BBRB 2BCRA 8ICPA 2NB0A 1G2TA 1C9OA 2P6UA 1CSPA 4YCWA 1A6XA 1ET6A 4A3KH 2R7FA 1ZRNA 2DQNB 1B43A 4UDUC 2Z6KC 2K1BA 4OCZA 5EPJA 2VUMB 4NDXA 1S9FA 5ALLA 1Z7TA 2DY8A 1EQVA 5FJ8G 5FLXE 4A3GB 4O5CA 2PFQA 1HFGA 2RHQB 2WAQB 3GTQH 4F87A 3R3OA 3H4DA 2ENBA 1S0VA 2EZZA 5JEAH 1YHQA 4A3BB 5E4XA 3VYRA 1U4BA 2V4RA 5BN5A 4HEDA 2KD1A 3NRWA 4JK1A 5EBDA 1DYQA 3A0HU 2JGAA 3C21A 4A3GG 3NWTA 3V05A 5JRTA 4DSFA 1T5XD 2UU9Q 1X9SA 3F1ZA 1W3SA 2W04A 1UE7A 3LYSA 3RJEA 3QWNA 2JA7G 1MA7A 4OO1H 4IUPA 3DMUA 8ICLA 1RKNA 1X3PA 3H0GH 3Q8DA 4JUZA 1OXTA 3U58A 2M2LA 4YR0A 3H0GB 4UPAA 1D5MC 3NRZA 5F2DA 1L7MA 2MA1A 1HUMA 3HZXA 2X6LA 3M4QA 4EBEA 5KG3A 2UUCL 2R3ZA 3QNMA 3BVGA 4Q44A 3E3XA 1U0LA 2B29A 3MXNA 4UAWA 1SDFA 4DNRB 3RJHA 3TN2A 3BS5A 5BR8L 1PH1A 2R7ZH 1WCMG 4I2EA 1QVFA 2W8LA 4LF9L 3WK9A 1QQ5A 2F1HA 2V4DA 2HMXA 4NLZA 4M1UB 1SJHD 3S17B 4RQMA 4KMUC 5ALWA 3AMZA 1UT8A 2QARA 3HOUH 2EAMA 4JOIC 4XQJA 4RU9A 2FFKB 4DAVA 2F4IA 4GLXA 2K05A 4BS9A 4BX9C 4NXZA 5ALZA 2A6EC 2M00A 3UQ0A 1SE4A 1NJZA 3E2EA 2AJQA 2F0HA 2GN5A 1EU3A 4BY1H 2R8JA 1K8AC 1IXRA 4O3NA 4PGXA 1JOOA 2F0KA 3IRUA 1MSGA 3ZYYX 2F3IA 2KECA 5JPNC 3SV3A 7ICJA 3GTOH 4IQWA 3Q8SB 4RCNA 2YQEA 4IUQA 2K8AA 2E3TA 4Y2VA 2D0OA 3LWMA 1B44D 2W11A 2DUYA 1BPXA 2LBOA 1ESFA 1IG6A 2KZ3A 8ICGA 4OJLA 1XC9A 2FPLA 4JI3L 4JI4Q 3TP7A 1V1PA 4MFCA 4P71A 3HKZB 1G8ZD 1XPUA 1FJGL 1L0YB 1SXEA 3RB6A 1SNPA 3NTIA 2IA6A 3PUWA 5ALXA 4C3HH 2FMCA 4QWAA 3NASA 1B8AA 1RDPD 2ZJQA 2QKQA 4X6AH 2YY6A 1ZQSA 3B6YA 2KHQA 1KD1C 5KT3A 2HDMA 1QUQA 2HQEA 1QJOA 5HGQA 1EEID 1V43A 3K8AA 1X32A 3CCJA 2E8PA 4DCCA 4DFAA 1QVGA 4ECVA 5DM73 3C2KA 3PO2H 2FE9A 1Z3EB 2LHTA 5KG0A 2F8LA 4O42A 4DR5L 1KHIA 4JI3Q 1CA6A 4JI4L 4C4SA 3HEJA 4RKBA 3U4ZA 3RUZA 3HS0C 3T1HQ 4Y2XA 4BY7H 2DWQA 2QKIC 3NPPA 4UARA 4Z6CA 1JE5A 1S3OA 3G7LA 1E1OA 1ZQUA 2MUTB 3KLSX 2Q2UA 4KLMA 1HTLD 1JORA 3IKJA 1X65A 1JR0D 4QZDA 4JI2Q 1J5EL 3RLOA 4UAUA 1BCPD 3CCLA 1Z47A 2BA0A 1WTPA 3S24A 3EYZA 5J2KA 1I50H 4IL6U 9ICCA 3PIO3 5ELCA 4F8MA 5IOCA 4BBSH 4DGZA 3OWEB 1VQCA 2HCCA 2K52A 2D0PA 4Y2SA 4J9KA 5KG5A 2KVCA 4ECUA 2F4VL 1PTOF 5KFSA 1SSOA 3RAQA 5C0XH 2J7ZA 3ER0A 2RBMA 4DQRA 3GTMH 4J9SA 2ID0A 1NK0A 2EDGA 3SVMA 2N55A 4HR7B 3AFPA 2NVQB 5CRXA 2ODGA 1JJGA 1ZQAA 9ICQA 5AKXA 1E2WA 4QWBA 2JH7A 5C5LA 2UU9L 1K0RA 4A3MG 5IYDH 4LF7Q 1L0XB 4NY8A 5IWAQ 3W1BA 5M5YB 2NZOA 2DGZA 1LACA 4YP3A 1UA0A 5BN3A 4M9HA 3BJUA 3IFDA 1ZEQX 5IGEA 4DL2A 5AM3A 1T9HA 2IHNA 4KLEA 4DQPA 1ZYRC 4OO1J 2RCFA 3Q23A 2XTIA 2KP7A 2PMZF 2Y0SG 1WTQA 1DOKA 4BBSB 4NXMQ 1WTXA 2BDPA 1NY4A 3A7LA 4CHTB 5ALMA 3H09A 4LF7L 1RYRA 1EY6A 2B2TA 1E7ZA 2KHIA 4IURA 5J2BA 1EY7A 3F2CA 4YCVA 2FPKA 2VY3A 1PHJA 3AU2A 3C1ZA 2FMPA 5GROA 3TSSA 4UAVA 1O7ZA 2JK8A 3Q6SA 2ZTEA 4R4IA 4LF6L 2XCPA 1N61A 2EXDA 1A3VA 2J6UA 5C4ZA 5AJ3Q 1FEZA 4QNLA 5J29A 3QZ8A 3TP5A 1VQOA 1PK1B 4X5VA 2DPJA 4C1NI 1NMGA 1ZQZA 1AROP 2RP5A 4C3JG 2UUBL 3C29A 2M0NA 2MO1A 5CV9A 2AQ4A 4ECSA 4BUGA 5AM2A 4RUAA 2AKWB 2PCFB 1FYCA 4KN7C 4CGZA 3CPWA 3RAXA 3AMUA 4O3QA 2PW7A 5DLFA 2NZHA 5ALVA 2LS01 4LWCA 5C5MA 3U26A 3J7YW 3V2TA 1PVOA 2F2AB 2CH4A 2N3SA 3OWFA 1S5ED 1NI3A 3FPUB 1V38A 2BZFA 3HFZB 4J1MA 1HR0Q 3ZD9A 2PPBC 3TRZA 2W9AA 3FPPA 1Y88A 4X3UA 3SI8A 1TWGB 2UUAQ 4GXKA 2D2CC 3LK9A 2HHSA 2L4NA 4JI8Q 4TQSA 4BA1I 3UDIA 3CYMA 3SYZA 2RHSB 2ZG6A 5T1GA 4N9TA 2KNJA 4R65A 1MKHA 4J9MA 1VMCA 4IFDG 2C2DA 1HPCA 1VQAA 5M9OA 4M2YA 3NVZA 1SMYD 4KY7A 1V1PB 5DEHA 2UXCQ 2UXCL 4K4HA 3J81E 1VQNA 1TS4A 2XY6A 1QNKA 1SEBD 3LVWA 2HVHA 5IP7G 1DXSA 2Z6BA 2HIVA 4X64L 2CKZB 5C3EH 5J1ZA 5JEAJ 1TY2A 1KABA 4LZGA 3S15B 1ZQJA 4CJ1B 5KT5A 1F2ZA 4DA2A 2YB1A 1O08A 4ZK9B 4XQNA 4DR3L 1Q3UA 2DL0A 2C2EA 2O5IC 4PNYA 4IRKA 3JPQA 2HHTA 3S17H 3MXUA 5CR0A 1FO4A 1TWHB 2EIFA 3M8SA 3K5LA 2JA5H 4A93G 2EY5A 2CQOA 3C1EA 5HR7A 2AWOA 2AGQA 1F9SA 3GTKB 2SNMA 3OHXC 1KSPA 1HUOA 1SNMA 3QU7A 3M7NA 1WYDA 3T5LA 4RNNA 4TRDA 4ECXA 5A2QE 4NM2A 3T79A 2BQRA 1SL0A 3CCMA 4B3TL 5DLGA 1X66A 1LT3D 2PQAA 5KFMA 4RWSC 3UE0A 4AH6A 4ELTA 2KQ3A 2E8GA 3H8SA 3O0FA 4B3RQ 3PW5A 5AI9A 4B9NA 3G6XA 1A8VA 1FNVA 5KG6A 3VC8A 1OTCA 4ED3A 3MEHA 3NTUA 2ISOA 4GN4B 2G07A 2LM4A 1D8YA 4IUNA 3NE5B 4OHJA 3PQIA 1P7DA 2E5SA 2EZYA 5DGBA 1K8OA 1Q1BA 9ICUA 3I4MG 4DF7A 1UUPA 4A3JB 9ICGA 1B4OA 5HHIA 1LTSD 4PQXA 2JA6G 4DR2Q 2PMZC 2UVRA 5C4HA 3J81j 2HHHL 2B2WA 4DFDA 1S5CD 2XCAA 4M9GA 2PKEA 3CD6A 2JA7H 4CDGA 3T51B 1IL8A 1A15A 3D2SA 4KN4A 4OJOA 1I4PA 1SXTA 2XN9C 1EUJA 4A3JG 1X9NA 4YIJA 2KHSA 1ZQNA 4ELVA 4KLTA 4RKLA 2CWPA 4L5QA 1M90C 7ICMA 1CI4A 3OPXA 4RCOA 5M3MG 5IT9c 4DR1L 5HY6A 1O7YA 1ZQFA 2KEYA 1ONLA 1GUNA 4UP8A 4KLHA 1VQGA 5AI0A 2WF5A 3HOUB 2EANA 4TUPA 4DNTB 1DONA 5L1MA 5ALHA 2KJ5A 5C0YA 1JB3A 2E75C 5GAHC 4C8NA 1N62A 7ICOA 1F2LA 3KJOA 5M3MB 5J0OA 4ZUIA 3SV4A 1YHAA 1F5SA 1MI2A 4DQSA 1XSNA 2JEJA 2LSSA 4YXMA 1NK6A 4F5QA 1WJJA 2XGTA 4DFPA 4DK0A 7ICPA 5JPMC 2HHXA 2IX3A 5FLMH 3GTJB 3HOUG 2DKZA 1Z4OA 2DFLA 1E2ZA 2A73B 4X65Q 1X6JA 1PH9A 3KKAC 3RZOB 4DUYL 3NXWA 1AH9A 1DK3A 1LUZA 2O2LD 3MXGA 4NWIA 3ND8A 4A75A 3BDLA 1BNPA 3AU7A 1F9RA 4AP9A 3MFGA 1UQVA 2CVRA 4A3EB 3C2MA 4J8QA 3PNCA 3SXHA 3K7AB 5FLXc 1OW5A 4J6HA 4NXML 4A4IA 4OWTB 3STBD 5KFPA 1PH7A 2BR0A 2JA7B 5KFQA 2JA6B 2JEGA 1VJ5A 2KCNA 2W54A 3G48A 4C7YA 3UMGA 5EE0A 3HP6A 2K75A 4PMCA 1IIPA 4A3DG 1E0BA 1KNEA 3GO5A 3MTSA 5J8YC 4EQOA 5CHGA 4DK3C 3VDYA 2M9VA 4JYAQ 1I94Q 3F5EA 1TKWB 4KLLA 3WDNA 1KNAA 3A54A 4RZRA 5KNBA 1ZRMA 5BOLA 2P35A 2ZIVA 2HI0A 5KFYA 2W9BB 1VQEA 1ZQ1C 3HP3A 1Q8IA 1WUDA 2A1JB 1KAAA 3PR5B 3HILA 1HIWA 4RPXA 2Q4TA 1N48A 4B9TA 3K80C 4G57A 3RZDH 4Y7NH 4NW2A 2NVXB 2KKVA 3I4NG 9ICKA 4P72A 2NVXH 1DZ1A 1ZQHA 4RMFA 1COKA 5JEAG 1JOQA 4Q0FA 4CF4A 4DV7L 2G5DA 1O7IA 4DNIA 4QZ9A 1WI5A 3SHLA 4F7XA 4GKKL 4OIKA 3I91A 1Z00A 3S15H 2LKYA 2CW0C 4UB5A 3V7KA 4K4GA 1RHPA 2D9UA 1UHUA 2IHEA 2I46A 3QOLA 1AW7A 3K6OA 4JYAL 4OL7A 4F71A 4F2RA 2UXBL 2EY2A 1NJWA 1UT5A 2VQFL 2A69C 3OJSA 2PFPA 3ZDAA 1B70B 4A3IG 5C4XG 1NSNS 4IOCA 2K4EA 1RCVD 2I5HA 3MABA 4TQRA 2K6AA 1YJWA 2F0QA 3WK8A 3MGVA 4F4WA 3KF8B 5IYBG 2L9HA 1FJGQ 2R8KA 4JI0L 5KFLA 1TWGH 1PVQA 3HW8A 2HHWA 1UE1A 2XRQD 3DM3A 1KRPA 1KFSA 2C9OA 4C8MA 2LXKA 1SWVA 3OSPA 3J80L 2R7ZG 3T3FA 4U6PA 3PSFA 5AK5A 2YU9H 5KFHA 1TAQA 2YTUA 2R8IA 4DL4A 3S1QB 5ELOA 3BDPA 3HWTA 1STEA 2UUCQ 2ZJ5A 4Y2JA 5G5GA 1U5KA 2E74C 3V6JA 2JXMB 2B2VC 5DB6A 1PZKD 4PG3A 2HSZA 4F5NA 2CHBD 1L7PA 4NL9C 1KFDA 9ICJA 1U4PA 3WK7A 4TURA 3EA6A 1GOZA 4JG2A 5IGCA 1Z19A 2F77X 1UEBA 3E0EA 2G08A 7ICUA 2G0AA 1XNSA 3KDFB 3ICXA 8ICHA 3ZD8A 3BDOA 2X69A 2ZXRA 3SAGA 1ZQIA 1LTRD 2SDFA 4HCEA 3UXNA 4US8A 1YNJD 4DEZA 3HOVH 5JTIA 3RB4A 2NUCA 2QDLA 5AKJA 2IHMA 4AYBF 3C2LA 2ZM6L 5KFKA 2KN7A 2MO0A 4DK6C 1VQDA 3MZ5A 2W43A 1TIID 3QO2A 3KDFA 5JAVA 2C2RA 4B9LA 3CP8A 2WB1F 3I55A 1SV0A 4JI1Q 4BXOB 3C28A 4IPDA 4TSSA 2NVTH 4KHPL 2QLTA 3S1NB 4OJ6A 3JAML 4NV0A 1Y8PB 3FM9A 2VZAA 4I2IA 2EJGC 1R9TB 4EBCA 2RDGA 3KF8A 3CQZH 1SKSA 4C3IH 2XIWA 3VA7A 8ICCA 3LWUA 4IJHA 4EVOA 4Y2UA 4H13C 9ICSA 1XSPA 3JPRA 4KK7A 3OW2A 1ICFB 2EXZA 5EPLA 4FXDA 4DSKA 4DV3Q 4OWWB 2X6GA 1JE4A 1V9PA 3OMGA 5KYLA 8ICTA 3NQTA 5LMNL 2WACA 3QR8A 3BZDB 1SR3A 5BR8Q 3M6KA 3PX4A 5C44B 5FP0A 1SKRA 4K0KL 1A6SA 1F0MA 5LMNW 2XICA 1NKBA 2I0QA 1DM0B 4CBVA 1HNZQ 1RF2D 1VQ6A 3AN1A 4X62L 5AKHA 1V1OA 4LF5L 4RFBA 5AM4A 3UDGA 4GKJL 4IZ8A 4ODGA 2YMMA 3GIMA 4YD1A 3S1MH 4GN3B 3S16B 1MN8A 1ZQWA 2Z7JA 1K28A 3JAMc 1NK4A 1Z1VA 2EY1A 3MEFA 4NP5A 2ES2A 7ICKA 2R7DA 4YY3Q 1WFQA 4DAYB 1XMOQ 3S6JA 5DBBA 1L8LA 2LXJA 2OTJA 2QB0A 3MHBA 4DV3L 1N36Q 2VKQA 1VQMA 3GTOB 4F4ZA 1VQIA 1RXVA 4UB1A 1LB2B 2NO5A 1GO3E 3P1HA 2BPCA 4C3HG 1WD1A 3K0YA 4DAYA 4NLBA 1N5WA 5KFGA 2BA1A 1U9LA 4UHVA 2XY7A 4C56C 4I2AA 3NHHA 2VQEL 4S3SA 2FI1A 4HMJA 2KBNA 3OTQA 2MUYA 1Y14B 2PZTA 2WKDA 3IM1A 4MTKA 2R92H 4LNQA 1TK5A 3CMAA 3PSIA 1X40A 4ME5A 3CCRA 4U68A 3RB0A 5AICA 1DJRD 1FL0A 3E58A 4B3ML 4BXXH 3DWQA 1JIHA 2K5NA 4WJ4A 1BGXT 1JCKB 2ZJPA 2A3VA 1OXSC 3ERSX 4EBDA 3AYHB 4OO1G 2Z8LA 3MR6A 4DF8A 3ERQA 9ICTA 4R4CA 3TI0A 4PHPA 5DG9A 1JJCB 1RTOA 3T5JA 1F44A 2B8GA 2F52A 3I7FA 4QUFA 3CCVA 4G7ZC 1PH4A 1AE3A 4QY7A 4R4TA 1SFOH 2R93G 2VJ5A 4G4KA 1CRXA 2IWHA 2IBKA 3MR3A 2A6ED 5I2XA 3GIIA 4KLUA 8ICSA 2WIIB 1CQFA 3KK7A 2AQ3B 4JW0A 2R8GA 4PHAA 2A6HD 1JALA 1XSLA 4ELUA 2BPGA 2D8CA 1BDOA 2D5DA 2NN6H 3BQ7A 5IYCH 3QXGA 5AK6A 2F0PA 4GIBA 1SXDA 1B7YB 1CK1A 2VB3X 2HDLA 2PI2A 5EJWA 4B9XA 3RNUA 1XNQQ 4NJ8A 1S0NA 3NENA 2F4VQ 3GTLB 1N56A 4C3JH 4N8FA 3PIPA 1O7LA 3MA2B 1AZPA 3GTLH 1BPYA 1D5XC 5KFCA 8ICWA 3H0GG 1VQ7A 5KFRA 1ZQGA 1PDQA 1VLBA 1KXLA 1HNWQ 1ZQCA 4F4XA 1TS5A 2NVQH 2LYBA 4OJ5A 3KLWA 5E3FA 5M3MH 5IWAL 1X6OA 1HNXQ 4AYBC 1ZD3A 1PFSA 3SAHA 2F3VA 1VCIA 3T1YL 5DBCA 1LTLA 2OF1A 3GTGB 1WCMH 1E1TA 1P16A 3FC4A 3HKZF 2KMDA 1EY8A 1BCPC 3NELA 1K9MC 1IL2A 1TWAB 1SFOB 4DV0Q 4XYOA 4NM1A 3H94A 3NBHA 1QLNA 5EWEA 5HP4A 5HMMA 3SAFA 4BBRH 4PL1A 2F8KA 2HBKA 8ICQA 4OX9Q 1Y1VG 1TVXA 1L3UA 3I4LA 3I1YA 4BXOA 3UXOA 5J0RA 1TT2A 4GC7A 5G5HA 3NBHB 5IP7H 3VYTA 4KLJA 4IALA 1H9RA 2IOFK 1PH2A 1STAA 3M4OB 3OSNA 2RDJA 4R4QA 4PMWA 4PV1C 4CDFC 5DM63 5T14A 3WK5A 4LF5Q 1FFVA 5J3BA 4A3GH 3CRXA 2RDHA 4I7ZC 4HJ5A 4Y2RA 1DGSA 5I9PA 1NKEA 3FMCA 2K5DA 3I4OA 1GO3F 5CV4A 1LTBD 3PMLA 4UAIA 4YY3L 4X65L 2L5TA 1YITA 4DS5A 2F1JA 2FJ2A 4O3RA 7ICLA 1T5EA 1VQLA 4TUQA 3CPFA 4Z6EA 2PO4A 2EH9A 2JHDA 8ICJA 3PV8A 3MFHA 1NZBA 4B9SA 2XRSD 5GTIU 3E5SA 2RA4A 4JWNA 3S2HB 3TZUA 4I2JA 4MEXA 1QUQB 4LFCQ 1SYDA 1SYFA 2JZBA 2JR5A 1A62A 3LWEA 4DV2Q 4M6WA 7ICHA 9ICWA 5IGBA 5LMUL 2Q8IB 4LFBQ 3HOYG 4QGUA 8ICVA 5A0LA 5CBAE 1XO0A 1L8OA 1K3RA 1QG7A 5KFXA 3NTKA 5AK3A 1IBKL 4Y2YA 1GUSA 4O0AA 1XX8A 4A3BG 3M4YA 2PI5A 4IFDH 1NKCA 1QILA 3ED5A 1KRSA 4O5EA 1PYWD 1SNQA 3GD7A 3QG1A 5ELEA 3PF4A 2ZIUA 2QB0B 5AHXA 3T5KA 5ELDA 5D46A 3KYHC 4DLEA 8ICXA 4XA5A 3K0XA 1X9XA 4BY1G 3CP0A 2JP1A 5IIOA 3D8GA 3K5NA 4YWMA 4YG2A 1PXUA 3E9HA 1QTMA 4ECRA 2BHNA 2ZIWB 4DUZQ 1HCZA 3R2TA 4M9NA 3KBBA 3A8KE 2HHQA 2VIXA 3TANA 2XI9A 1U4RA 2W7OA 3D0FA 5BOMA 1II3A 2C28A 3J81c 4FBUA 2E5LL 1EQRA 4IFDI 2F76X 2UXBQ 3G4SA 3RJJA 3SR6A 4RQ8A 4A3KG 5CJ7A 2GH1A 4JBJA 5KAFU 2D62A 4E6IA 1LV9A 2QDBA 4KI0A 1XNQL 1L1OB 3NS1A 2KFZA 5DB7A 5KFEA 1STGA 2KCTA 1GUTA 3HOVB 3Q8QB 2L55A 4JMUA 2B2WC 2J6SA 3OSOA 3UI2A 2V9WA 4GZYC 2W9CB 1H9KA 3LX0A 4JI0Q 2Y9UA 3OJUA 4UASA 1N60A 1Q1EA 3GTQB 2ZXHA 4KKUA 1PZJD 3TS2A 4I28A 3CCSA 2H5XA 2N88A 1ZQOA 5KAIU 2W9BA 4ZAIA 3J7AF 4YD2A 2MU2A 2Q0ZX 3N28A 2WB1C 8ICKA 1EZ8A 3ZDEA 3HKZE 3HKSA 5AKLA 2G9HD 5EGTA 5KNIA 1LLRD 4KV6A 1RTNA 2VJ4A 3L9AX 2I6XA 1STBA 3U4VA 3SQIA 4KX5A 3EIVA 4CJ2C 3G6VA 2K50A 3ZDBA 4V0BA 3EPGA 1T3NA 3I3CA 2E2IB 5G3LF 4LUVA 4M8AA 3CU7A 3SEBA 1IYJB 5J22A 3EZ5A 1S97A 2Y9TA 3FKIB 5M5YH 3W2DA 4CKEA 2K5WA 5JJZA 5HNKA 3OMCA 1LM0A 1HZCA 2NV3A 3BQTA 5CV5A 3CXCA 1QE6A 5ALJA 2JYOA 1XPRA 2DF4B 2HOIA 3HKZC 2HD3A 3DLLA 3KOOA 2NZ1D 9ICEA 1LKYB 8ICYA 3F2UA 3RTVA 2KICA 1R4QB 3D3RA 2VUMH 1I4XA 5C0XJ 4C3JB 1JXEA 5AI4A 1BVSA 2B21A 1K5OA 2E2DC 2BE5D 5NUCA 4DV4L 3PW0A 4P73A 3MAQA 3BZCA 1ASYA 1X9WA 1SNDA 1XXGA 2EE1A 5AI5A 5JOBA 2HHVA 2VXWA 1BOSA 3L2PA 3BS1A 3T56B 5AFWA 5GADC 4LVSA 5GTHU 1ZXTA 5C4XH 4A3IH 1XNRL 1XMOL 3PW7A 2XGQA 3QUBA 5J0TA 2L12A 1R9TH 7ICQA 2ZUCA 4G7OC 1SE2A 2YN4A 1ZQDA 1SL2A 1B1ZA 1Y8NB 2VNUD 2KG5A 5EAYA 2D3DA 2AU0A 4M47A 1RL2A 2PNRC 4ALPA 2F0FA 5J8YA 4PZNA 1YHBA 5L1IA 5FOBB 4L5SA 1BR9A 1QH9A 3OHAA 4CE6A 2W3SA 2LI6A 1X54A 1ZXIA 5CORA 5G3LD 3M9NB 1BNZA 2ALZA 9ICFA 4AYBG 4UW9A 2VA2A 4JI1L 4KLSA 1WYGA 3RRHA 4K5VA 3WKEA 2DNEA 1J6QA 1I4GA 1S5LU 1I94L 3TQ1A 4GKJQ 4F8RA 3PMFA 3U9SA 1O78A 5JJLA 4C3HB 4IC9A 4CNQA 3J7A5 1X2IA 2NTTA 1EL0A 3B0YA 4RQ2A 5LMNQ 1B9NA 4US9A 4QZIA 3V7JA 1KBUA 2ZIXB 2MPMA 3DUZA 1VQPA 1PFBA 1N33L 3L7ZC 4LW1A 5C3XA 2E8NA 5ALUA 4ED1A 3PO2G 3QUTA 1W6KA 4IPCA 4PGYA 4V190 1GHJA 5L1KA 1LVHA 2AUJD 3QYPA 5KFWA 3I76A 1B22A 4ME3A 4Q5VA 4OO1I 2E2HB 3TAPA 1S5DD 3PUVA 3EPIA 1N32L 1N32Q 3GQCA 4BGDA 2Z6KA 2GVAA 7ICTA 4CF3A 3G6JB 5I2YA 4A3DH 5D14A 2XVTA 2BCVA 4PMBA 4PH5A 2B2VA 2L1BA 5CC4A 5COYA 2P66A 4LFAQ 1D8LA 2ES6A 4PGQA 1BCPB 2EYOA 2J0TD 3J80c 3JAME 1U49A 3PIP3 3SZ2A 2BDUA 4F5PA 1PK1A 3A56A 5A2QL 4BBSG 2BCSA 4MFAA 8ICMA 4ILWA 2A1AA 2AQ1B 2K4IA 9ICVA 8ICFA 2N78A 5DG7A 2UXDL 1YNXA 1SJED 2GOLA 1N33Q 2IX0A 3KF6A 3AUOA 1V8QA 5J2DA 9ICRA 1A2TA 1QB5D 2F0WA 1V85A 5K4LA 4XRHA 4Z9CB 1D5ZC 3S9WA 2JA6H 3STBC 1N2XA 8ICAA 2JSOA 1PVRA 3NK9A 1M4VA 3QEAZ 2JEFA 3K5MA 7ICGA 1HUNA 4RH6A 4BDPA 2JA8H 3L4PA 2RDFA 2NN6I 1B0XA 3V6KA 4Q45A 2WAQC 3TKAA 4A3MB 4B9UA 2FDRA 5ALQA 1EYAA 3U50C 5KIXA 1F77A 2WHEA 3D4WA 4A3MH 5AIAA 2FMSA 4JB3A 2JZBB 2ZIXA 5AIBA 3PO2B 1H38A 1WWUA 4M6WB 4B9MA 1WCMB 2F0NA 2K01A 2MSNA 5J2JA 4EX7A 2K03A 2ZJRA 3H15A 1U48A 5D3DA 1SGGA 3V96A 3HOVG 3J80E 3MFIA 2HBMA 1G91A 5IT9E 1YNND 3OOCA 3CNHA 2QARB 4DV5L 2VANA 4FZNA 1HZAA 1TS2A 1XS9D 4HCSA 4C2MB 2B2YC 2JA5G 1MD2D 4BWJA 4ID6A 4EQNA 5IILA 3EFXD 1UCVA 1SAPA 4KKTA 1NK9A 5EQ0A 5JVH3 1JROA 2KZZA 9ICNA 1RJTA 4WRDA 1MGSA 4YHHQ 4IFDJ 5J0YA 3OIPA 1TWHH 4NLNA 2E76C 4X64Q 4GOPA 3RH5A 9ICOA 1PH8A 1BF4A 4N8X1 4C7ZA 8ICEA 3N7RC 2NRWA 1IBLL 1M6YA 4ICAA 9ICIA 2IPKD 3D6WA 3QB3A 4K6DA 3K58A 2ATWA 2KK0A 4IO9A 2QILA 4HN7A 3BQ2A 4IQZA 4HYKA 4R8UA 3R2IA 5ELNA 4RQ1A 1FNUA 3H6MA 3R93A 2IT1A 2WFAA 2O5JC 1SZHA 4EENA 1GUGA 3ZJYC 1VQ8A 2KV2A 4X3SA 5IE8A 1E2VA 1PLFA 2G9DA 2R61A 4OONA 1AFPA 5AM5A 5KFZA 5J2GA 1JOKA 2AGPA 7ICFA 2EVBA 2W9CA 2N1RA 3QOJA 3H0LB 2NWGA 1Q46A 1T7PA 1J9OA 1X3FA 4JC0A 3C5FA 1LTTD 1DXMA 5FK9C 1I6HB 4PL2A 3I73A 4QW8A 4C4TA 4CKCA 3ULLA 4OIJA 3M7GA 2OH2A 3S2DB 2G09A 3BJYA 1PRTD 4K5WA 1PTOC 7ICIA 4DAMA 4H44C 2IOFA 2V4QA 4XUSA 3T16A 5C44H 4DSIA 1KLGD 2PZUA 1JT8A 2QW7A 1ZYQA 1D7QA 1WTRA 1Y1WG 2NN6G 3HPOA 4ED2A 1YNJC 4DUYQ 4H7BA 5TISU 3W1GA 1Z00B 1DOLA 2TMPA 1UE5A 2HHUA 1VQFA 3OHBA 4LUZA 4K0KQ 4ECTA 4DOCA 3AU6A 2UUBQ 2DBYA 5DKWA 2YTYA 2ZXPA 5IP9H 5C0XI 1K0SA 4EZ6A 1IV8A 5DDYA 3M4PA 1D6EC 2KJ9A 1I4RA 1VMPA 4RPYA 4FZLA 5FKAC 5C6AA 5C3EG 4K14A 9ICAA 5D65A 5BN4A 2ZTDA 4F93B 4P2CB 4BY1B 1L6NA 4HIMA 1PZNA 5ISRA 2E2JH 1UA1A 3VR3A 3TADC 3N7SC 4L5TA 1XWLA 4HAEA 3PUYA 2Z4HA 4J03A 4DL3A 4YFKA 4UAYA 3NVWA 4F3OA 3K59A 1X3EA 2MNAA 1Q7YC 3CC2A 2C35B 4LF6Q 1NNXA 3IN5A 4I2BA 1JUDA 3CF5A 4IJLA 5EE1A 1WWVA 1PRTF 4PZOA 2LY7A 4DL5A 1QQ6A 3NTHA 2MQHA 3Q8MA 3DEPA 1CI3M 5KG4A 1TV9A 2K4HA 1SV0C 4FXKC 5KT7A 2ASJA 2Z9HA 4K6LA 5EPKA 3GV3A 1DCZA 1F9PA 3S1RB 3L0OA 4BWMA 2IY5B 3GTPH 2JEBI 4I2DA 5KEEA 1Y1WB 2E5LQ 5IYCG 1SN8A 3SMVA 3ONNA 1K73C 4DAPA 4A3EG 3SR1A 2W9MA 1AZQA 4NXNQ 2ZXIA 4L5RC 5AKKA 3R9KA 2EPBA 4B08A 4K2KA 2IMWP 1D8BA 4KMOB 1TWCH 2F1MA 1W2BA 3WU2U 4AYBE 1Z6HA 3HRDD 4YVZA 4O3OA 1EEFD 2ALYB 1E24A 2RKSA 2CWAA 3GV5B 2F0UA 2KHVA 2ZM6Q 2FMMA 1VQBA 5C3EB 3Q22A 2EDUA 2WB1E 4ED0A 1B9MA 3H40A 2KIWA 4HJAA 3GU3A 1XPOA 3F8TA 1C8CA 2R93H 4UAZA 3NEMA 1CZGA 1PFNA 5T1IA 1HUZA 5EWFA 1WCNA 4MEYA 1CHPD 4LK1C 3J80i 1XU4A 4XT3B 1EFWA 1SBBB 2A19A 3QZ7A 1K1QA 2F0IA 2ZIUB 2AQ0A 4I2GA 2NVYH 4DR2L 1JRPA 3ETRA 3MXNB 4Z6FA 3V6HA 3W3AA 2N8NA 3WWVA 4WORA 1WTHA 3DWAA 5KFUA 4DV4Q 2PW5A 1PK3A 5FLMG 5I9OA 2Y0SE 1ILQA 2NYZD 2O6KA 3E0JA 4QZGA 1VS0A 3J81L 4B3SL 3QIAA 3G6YA 1Q12A 4A8EA 2XWJB 3GDEA 4OX9L 2IX1A 1F9QA 2OCEA 4I7AA 1X3QA 3FDSA 4OEMB 2Y1JA 3AQEA 2W8KA 4HIOA 1PH3A 8ICNA 5HHHA 1PRTB 4DR3Q 1ZQLA 2F44A 4LMQD 7ICVA 2JJQA 4KHPQ 2ICEC 2HBLA 1A0IA 3EVQA 1TVAA 3K7AH 2QEXA 1TWCB 4AQYQ 4OD0A 3H0MB 1OXJA 1YI2A 2DPIA 5CGKA 5JU5A 4IQVA 2JQOA 4UP9A 4Q8EA 1C7YA 4MZ9A 1KTKA 4JVZA 2ICIA 2E1EA 4HAIA 1NOMA 1G6ZA 1H9SB 2F0MA 4LF4Q 4LF4L 2R7ZB 1PUZA 5DAUA 3T13A 4PZ7A 4CKBA 1RG6A 2PYKA 2OHFA 4NB3A 3MR2A 3PSPA 2HW3A 3M6ZA 3RJIA 5AKGA 4B3RL 2AH5A 3H3VH 4MIUA 3THVA 4C80A 4K4IA 2I5MX 3HKZG 2NVTB 4RQNA 1H9SA 1IW7D 1J97A 1WOCA 4KY6A 4J9LA 3OGUA 1ZQRA 1SE8A 2NYVA 1K83H 2L11A 2RVLA 2SOBA 4LJZC 1CKOA 4IUVA 4XXEA 1PYBA 4DXFA 4Y2TA 1IW7C 1OO9B 5CV6A 2XIDA 2BCUA 2WF9A 1C4QA 4GLAC 1YJNA 1HHVA 1BBXC 1L2FA 1FFUA 4GC6A 4KN7A 1CT1D 1N63A 2K28A 1YIJA 2FJ6A 4JCVE 1VDZA 3M9BA 3VA5A 2YX8A 4JI7Q 4UB4A 3RRGA 3PV0A 1G2SA 2VW9A 3NUCA 5FLXL 2GA4B 3IHQB 1SYBA 5HR6A 1JI7A 4DLGA 4NLCA 1F2YA 4FP5D 5J2EA 2RF4A 3KUPA 1TXYA 4QB4A 3S2DH 1KLUD 3O13A 4L8JA 2E1FA 2NRZA 5AM0A 4F2SA 3IG8A 3SE0A 3DHQA 5IYBH 3WOFA 2WF7A 2OXPA 3PO3G 3FAHA 4BJQA 2EAPA 3S14B 5ALPA 5LMUQ 1ZD4A 4JV1A 1Q81C 3WKDA 1HZBA 1WTVA 1T94A 5IINA 2OXOA 4R64A 1TAMA 1G6PA 4IRCA 1E3PA 2FHTA 3JPSA 1ED1A 4NL9A 3RJFA 3RR8A 1YBYA 1HR0W 3M3YH 3D2QA 1BBWA 2B2TC 5JVG3 3PO3B 1W6JA 1G291 5C4JH 2UXDQ 3QU4A 3FHWA 1V1QA 2K5QA 4FDBA 3Q8PB 3M7DA 2WV6D 4A3DB 2EYLA 5AK4A 1XWEA 4BBRG 3J7AV 3RN5A 3ZI4A 1JWSD 3DV9A 1S10A 1K83B 2PI4A 1D1KA 3D6CA 1JN3A 2Q8TA 4NXNL 3RB3A 2CRXA 2BPFA 1EU4A 3HOWH 1B3AA 2VA8A 1U47A 3CCQA 3KFUF 4DXGA 1WTOA 1XMQL 1ZD5A 2JEAI 1TY0A 4A3CG 1J2NA 3RF9A 2MGSA 3VR4A 2XSCA 1AEXA 2KFNA 1MC8A 2J6TA 1N36L 5HMLA 1BXTA 3EROA 1PTOB 3QU5A 5ALRA 1CM9A 3NBIA 3KOJA 2CH4W 4RGOS 4A93H 5ALTA 3KHHA 4KD3A 5DB9A 4FZMA 4I27A 4RQ0A 4DR7L 3GILA 3TAQA 4KJOA 1DRGA 3RFAA 4DR6L 1TS3A 1M8AA 1HH2P 3CRKC 2ASDA 4KD4A 2Y0SB 1RDFA 2VB2X 3PR4A 1SE3A 1BKBA 4F4KA 1A3UA 1A0PA 2WP8J 4CF5A 2ESEA 4NLKA 4P2HA 2CFMA 3RLFA 1QNUA 2MP1A 4BY7B 2SNSA 1RODA 3NQIA 1T4GA 3HX0A 2ZIVB 1A63A 5KFIA 2NBFA 5H1SE 1BUVT 5DGAA 4YHHL 4CRXA 2Z1CA 1GJXA 3FYHA 2H3VA 3TFRA 2KEDA 3ISDA 2Q2TA 4TQUS 1RZTA 5EE3A 2BOSA 2ASLA 3TS0A 3TARA 3SENA 4KMUA 5BPCA 2PQAB 3EWAA 3M1YA 2H3FA 2EJFC 3TZDA 4DV6Q 2F03A 2OTLA 3DEOA 1ZOLA 1TK0A 5DNFA 1JMSA 1UEAB 2QB1A 4A3KB 4P0QA 1VF7A 1QSLA 3S1MB 1RYSA 3T4AC 2ZJAA 1UNSA 5J2CA 4RGTA 4IPHA 5ALIA 3HOYH 4EYIB 5F3XB 3C1YA 4YMOA 1C20A 4O5KA 2HUGA 2K60A 3URYA 1Z1BA 5DG8A 4DL7A 1EY4A 4A3FH 1PMRA 5AKEA 1KW4A 1SB3C 3D2NA 3SK6A 2KCMA 1BO0A 3CC7A 3L3FX 1S5BD 3RD4A 3GTGH 5K36H 4R4OA 3ZDDA 4R9WA 5CYUA 5AJ3L 4C4RA 4KHZA 2CW0D 3NGDA 1XNRQ 1IKLA 2A5HA 3Q8RB 4MN3A 2ZJ8A 1GKHA 2OEHA 2YYZA 1LYLA 3QUQA 4RUCA 2Q2IA 1KTQA 4KY5A 4JK1C 5FO9B 5GAEC 3HOXG 1GD7A 3AQQA 2R92B 1KIXA 1HQMC 2DGYA 3NUQA 8ICRA 2KOLA 2GVBA 5KT6A 3M8RA 1UWVA 4JV5L 5KFVA 4A76A 3LNNA 3ETLA 5CBEE 3JPTA 1FD7D 3HGBA 1HRJA 4LF8Q 2D6FC 1RQNA 4O3SA 2FMQA 5LL6S 1IBMQ 4NPSA 1KN5A 3U9OA 1J2MA 4YWKA 3ISCA 3CRLC 5J0XA 1WVLA 3VR5A 4R8UB 4R8NA 4CDCC 1WG8A 4UATA 2MUTA 1LTGD 2QF7A 1RXWA 5C4JB 4ED6A 4FF4A 4DFJA 4QZFA 2R8HA 2WFWA 5A35A 1J8IA 1CKNA 4TKOB 1V97A 4I2HA 3RZDB 5KTQA 1JWUD 3UXPA 4G3IA 2RLTA 1BPBA 2B63B 5KFJA 9ICMA 5M3FG 3CAMA 3Q8KA 4DK1A 3R8BA 1PRTC 4FO2A 1HXYD 2JRZA 1AE2A 4LF9Q 1H95A 4DFMA 4Z6DA 3V7LA 3RZOH 3MXPA 4RGMA 5KT2A 2CPRA 2DY7A 3BQ0A 2EZXA 3N7PD 4P0PB 1EWHA 1N8RC 2JXJA 1KDHA 2QGQA 1EIHA 4APVA 4QL5A 4USAA 5IIMA 1ECWA 1PTOH 3RMHA 1ZQVA 4ZKCB 4QJFA 4HJ9A 1N5XA 1A3TA 2HDOA 4X62Q 1IBKQ 1LT5D 1MSWD 2C22A 3LGJA 1RPLA 2WINB 1JMCA 1K8MA 4ZLTF 3JAMi 3F5AA 2HBJA 3SDZA 1GHKA 1MHWC 5J39A 1TFRA 1EYGA 1VDVA 2A8VA 5TZVA 4B9WA 1SROA 4DKAC 5C44G 5ALDA 2DKXA 5IGGA 1HFNA 4IQUA 5KL8B 5EKIA 8ICBA 3KBXA
chains in the Genus database with same CATH topology
1N32L 1Y1WH 3KJOA 2Z6KA 1KQSA 2GVAA 3M85A 2VUMG 4A3DH 1YHAA 1SLJA 4JI2L 2LSSA 2MFIA 4IOAA 1E22A 4B3TQ 3HOZH 1WJJA 2XGTA 2YTVA 4LFAQ 2QA4A 1D8LA 4A3JH 1I5FA 5FLMH 2JA8G 3HOUG 2K4KA 4X65Q 2KHJA 1PH9A 4DUYL 3ULJA 3J80c 4GOPB 1KL9A 1AH9A 4UY8C 1PA6A 1LUZA 4A75A 2HT1A 4BBSG 3G6EA 2A1AA 2B63G 1MIUA 2N78A 3ICEA 5FLXc 2UXBL 4NXML 2UXDL 3RN2A 4A4IA 1CSQA 1YNXA 4OWTB 3STBD 1K8GA 1N33Q 5M3FH 1PH7A 2IX0A 3KF6A 1EIYB 3G48A 3PF5A 2K75A 4JI5L 3EN2A 2VQFQ 2JA6H 1X56A 3STBC 4A3DG 3GO5A 2YV5A 3BU2A 4DK3C 3VDYA 1KC8C 4JYAQ 1I94Q 4EQ5A 1NTGA 2JA8H 1J5EQ 1VQJA 2NN6I 1VQEA 2WAQE 1TWFH 3S1NH 3U50C 2BH8A 5M5WH 1YEZA 3K80C 4A3MH 3RZDH 4Y7NH 1VQ9A 1QVCA 3S2HH 3I4NG 2KENA 4P72A 3W5OA 2NVXH 3IRBA 2ZJRA 3H15A 3CMEA 4RMFA 4BY7G 1Z9FA 5JEAG 2E2IH 2N49A 4DV7L 3HOVG 3K81C 3GTJH 2K5VA 2HIXA 4DR4L 1O7IA 4DV5L 4DNIA 1HZAA 2JA5G 1WI5A 4PZ6A 1OXVA 2AMCB 3CCUA 2PNHA 4DV6L 3T1YQ 3S15H 4GKKL 4C2MH 4X66L 3ULPA 1L1OC 2IHEA 1MJCA 4GNXB 4JYAL 4YHHQ 4IFDJ 1YZ7A 1N9WA 1FVIA 1TWHH 3TQYA 3A74A 4X64Q 2VQFL 4GOPA 1PH8A 1HNWL 1B70B 1Y1VH 4A3IG 1IBLL 5C4XG 4IOCA 4B3MQ 2I5HA 4HJ8A 1CKMA 3A5ZB 4HIKA 1YJWA 2ATWA 4IO9A 3KF8B 4A3LG 1BBUA 3UE1A 5IYBG 5JJKA 3PO3H 1Q86C 2ASBA 4EX5A 1FJGQ 1IZ6A 4JI0L 1TWGH 5ELNA 1XTDA 3KF6B 1UE1A 1S40A 3DM3A 1SRUA 3CW2C 2LXKA 2R7ZG 2IT1A 4TVAB 4AIMA 2YU9H 2IHFA 4DR4Q 3ZJYC 1VQ8A 5IE8A 4OONA 5ELOA 4DR5Q 5M5XH 2UUCQ 1L1OA 1U5KA 4OXPA 1Q46A 4R1JA 1X3FA 4JC0A 2K5HA 4PG3A 4PZ8A 4GS3A 2HQLA 5FJ8H 4RG1A 3ULLA 4JG2A 4DPGA 1UEBA 3E0EA 3F2BA 4DAMA 4DUZL 3KDFB 4KLKA 2AWNA 3OTOQ 1IBML 4MNOA 1S72A 5C44H 1JT8A 3AFQA 3HOVH 2UUAL 1XMQQ 1D7QA 4GKKQ 1Y1WG 2NN6G 1HNZL 2ZM6L 2VQEQ 1QZGA 1NJIC 4DUYQ 2MO0A 4DK6C 3KJPA 1VQDA 3SGIA 2Q2HA 3W1GA 1Q82C 3KDFA 1HR0L 4A3BH 1UE5A 1VQFA 3I55A 2NVTH 4LUZA 4JI1Q 4IPDA 3HOZG 4KHPL 1PYSB 4A93G 2UUBQ 4IPGA 3HOWG 2YTYA 5IP9H 5C0XI 3D31A 1JB7A 1KAWA 4XTCS 3M4PA 2VZAA 3FKIG 1PV4A 3CCEA 4WJ3M 1VQKA 1NMFA 5C3EG 2R92G 4DR6Q 3CQZH 2ZTDA 2FXQA 3TREA 4C3IH 4LFAL 4DV2L 2B63H 4IJHA 4HIMA 4A3LH 4QIWE 3UDFA 3HOXH 3OYYA 2E2JH 3OW2A 1MJEA 3PCOB 3UDXA 4DV3Q 4L5TA 1QZHA 4OWWB 3PUYA 4DV5Q 1V9PA 5LMNL 4JI6Q 1X3EA 2MNAA 1Q7YC 3CC2A 2C35B 4LF6Q 1SR3A 5BR8Q 4GN5A 1C9OA 2EQSA 1CSPA 4IJLA 4YCWA 3CF5A 4K0KL 4A3KH 2R7FA 5LMNW 2I0QA 2Z6KC 2MQHA 3RR5A 1HNZQ 3AEVA 1CKNB 1VQ6A 4X62L 4LF5L 5FJ8G 3UDGA 3KFUA 4GKJL 2RHQB 3GTQH 3S1MH 4GN3B 3JAMc 4Y52H 3BZKA 4DR1Q 1HNXL 3MEFA 2ES2A 3L0OA 1YHQA 2IY5B 2R7DA 3GTPH 2JEBI 4YY3Q 1WFQA 2E5LQ 4DAYB 5IYCG 1SN8A 1XMOQ 1PH6A 4A3GG 2LXJA 1K73C 2OTJA 4A3EG 4DV3L 1N36Q 2UU9Q 4NXNQ 3F1ZA 1W3SA 1UE7A 1VQMA 4A3FG 4JOIA 1VQIA 4L5RC 2JA7G 1GO3E 3H0GH 3Q8DA 1TWCH 1X3GA 4LUOA 1W2BA 1OXTA 3U58A 1GM5A 4AYBE 2OWOA 2ALYB 4UPAA 2BA1A 1E24A 2CWAA 4K0KQ 2ZM6Q 2VQEL 1YVCA 3FKIH 1VQBA 2R6GA 3T1HL 2WB1E 3M4QA 2KBNA 4HJAA 1Y14B 1XPOA 3F8TA 2R93H 2R92H 4LNQA 3NEMA 3CMAA 3PSIA 3CCRA 1U0LA 2B29A 3J80i 2ZTCA 1EFWA 1FL0A 3K7UC 4POFA 2A19A 1PH1A 4B3ML 4H02A 5BR8L 2R7ZH 1WCMG 4YWLA 2NVYH 1QVFA 4BXXH 2K5NA 4JBKA 4JV5Q 4DR2L 4LF9L 4WJ4A 2ZJPA 1OXSC 3MXNB 3ERSX 3WWVA 2N8NA 3AYHB 4OO1G 4J15A 2K14A 4R4CA 4DV4Q 4LF8L 3HOUH 4JOIC 5FLMG 2Y0SE 4B3SL 1VS0A 1JJCB 3I7FA 2F52A 1PH4A 4GLXA 3CCVA 3CC4A 1Q12A 1AE3A 3GDEA 1Q8KA 1VQHA 4BY1H 4QY7A 2GN5A 2OCEA 4R4TA 4UP7A 1FGUA 4OX9L 1SFOH 2R93G 1K8AC 4HIOA 1PH3A 4JBWA 1IXRA 1EOVA 4DR3Q 5E7NA 2F3IA 3GTOH 4KHPQ 2JJQA 1A0IA 3K7AH 2QEXA 2D0OA 4AQYQ 3A5UA 5IYCH 1YI2A 1YZ6A 3S14H 1B7YB 2OQ0A 2JQOA 2YTXA 4UP9A 4JI3L 2PI2A 3RNUA 4A3EH 1C7YA 4JI4Q 4MZ9A 3NENA 4P71A 1VQ4A 1XNQQ 2F4VQ 1FJGL 1XPUA 2JA9A 4C3JH 1JJ2A 3PIPA 4LF4L 4LF4Q 3GTLH 3PUWA 3H0GG 4C3HH 4PZ7A 1VQ7A 1B8AA 1EIFA 4NB3A 2ZJQA 3M4OH 4B3RL 1NE3A 1KXLA 3H3VH 4X6AH 3B6YA 1HNWQ 1KD1C 1XJVA 1OXUA 1QUQA 2I5MX 3HKZG 5HGQA 3CCJA 1V43A 3K8AA 3S1RH 1QVGA 2NVQH 4A3CH 3KLWA 1WOCA 5M3MH 3PO2H 1SE8A 1K83H 1X6OA 5IWAL 1HNXQ 2E2HH 4DR5L 1CKOA 4LFCL 3GTKH 1PYBA 1KHIA 1PFSA 1KRTA 4JI3Q 3U4ZA 1VCIA 3T1YL 1LTLA 4JI4L 1YJNA 4GLAC 3T1HQ 4BY7H 1WCMH 1L2FA 1YIJA 1E1TA 1P16A 1JE5A 1S3OA 4JCVE 1E1OA 3M9BA 2Q2UA 4JI7Q 1K9MC 1IL2A 3NELA 4MTNA 3PV0A 1X65A 4DV0Q 2VW9A 4GOPC 2IX1A 4JI2Q 1J5EL 3G71A 3RLOA 5K36G 4BBRH 3PIOA 2CCZA 3CCLA 1Z47A 2BA0A 3H3VI 3S24A 1Y1VG 2RF4A 1I50H 1TXYA 4OX9Q 3S2DH 1PH5A 4BBSH 3J81i 5IYBH 1G51A 3NBHB 5IP7H 3PO3G 3TEHB 1VQCA 5LMUQ 1PH2A 1Q81C 2K52A 2D0PA 1HZBA 2RCNA 4R4QA 4PMWA 4JI8L 1G6PA 4LF5Q 1E3PA 3PUZA 5J3BA 1HZ9A 4O2DA 2F4VL 1YBYA 4HJ5A 1HR0W 4A3GH 1EWIA 1DGSA 3M3YH 1BBWA 3ER0A 3I4OA 3GTMH 1G291 2ID0A 4YY3L 5C4JH 2UXDQ 4X65L 1YITA 3FHWA 1V1QA 4FDBA 1VQLA 3AFPA 4GLVB 1JJGA 3CPFA 4BBRG 3RN5A 4OWXB 4NXNL 2UU9L 1K0RA 4A3MG 1TWAH 3CCQA 1XMQL 5IYDH 2JEAI 1QUQB 4LFCQ 2WB1G 4LF7Q 4QQBX 4A3CG 5IWAQ 4DR7Q 1A62A 3W1BA 4DV2Q 4LFBQ 2NZOA 5LMUL 3HOYG 1N36L 4QGUA 1K3RA 3BJUA 1OXXK 2WAQG 3I56A 2PI2E 1T9HA 3KOJA 3RLNA 1IBKL 4A3BG 2XTIA 4O0AA 4A93H 2Y0SG 4NXMQ 3HOWH 2UUCL 1KRSA 3PF4A 3GD7A 5IP9G 1NY4A 4DR7L 4LF7L 3KYHC 4DR6L 1E7ZA 2KHIA 3K0XA 4XIGS 1X55A 3CP0A 4BY1G 2HHHQ 1HH2P 1N32Q 4AQYL 5IYDG 4YWMA 3J7ZC 3E9HA 3F2CA 1I3QH 4YCVA 1BKBA 2VY3A 2WP8J 2Z0SA 1PHJA 4DUZQ 5IY0A 5GROA 1ASZA 2CFMA 3RLFA 1P8LA 2JK8A 2ZTEA 4R4IA 4LF6L 2AHOB 4P75A 3D0FA 2EXDA 1A63A 5AJ3Q 3S1QH 3J81c 1VQOA 2E5LL 4B3SQ 1EQRA 4IFDI 5H1SE 4P74A 4LFBL 3I2ZA 4YHHL 3G4SA 1NMGA 2UXBQ 4DV0L 4A3KG 2UUBL 2MO1A 4JBJA 2D62A 1EQQA 1N34L 1M1KC 4TQUS 2Q2TA 4KI0A 4JI7L 2AKWB 3TS0A 1XNQL 1L1OB 3CPWA 1RIPA 2KCTA 2PQAB 4DV6Q 2BH2A 2OTLA 1L0WA 4JI0Q 2NZHA 4HIDA 4LWCA 1PVOA 1Q1EA 2N3SA 3E9IA 1HR0Q 3I4MH 3HFZB 5GAHC 3TS2A 3TRZA 3CCSA 2H5XA 4IPHA 3HOYH 4POGA 2JE6I 3HKZE 3S16H 2UUAQ 3HKSA 5GAGC 2VL6A 4JI8Q 1N34Q 1HJPA 4BA1I 3U4VA 2RHSB 3UDIA 4A3FH 3OTOL 3EIVA 1MKHA 4IFDG 2KCMA 3CC7A 3GTGH 2K50A 4R4OA 5DLQE 1UE6A 1VQAA 2OQKA 5AJ3L 3F2DA 3PUXA 4LUVA 4KHZA 2UXCL 1XNRQ 2UXCQ 2PMZE 1VQNA 1IYJB 1GKHA 2YYZA 5IP7G 4X64L 2HIVA 5C3EH 2CKZB 5M5YH 1LYLA 5JEAJ 2Q2IA 3A0JA 1LM0A 3I4NH 5GAEC 4DR3L 3HOXG 1GD7A 3AQQA 1GVPA 1HZCA 3CXCA 2DGYA 1KIXA 3JC66 2GVBA 4X66Q 1XPRA 4GNXA 1UWVA 4JV5L 1I6HH 4A76A 5C0XG 2EIFA 1C0AA 2JA5H 2VUMH 2DUDA 5C0XJ 2CQOA 4JBMA 1BVSA 2AWOA 4DV4L 4LF8Q 4P73A 4DV7Q 4HJ7A 1IBMQ 3BZCA 1WYDA 4NPSA 1ASYA 3M7NA 4B3TL 4YWKA 3CCMA 3L2PA 4AH6A 2PQAA 5JJIA 3UE0A 5GADC 2E8GA 4B3RQ 5C4XH