2A1AA

Pkr kinase domain-eif2alpha complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
161
Chain Sequence
SHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
total genus 47
structure length 161
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a1aA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a1aA01
1BBUA 1VQ7A 2VNUD 2RCNA 4HJ9A 2AKWB 4BBRH 5IYBH 4DV0Q 2R92G 1HNXQ 3FHWA 4B3MQ 1QUQB 2NVTH 1IBMQ 3GTQH 3KF8B 1FGUA 2ZTDA 2CCZA 3M4OH 1I50H 1JB7A 5LMUL 4DV7Q 1K83H 1K8AC 2IY5B 3F2BA 4DV3L 5FLMG 4R4QA 1O7IA 1HR0W 5LMUQ 4IJLA 1Q8KA 4IOAA 4NXNQ 5HGQA 4DV2L 1Q46A 1LUZA 2K52A 5GROA 1K9MC 3TRZA 4B3TQ 1N36Q 4DR7Q 3I7FA 3F8TA 4WJ3M 4DAMA 4PG3A 2NVXH 3HOVH 1HNZL 2LXJA 3CF5A 4JV5Q 3CCVA 1HNWL 2YTYA 1I3QH 3KJOA 2NZHA 2JA8G 1PH4A 3CQZH 1XPRA 1B70B 2JEAI 4HIMA 2HT1A 4KI0A 1W2BA 1HJPA 4AH6A 4DR2L 1S40A 3E0EA 3CCRA 2PNHA 1VQMA 2IT1A 4BY1G 1WJJA 2E2IH 3UDXA 2N3SA 3ERSX 3K7UC 5C0XG 3BZCA 2VUMG 2Z6KA 4MTNA 4DR6L 1H95A 2B29A 2EIFA 5LMNW 4LF5L 3PF4A 1Z9FA 4LF4Q 4IFDI 2A19A 2PI2A 4LF5Q 4GOPA 3TS0A 3FKIG 4C3JH 1PH3A 1FL0A 1VQ9A 1QZGA 4NXMQ 3CD6A 1PYBA 3J7ZC 3HKSA 5AJ3L 1PH5A 1D7QA 4GKKL 1VQGA 1CUKA 1YZ7A 3KDFA 1ASZA 1IBKL 3NBHB 5E7NA 3U58A 2K4KA 3H0GG 4QJFA 3KF6A 3ICEA 2VS1A 1FVIA 4YY3L 1X6OA 5C3EG 4JYAQ 1A0IA 2XTIA 3KOJA 2N78A 3KDFB 1MJEA 2JA5G 3J81c 4A3IG 1TWFH 4YY3Q 1EFWA 3E9HA 2E2JH 1VQLA 4BY7G 3UDIA 2GVAA 1IYJB 4LW1A 1EWIA 1KD1C 5J3BA 1GM5A 4DV4L 4FDBA 4IPCA 1XNQQ 4LUZA 3U4VA 2JJQA 1Q1BA 3K8AA 2ZJPA 4LNQA 2B63H 2WFWA 4X65Q 4LF8Q 4A3BG 1JJ2A 1HZBA 4JI4Q 5IT9c 1JMCA 1A62A 1P16A 2VW9A 3AFPA 4JI6L 2QEXA 1KC8C 1XPUA 1QVCA 4UP7A 5GAGC 1XMOQ 4A3LH 1E24A 2VQFQ 1G6PA 2NZOA 3PUVA 4JI6Q 1VQ8A 2E8GA 3L0OA 5IP7H 4A3FH 5JJKA 2ATWA 5BR8Q 4A3JG 4HJ8A 1YHAA 2YV5A 1RL2A 2PQAB 1KRTA 4C2MH 2KHIA 4Y7NH 1OXVA 1XPOA 2AMCB 2K50A 3PSIA 1VQEA 2VL6A 3U4ZA 2R93G 1YI2A 1Q82C 3HOZG 4BXXG 3A74A 1WYDA 2WB1E 4YHHL 4A3DG 3CCQA 1I94Q 3S1QH 1VQNA 2N49A 1HR0Q 2F4VQ 4DUZL 5M3FH 4RG1A 4DKAC 1KXLA 5M5WH 4LF9L 3A5ZB 1NE3A 3T1HL 3F2DA 5FLXc 4JI4L 2MNAA 3RNUA 1KRSA 4AIMA 3DLLA 4UP8A 4X66L 2H5XA 1R9TH 4BBRG 1L0WA 4K0KQ 1XMQQ 5IYBG 3T1HQ 2UUBQ 2K14A 4OO1I 3I55A 4PMWA 2OQ0A 1JE5A 3CP0A 3HOYH 3M85A 5JJIA 2XGTA 4JI1Q 1L1OC 3L2PA 5IYDH 2YTVA 5K36G 1E1OA 4YCWA 2E5LL 4ME3A 3OTOL 1SLJA 2UXDL 2AWOA 2N8NA 1HZ9A 3UE1A 4DUYL 4JBKA 1X3EA 1VCIA 4A3MG 4EQ5A 2UUCL 1PH9A 4JI7L 5LMNL 1G51A 4DUYQ 4HIDA 4C3HH 3JAMi 3PIOA 3HOVG 2QGQA 5LMNQ 1YZ6A 4JBJA 4DV0L 1XNRQ 1HNXL 4B3ML 1X65A 4QL5A 2R7FA 2JA6H 1IBML 2D0OA 4UP9A 1K3RA 1EIYB 1VQKA 3J80i 4KLKA 3KYHC 4L5TA 3I56A 1OXSC 1VQBA 2I5HA 4DV7L 1NY4A 4DK6C 4NB3A 5C4XH 4OONA 4TVAB 3NEMA 1Y14B 2Z6KC 4HIKA 2JA7H 4A3CH 1C9OA 3UDFA 2HIVA 4DV5L 1Z47A 3S1MH 3HOUH 1X55A 4NXNL 4OWTB 2WB1G 3EN2A 4EX5A 3GTLH 1L1OA 1PH6A 4A3EH 4B3TL 4DV5Q 1V1QA 1N36L 1HH2P 1VQDA 4QGUA 4LF6Q 4DR7L 2Y0SE 4GOPC 4HJ7A 4RMFA 4GNXA 3HKZG 1KAWA 4JV5L 1L1OB 1PA6A 3I4NG 2JQOA 1GD7A 1S3OA 1P8LA 3H15A 1KHIA 1X56A 4X62L 4B3RL 1FJGL 3HOXG 4GNXB 3KFUA 1SR3A 2WAQE 1NJIC 1SROA 4JI8Q 2BA1A 4GLAC 4IO9A 4X62Q 4B3RQ 1FJGQ 4MZ9A 5IP9H 1N34L 5M5XH 2R7ZH 1IXRA 2KBNA 1OTCA 2B3GA 2MO1A 5C0XI 1IZ6A 4JC0A 3A5UA 4AQYQ 4OWWB 1UE6A 4C3IH 4POFA 1VQFA 1N34Q 4LF4L 1PH8A 3W1BA 1NMFA 3CMEA 5FJ8H 3S2DH 4HJAA 1UWVA 4R4CA 2ZTEA 1CKNA 4OXPA 1WFQA 4L5QA 4NXML 1UEBA 4A3KG 2B63G 3NELA 3U50C 3S1RH 1B7YB 4JBMA 3PO2H 4LFAQ 2KHJA 3T1YQ 4DR5Q 5C4JH 2VUMH 5GAHC 1YJWA 4J15A 1J5EQ 3RN2A 3S15H 2ZJRA 2Q2UA 4JYAL 2MQHA 4P71A 4A3LG 4IPGA 3CCUA 4GOPB 2Q2TA 2CQOA 3CCLA 2ES2A 3L7ZC 5IP7G 4A3FG 1WI5A 1IBLQ 1PV4A 4MNOA 2NVQH 1VQ5A 4GN4B 1PYSB 2EXDA 3G71A 4DV6Q 3GDEA 1AE2A 3KF6B 1YHQA 1N9WA 3LGJA 1GKHA 2HQLA 2I5MX 5ELOA 1XNQL 2Y0SG 3J7A5 2K75A 3JC66 5GQOA 1KIXA 2UUAQ 3RZOH 3G48A 3CCEA 4X65L 4LF8L 4LFBQ 2AHOB 2EQSA 3MEFA 5EAYA 3STBD 2Q2HA 5M3FG 3CC7A 1YJNA 4JI0Q 2LXKA 2WAQG 3I4OA 1XMOL 2VQFL 1VQPA 2GN5A 4DPGA 4ALPA 2JEBI 4B3SQ 4JBWA 5BR8L 3HOYG 2UXCQ 2L15A 4UY8C 2UXBQ 5IYDG 3HOWH 4BA2I 2OWOA 1JJCB 4O2DA 3ER0A 4GLXA 1SRUA 4PZ6A 4JI5L 3I4MG 1ASYA 4A3GH 1AH9A 1I94L 4LF7Q 1HR0L 2F4VL 2KCMA 3GTGH 4JI5Q 1A8VA 4JI2Q 3ULLA 3GTKH 3CPFA 4O0AA 1YHBA 1N32L 4K0KL 3I2ZA 3PUZA 1OXUA 3HKZE 1XMQL 1YEZA 2UUBL 4QY7A 4LFCQ 3S1NH 2JA6G 1N32Q 2UU9Q 2A8VA 1EYGA 1PFSA 3G6EA 1BBWA 2CWPA 4DR1Q 1Y1WH 2HHHL 4A93H 4JI1L 2ZTCA 3TQYA 2JA9A 5GADC 4HIOA 4POGA 4KHZA 4IFDJ 4A3CG 3W5OA 1LYLA 2VQEL 1VQJA 1WCMH 2CFMA 2NN6I 2OCEA 1GO3E 3GO5A 1VQ4A 2HHHQ 2JA7G 1YNXA 2LSSA 2VQEQ 3A0JA 1U0LA 1CSPA 2MFIA 4A3EG 5M3MH 1HZCA 2VY3A 4P72A 3J81i 2IHFA 4GNXC 1A63A 1V43A 3RLNA 1SE8A 4IPHA 1JJGA 5JEAJ 1UE7A 1SN8A 2CKZB 5DLQE 4P73A 4R4IA 2OQKA 3K7AH 1XNRL 1NBWA 2K5VA 4GLVB 1Q81C 3GD7A 1AE3A 2D62A 1EOVA 1OXTA 1Q1EA 3CXCA 3GTMH 3D0FA 4GN5A 4XTCS 5C44H 3PUXA 2GVBA 4YWKA 4R1JA 5IP9G 3WWVA 1N8RC 3IRBA 2RHSB 4A3JH 3KLWA 4JI3Q 1LM0A 2A1AA 2KCTA 4GN3B 1C0AA 1UE5A 4DV1Q 2FXQA 1Y1VH 4PZ8A 2YU9H 2IX0A 4LF6L 4WJ4A 3J81j 3PCOB 1PH1A 4BBSH 2JE6I 5FJ8G 1UE1A 4DR3L 4A3DH 1V9PA 2BA0A 4GS3A 1CSQA 4BA1I 5IYCH 3PF5A 4GKJL 4UPAA 2PMZE 4OX9Q 2RHQB 4OWXB 4NPSA 4DR3Q 3PO3H 3CPWA 1VQ6A 3EBEA 5ELNA 3PO2G 4GKJQ 4Y52H 1K0RA 2C35B 4JI8L 1X3FA 4P74A 1EQRA 1MKHA 3TEHB 1K73C 2ASBA 3CMAA 2RF4A 4AQYL 1E7ZA 1N33L 4P75A 2IHEA 1M1KC 4YWMA 5IY0A 1N33Q 1QVGA 3RR5A 2DUDA 2Z0SA 4LWCA 4DV3Q 4HJ5A 4A3MH 2R7DA 3M3YH 2BH2A 2ID0A 3M4QA 3BZKA 4X6AH 4DV2Q 3S14H 4YWLA 3T1YL 1C7YA 4LFAL 4DR5L 1J5EL 5IE8A 1YVCA 4JOIC 3K0XA 3M9BA 3SGIA 1HNZQ 1CKNB 1HNWQ 1XTDA 1B8AA 3KJPA 2R92H 1IBLL 1QVFA 1KL9A 4R4TA 3GTOH 2OTLA 3E9IA 4DV6L 1BVSA 3G4SA 3F1ZA 4DR2Q 2D0PA 4QIWE 1Q7YC 3HOWG 1YIJA 2AWNA 1E3PA 1GVPA 3TS2A 2R6GA 5FLMH 2UUAL 1DGSA 4DNIA 4A3GG 1MIUA 1TWCH 1K8GA 3M4PA 4PZ7A 4LFBL 1PH2A 2K5NA 1CKOA 4IPDA 1D8LA 4DR6Q 2F3IA 3CAMA 3Q8DA 2BH8A 1PH7A 3S2HH 4IFDG 1G291 4XIGS 4JI0L 1VS0A 3I4NH 3S17H 4YCUA 2IX1A 4IOCA 1PHJA 3HOXH 3D31A 1VQIA 4B3SL 2JA8H 1QZHA 2DGYA 3HFZB 1EUJA 3K81C 5AJ3Q 1Y1WG 4GKKQ 4JOIA 4A93G 2UXCL 5JEAG 1IBKQ 2UXBL 5H1SE 5JJLA 1BKBA 1J6QA 1MJCA 3ZJYC 4L5SA 3MXNB 3RN5A 2K5HA 1LTLA 3UE0A 1YJ9A 1WCMG 2Q2IA 4BY1H 1T9HA 3DM3A 4A4IA 3CCSA 1VQHA 4H02A 4JG2A 1WOCA 4QQBX 2ZM6L 4LF7L 3JAMc 3CCJA 1TXYA 5M3MG 3NENA 3VDYA 4DR4L 4AYBE 4JI2L 3S16H 2HIXA 3GTJH 1I5FA 2ZM6Q 5IWAL 3W1GA 1RIPA 1KQSA 4DR4Q 4DV4Q 3RLOA 4A3KH 1VQAA 2YTXA 4IJHA 1XJVA 4LFCL 5IWAQ 2KENA 3FKIH 3J80c 2OTJA 2UU9L 1NMGA 3H3VI 4KHPL 5C0XJ 3UDGA 1M90C 4YCVA 4DR1L 3ULJA 2PQAA 1SMXA 4JCVE 5C44G 3H0GH 2YYZA 3TREA 4KHPQ 1JT8A 5C3EH 1E22A 2JA5H 4R4OA 5C4XG 2WP8J 4A76A 4A3IH 2CWAA 1YITA 3EIVA 2ALYB 1Y1VG 4APVA 1EQQA 4BY7H 3M7NA 3HOUG 4LF9Q 4BBSG 4A75A 4X64L 2F52A 3CW2C 5M5YH 1HZAA 5IYCG 1Q86C 3CCMA 3B6YA 1TWAH 1NTGA 4TQUS 4YHHQ 3PUWA 4X64Q 3PO3G 1I6HH 3F2CA 1X9NA 3PUYA 4A3BH 1TWHH 2QA4A 4DUZQ 3S24A 3PGZA 1W3SA 2PI2E 3ULPA 3OYYA 2VZAA 3AYHB 3PV0A 2I5LX 1Q12A 1VQCA 1SFOH 3FP9A 4X66Q 1X54A 1S72A 2E2HH 3GTPH 1TWGH 4OO1G 3BU2A 1YBYA 4JI3L 3BJUA 3K80C 2ZJQA 1PVOA 4LUVA 1CKMA 4DV1L 1E1TA 2NN6G 2R7ZG 4L5RC 2I0QA 1X3GA 3AQQA 4AYBG 4DK3C 3I4MH 3CC4A 1OXXK 2E5LQ 4DAYB 5GAEC 3AFQA 1EIFA 3OTOQ 1U5KA 3RLFA 3CC2A 4OX9L 2UXDQ 2R93H 3HOZH 1IL2A 4BXXH 2JK8A 2UUCQ 3PIPA 2NVYH 4JI7Q 1L2FA 4LUOA 3STBC 1VQOA 2MO0A 2V1CC 1QUQA 5HY6A 3RZDH 3H3VH 3AEVA 3OW2A
chains in the Genus database with same CATH superfamily
1BBUA 1SJED 1VQ7A 4H7BA 1U9LA 4DEZA 4DL2A 3DWPA 4JW0A 4HJ9A 2XCAA 1AW7A 1KBUA 5IT9L 3RAXA 2R92G 1QTMA 4B3MQ 5AKIA 2XWJB 3E0FA 1QUQB 1IBMQ 3GTQH 3JAME 1STHA 2XGQA 2ZTDA 1QE6A 1F77A 2CCZA 4DL7A 1JB7A 3HZXA 2IOFK 2FMSA 4RNNA 2R7ZB 4R4QA 1O7IA 1JR0D 1RF2D 5M5XB 1D2BA 2Y1JA 2DY7A 4N8FA 4IOAA 1EY5A 2RDFA 4DSEA 5IGFA 4J9LA 3HW8A 3G6XA 2Z6BA 3IV6A 3NBIA 5EOZA 5JVH3 2E8NA 1OO9B 2CH4A 3RRHA 3F8TA 5DKWA 2B2YC 3GQCA 4PG3A 5BN4A 2NV3A 5D3IB 3HOVH 4I65A 4F72A 3ONNA 4JV5Q 4ECVA 1HNWL 1TFRA 3HP3A 2PXIA 1MSHA 1PH4A 2XN9C 1XX8A 2EYPA 5FLXL 2W03A 1T4GA 3LK9A 1HJPA 1T5EA 3EJIA 1S40A 3CCRA 3VC8A 2SNMA 3HWTA 1WJJA 2E2IH 1L7OA 4FF4A 4FNFA 1A2UA 3ZYYX 2Z6KA 5AKLA 2CN1A 2EY2A 1H95A 5LMNW 1QG7A 4LF5L 4LF4Q 3SHLA 3BYTB 1BPEA 5CYUA 1WTXA 5KFJA 3BQ7A 5AM4A 4FF1A 5B66U 3TS0A 4NXMQ 4MHEA 1GXDC 1CRXA 4WJ3B 2DQNB 4Q5VA 4GKKL 1CUKA 2B2YA 3NBHB 2BGWA 5J2GA 1B9MA 2KP7A 2WB1F 3LVVA 1LTSD 2VS1A 3ICEA 1X6OA 2H3QA 1A0IA 5EE1A 1A15A 3KOJA 1MJEA 3NVVA 2JA5G 4A3IG 2B6GA 3D2SA 3NVWA 1T5XD 1TWFH 1LTGD 2E2JH 4K2KA 8ICEA 3W3AA 2OEHA 1IYJB 1RDPD 2GVAA 3SAHA 1ZQBA 1X42A 1FR3A 4LW1A 4ZQ3A 5J3BA 3TSSA 1KD1C 4F5QA 3RR7A 4OHJA 4IPCA 5DLFA 1MBYA 4FS1A 4DFMA 3DV9A 3U4VA 2ISOA 4NLKA 1CK1A 3K8AA 3SK5A 2ZJPA 4LNQA 5IGCA 5CHGA 4LF8Q 4FBUA 1X32A 2KTQA 4IRCA 5IT9c 1JMCA 3H8SA 4B9LA 1DRGA 2DN8A 3D3RA 2YB4A 1P16A 2VW9A 4OELB 4ED3A 1KC8C 3S1NB 5GAGC 5FOBB 1E24A 3A54A 2NZOA 4JI6Q 4A93B 1ZYQA 2TMPA 2LYAA 3THVA 5ALPA 8ICKA 4KLSA 5JPNC 1XPOA 2VL6A 4PMCA 3ISBA 1ZQAA 4BXXG 3JPTA 1F0MA 1CT1D 3N28A 4YMOA 1ZD4A 2N49A 1HR0Q 1XO0A 4RG1A 5J2DA 3RB6A 4IN3A 2D8CA 1XS9D 3F2DA 4CRXA 5FLXc 2MNAA 5AM1A 1BGXT 5IODA 4RQ5A 3QE9Y 4K0KQ 4J9OA 4CF5A 4ECSA 3T1HQ 3BDCA 5KFKA 5EBDA 3UMBA 3IFDA 4QZCA 2N88A 1KN5A 4QZAA 3DUZA 3I55A 2KKPA 4RKBA 1L1OC 3U9OA 4YCWA 9ICIA 2E5LL 1YNJC 1ONLA 1SLJA 5HMLA 4KLLA 2N8NA 1C8CA 3TARA 5L1JA 2JZBA 3SR6A 1N60A 5HHIA 4EQ5A 1ZQDA 2RBMA 1KSPA 1PH9A 4EX6A 1G51A 5LMNL 2GOLA 4TUQA 4C3HH 4IURA 5J0SA 1V8QA 5G5GA 1TKWB 5CR0A 3L3OC 2BCRA 1NI3A 1I4XA 3PO3B 4JBJA 4EBEA 1XC9A 4F2RA 4B3ML 5KG7A 4IR9A 3DHQA 4OGQC 5JUMA 1IBML 2D0OA 2JA6H 5KL1B 4UW9A 5KYLA 3NPPA 3QIAA 4DXGA 5DB9A 3I3CA 1SXDA 3SD7A 4OONA 3LWUA 3MR5A 3DEOA 2P35A 1XXGA 3UDFA 1Z47A 1MHWC 3HOUH 4X3TA 3SMVA 4YMMA 2PFNA 1L1OA 3SV3A 4A3EH 1V1QA 3GIJA 4F2SA 5IT9E 2RDHA 3E5SA 3BJYA 3D6JA 3KHRA 3HKZG 1Y8PB 1SXEA 3OPXA 2GWSA 1L1OB 4C3JG 4JV5L 2MP1A 2IX3A 2YMMA 1GD7A 1S3OA 2DNEA 1P8LA 3C29A 3S14B 2ES6A 1FJGL 2KIVA 4F4WA 3URYA 2WAQE 4HCSA 3L9AX 1PK3A 4IO9A 9ICUA 4X62Q 1GHKA 2A5HA 3I70A 1ILQA 5FO7B 4MZ9A 5CP2A 4H0LC 2R92B 4NL9A 3A5UA 1U49A 3CRKC 3CRXA 3J7AF 1S4ZA 1VQFA 1F9SA 4LF4L 5ALZA 2CRXA 2AGPA 1EY4A 2RA4A 4P2HA 1PH8A 4YQWA 3TADC 5KT3A 3CMEA 4PHEA 3JPSA 5FLXE 1HUOA 5KFEA 2R8HA 2KVSA 4RT2A 2ZTEA 1EZ6A 4EZ6A 1HEKA 1O7ZA 2EYLA 4OXPA 3BS7A 4JPBW 4NXML 1UEBA 1D8YA 3U50C 4DSIA 2XY5A 3IRUA 5ALLA 5FP0A 5C4JH 3H4DA 2G06A 1II3A 1PUZA 5GAHC 3RN2A 1YJWA 2YTUA 2F0FA 3EA6A 3S17B 4ELVA 3R9KA 5C0YA 3CCUA 1O7YA 3DXJC 2B2UC 3PSFA 2HW3A 3WKBA 2PCFB 3KZXA 1WI5A 4O42A 3RMHA 1SNDA 3H91A 4MNOA 2RP5A 3IM1A 1F2ZA 2EXDA 4QJFB 4WJWA 3LGJA 1GKHA 1TV9A 2I5MX 5ELOA 2HHWA 3JC66 5GQOA 2HHXA 3G48A 3RH5A 4LF8L 4J1MA 1ESRA 3MEFA 5A0LA 1LACA 2L55A 3WOEA 5ALJA 2WAQG 2H1EA 2WKCA 1PZID 5CJ7A 3TI0A 2F0GA 4ED1A 3QZ8A 2LM1A 2GN5A 2X6GA 1ZOLA 4BDPA 3H94A 4QZIA 4FZNA 1WYGA 3F5EA 5DQHA 2R8IA 1RDFA 3VA7A 3HOYG 2L15A 3LYSA 1G8ZD 2NZ1D 1HRJA 4PL1A 5IYDG 3BS5A 4NLCA 1IKLA 1I4RA 1DCZA 3FAHA 2JA5B 3TANA 4IQVA 4PZ6A 3T16A 4A3IB 1ASYA 1SYDA 4A3GH 4C80A 4UDUC 4FXGC 3H3VC 5KG5A 3C2KA 1HR0L 3H09A 3BS5B 3J7AV 4JI5Q 1CQVA 2MJ8A 4IFDH 2KVCA 3KLSX 4PGQA 4M9HA 2BPCA 2HHTA 3IG8A 7ICOA 2RQXA 2HDLA 5ELDA 4K0KL 3NWSA 5E79U 2GH1A 4F91B 2KECA 1N32Q 1PFSA 3G6EA 2JP1A 4G9BA 1R4QB 9ICHA 5JEAH 2A1JA 2PMZF 2JA9A 5GADC 1SBBB 1KNEA 3W5OA 1VQJA 1SDFA 1TWGB 2KSOB 4O0IA 2HHHQ 5IIJA 4MEYA 3T53B 2VQEQ 1N5XA 2NO4A 2EDGA 4CKBA 5M3MH 3J81i 3BQ2A 1A3UA 1V43A 4JK1C 3RLNA 4QZFA 1SE8A 1ET6A 1A3TA 2FMQA 2FJ6A 1Z00A 2KE7A 5J2AA 2EY6A 4R4IA 1NBWA 2EJGC 1ZQVA 2F1MA 5JTIA 1ZQIA 3CXCA 4NLBA 4GN5A 4MFCA 3HG9A 4XTCS 5AKZA 5KNDA 3QUBA 2KVMA 5C44H 1C20A 1V38A 4YWKA 3KBGA 5ALRA 5IIOA 1SMYC 2WKDA 3RJGA 1LM0A 1XNSA 3QUTA 3HKZC 3NTHA 2IX0A 4WJ4A 1URJA 2ZXPA 3EQLC 3J81j 1PH1A 2JE6I 4DR3L 3KOOA 3AU6A 5HP4A 1UE1A 3NWTA 5ALGA 2ENBA 4UPAA 5D46A 1RXWA 3TQ1A 4M9LA 1BCPF 2RHQB 4S3SA 5ALDA 3QOJA 3CPWA 2VJ5A 1Z7TA 4JK1A 1H9RA 5TISU 3EBEA 5ELNA 3T4AC 1N63A 3PO2G 4O3MA 1K0RA 2C35B 3VR4A 3GV8B 4BXOA 1EY8A 3SAFA 2X69A 4P74A 3TEHB 1B9NA 2NRWA 1K73C 3ITPA 2ASBA 3CMAA 3KZIU 2YY6A 3CQZB 2BR0A 4Y2YA 1JALA 1HQRD 3QUCA 1LABA 1ZQYA 4DQIA 1EIGA 2F0HA 4U68A 2KHSA 1S0VA 3ND8A 5CV6A 1QVGA 2W9BB 4F4ZA 2I9GA 2DUDA 2Z0SA 3HEJA 4LWCA 5DEHA 3TDQA 1SNOA 4WRDA 2R7DA 3M3YH 5KFIA 2KJ8A 5ALWA 1PLFA 2BH2A 3LDAA 1H9SA 5J39A 4DCCA 1TWCB 4J9RA 4DV2Q 1KFSA 1Q8IA 1A6SA 3MR6A 2EYJA 3HKZB 4JOIC 3K0XA 2W11A 1S77D 4JVZA 4C3JB 4CF3A 5C5LA 3KD3A 1B8AA 2KFNA 1MI2A 4UB3A 4HMJA 2WTFA 2G9HD 4R4TA 1J2NA 3TZUA 1QVFA 1SNQA 3RB3A 4HCEA 2OTLA 3E9IA 5ELBA 2KMDA 2K32A 1XSPA 1YNJD 3FMCA 3RUZA 5E3FA 3IG5A 1F9RA 4DNIA 1O08A 1K8GA 1TWCH 2QB0B 3V6HA 3FPPA 3WKAA 1X66A 2WAQC 4DWIA 3Q8DA 2RDGA 4IPDA 2BH8A 5CGKA 8ICLA 5EKKA 1PH7A 1G291 1TVXA 4XIGS 3T5KA 4B6JA 1IIPA 4YCUA 4Y2PA 1EYCA 5ALUA 2F0VA 2IX1A 3FDSA 2ZIWB 1F9PA 1PHJA 4YR3A 4DSKA 2A6ED 5TSSA 3UMGA 1QCBD 1EUJA 3K81C 1Y1WG 2BQ3A 4JOIA 1M4VA 4ZCKA 3C5FA 5H1SE 1J6QA 5EKIA 1MJCA 4K5VA 4G3IA 2XVTA 7ICUA 1YJ9A 1WCMG 1W6JA 2DPIA 3DM3A 2G5HB 3CCSA 5KFVA 1VQHA 2OM6A 3D2NA 5HMMA 5JVG3 3D2QA 4TSSA 3NENA 4C2MB 4DR4L 4Y7NB 1XU4A 3S16H 4Z6EA 2NUCA 4JMUA 1RTOA 3GTJH 2P5ZX 4IC9A 2FDRA 4NY8A 3W1GA 1CHQD 1TT2A 1VQAA 1L8OA 9ICTA 5C3WA 3U26A 2PYKA 4QIWC 3KBBA 3Q8LA 2KENA 4UAUA 3C1YA 5AKEA 5KFNA 1OUQA 2O2LD 4F92B 3TZDA 3Q8SB 1D1KA 5C0XJ 4K14A 5T1IA 2CVRA 2OXPA 4NLZA 4I28A 2WAQB 4DL3A 4P4MA 5IIIA 1HTPA 2YYZA 4KHPQ 9ICMA 5KFYA 3M4YA 4ZLTF 8ICPA 3N52A 5C4XG 2ODGA 1U47A 3GTPB 5AK5A 1QILA 3MDAA 1MN8A 4APVA 3HOYB 3QU4A 3GILA 1QQ7A 3GZFA 5CORA 3OSPA 4CE6A 5HR6A 2K5WA 2KICA 4GXIA 2F52A 5IYCG 4R8NA 9ICXA 4CBVA 1Q86C 2LHTA 4QZHA 2MGSA 4QWEA 3PUWA 3QWNA 3OMGA 4YHHQ 3V7JA 3OJUA 1D5MC 1TWHH 1K0SA 5ALFA 3S24A 1RXVA 5J0XA 3V2TA 5AM0A 2B39A 3PX4A 4EQPA 3V6KA 1EU4A 1VQCA 2I5LX 2FPLA 8ICAA 4RFBA 5JPMC 1L3VA 4K8JA 4F7XA 1S72A 3GTPH 2NRVA 1FYCA 2JEJA 4TURA 4DAYA 5JAVA 1JROA 1E1TA 2MUTB 3AL0B 5JOBA 4QIWB 4LZGA 1EQVA 2R7ZG 2OH2A 5IIMA 2FHTA 1COKA 4DFPA 1XTCD 4CJ0B 1X40A 8ICCA 4C3IG 2HI0A 3AN1A 5KFZA 3J81L 1I50B 5KT2A 4RQ1A 1PFBA 2BKEA 4DAYB 3RLFA 1NKEA 7ICEA 4UAYA 4I2FA 4I2GA 4IUUA 1VF7A 4C7YA 1SNCA 3LVWA 3PIPA 3STBC 4DF4A 3U9SA 5CC4A 1KQQA 2KNJA 2KUMA 3WKEA 4IQZA 1Z3EB 1ZQUA 2RCNA 2BDNA 1B0XA 5JJZA 2HHQA 1NAPA 3KUPA 2K28A 2PZTA 3AB9A 1Z19A 1FO4A 4OL7A 1T8EA 1VMCA 5CV4A 2NVTH 5L1MA 1FGUA 4ABNA 3M4OH 1I50H 7ICSA 1PTOC 1K8AC 1K83H 5D14A 1BOSA 1V1OA 3F2BA 4ZK9B 2EVBA 3IKJA 2F0NA 5K36H 2UVWA 2HDOA 5FLMG 3VA5A 9ICVA 2EJFC 4CJ1B 4RNMA 2EZVA 5ALVA 1K1QA 4NXNQ 4DV2L 4DFKA 2K52A 1JWSD 4KY5A 3UXOA 5GROA 1K9MC 2ZXRA 4B3TQ 2BZFA 4M6WA 1N36Q 4DAMA 3S2DB 1EL0A 1BPBA 2J4XA 2ZJAA 2DJFC 4UAZA 4QNLA 3P20A 2F8KA 1SE3A 1X9MA 2YTYA 1IYUA 1I3QH 3P1HA 1SZHA 3S1RB 2NTSA 3PO2B 2SOBA 3K0YA 2KJ5A 2HT1A 1SL0A 2K89A 3CU7A 2Q0ZX 1G2TA 4XXEA 4Z9CB 2B2TC 1FD7D 3K7UC 4KY6A 4RGOS 5C0XG 3BZCA 2F3VA 4KLOA 4DR6L 2UVUA 1JI7A 3KLSA 3JPRA 3QO2A 3JPPA 4ID6A 4DR6Q 2NVQB 3PF4A 3PR5B 2E76C 4F4YA 4F4KA 4ECQA 2A19A 2QF7A 2PI2A 4EX7A 5L1LA 4G7ZC 4LF5Q 2K01A 1PTOB 4O1NA 5AM3A 3FKIG 3SDZA 1PH3A 1QZGA 4O5CA 4PV1C 1PYBA 3J7ZC 1YNNC 1UUPA 2A69C 1PH5A 3A7LA 2XIWA 3GIKA 5CMDA 5E7NA 1HCZA 3VR3A 4J6HA 5G5HA 4E6IA 4QZDA 4BWJA 3KF6A 1TR5A 7ICGA 1B3QA 1D5ZC 1SMYD 2RSOA 5JRTA 2XTIA 3J81c 3OJSA 1BNPA 5BN5A 5J8YC 1VQLA 4PMBA 4P0PB 4BY7G 4ECTA 1EWIA 3CYMA 1GM5A 4FDBA 5KFBA 2CQAA 1SYGA 3MEHA 3HRZC 4LUZA 4PHPA 2AXTU 4PPXA 1ZD5A 3GTGB 1HZBA 3GTKB 3NVZA 1QH9A 4KLEA 1X9SA 1SWWA 2E1FA 2QEXA 1STEA 4PL2A 4EQNA 4A3LH 3H7IA 3MFYA 4RKLA 2VQFQ 4OIKA 1AN8A 2H4OA 4DF8A 2EY1A 5C4HA 1VQ8A 1Y1WB 1LO5D 1MQ2A 4A3FH 1CZWA 5BR8Q 3LWLA 4HJ8A 1F2MA 3ZDEA 2PQAB 4KK7A 2KHIA 1AEXA 1OXVA 2ASLA 1WCMB 4RNOA 5LL6S 5J8YA 1YI2A 1Q82C 5KFMA 3K6OA 3HOZG 3A74A 2WB1E 4YHHL 1HUZA 1U9RA 3ONAB 4TQRA 1STAA 4O3QA 1I94Q 1VQNA 3S1QH 4ED8A 4DL4A 4UATA 2F4VQ 3PMNA 3NTKA 4DKAC 1Q3LA 3TBIB 2ISPA 4UAWA 1Y88A 2K5QA 2VA3A 3K7AB 4BBRG 2DPJA 3RTVA 4I2BA 5IYBG 1BPYA 2XRQD 2K14A 4ZH4A 2Y0SF 3ETLA 3SI8A 5I2XA 1VF5C 3A7AB 1BDOA 3CP0A 5KT6A 4NJ8A 2UVVA 3M85A 5JJIA 2Q8IB 2YTVA 1CQFA 4X3KA 1MD2D 1UPHA 3CHBD 5C4XB 3UE1A 4C4SA 1RKNA 2LS01 1X3EA 5KFGA 4EYIB 8ICJA 2YU9B 2C9OA 4Y2XA 3PW4A 4RPXA 1VDVA 4HIDA 5KG1A 4DAVA 3RAQA 4P4OA 2PZUA 4KLDA 4Q45A 4F50A 1P7DA 4JB3A 3LWEA 2OHFA 1YZ6A 4IRDA 5LMNQ 3BQTA 1CI3M 3R3OA 1KDHA 5F9NA 2R7FA 4UP9A 1K3RA 2K03A 2K60A 3UXNA 4J8QA 3J80i 5AKKA 3I56A 3GU3A 1EY0A 1NY4A 4ELUA 8ICSA 4DK6C 1O03A 3QG1A 5C4XH 4A3CH 2BDPA 2Z6KC 1JQYD 5ALQA 4RCOA 2JA7H 4HYKA 4GC7A 1G91A 1HFGA 4A3JB 4NXNL 4OWTB 1JOOA 2WB1G 2B2VA 4EX5A 5J2IA 1ZQMA 4B3TL 2C5CA 1N36L 1H9JA 3EROA 3P75A 1JWMD 1NKCA 4J9PA 4C0ZA 2K8CB 3BVGA 3H8JA 4C3IB 4HJ7A 1O78A 4QB4A 4B9NA 1S8OA 2J6SA 2JQOA 4LJXA 3TAQA 9ICAA 4HN7A 2QLTA 2BQUA 1CM9A 1JORA 3H15A 1KKXA 1KHIA 1X56A 1I4QA 1WTQA 3KFUA 4K4IA 4B9WA 3C3LA 1SAPA 3MWYW 4TKOB 5ELFA 2KQ3A 4YG2A 1QCKA 1XWEA 2EXZA 3FPUB 1FJGQ 3PR4A 1N34L 2R7ZH 5M5XH 1FNWA 3E58A 1LT6D 2KBNA 5CEHA 4KHVA 1OTCA 3GIMA 5IINA 1Z1VA 2MO1A 2F4IA 4MIUA 5FK9C 5C0XI 4OWWB 4C3IH 1S9FA 2LKVA 3NK9A 4P4PA 1PVQA 1ZETA 2L11A 2E8OA 4F5OA 5CA7A 1S0OA 3NUCA 4Y2VA 3QZ7A 1CKNA 3MDCA 2HQEA 1WFQA 2B63G 5AFWA 2EAOA 1O80A 2QW7A 5AK3A 4IQWA 1B7YB 2G5IB 2I07B 2L12A 4JBMA 3S2HB 4RUCA 1ZQOA 3T1YQ 3PSTA 3I76A 3PW5A 3PNCA 1U4MA 1KLGD 4YMNA 2Q2UA 2MQHA 4P71A 4IPGA 3K1ZA 4QCLA 2PFPA 2Q2TA 2CQOA 4RT3A 2ES2A 5IP7G 2E1EA 3D4DA 2AQ0A 4B9MA 2YQEA 1E0BA 4QWAA 1VQ5A 4DV6Q 5KG2A 3ZD9A 3QEBZ 4RCNA 8ICVA 2EOTA 3H6MA 2D3DA 1TY0A 2BE5C 1KIXA 3KLRA 1TQOA 2OF1A 4LMQD 4KN7C 5GTIU 3MR2A 1A2TA 2G07A 2A73B 3STBD 5ALKA 2LI6A 3NTIA 5KNIA 5M3FG 1YJNA 2ZIUA 2E2DC 4JI0Q 1XO1A 3MXNA 4A3KB 4KLFA 1G6ZA 1PVRA 2BCVA 3MGVA 3FKIB 1L7NA 2VQFL 1VQPA 2Q8RE 4FO6A 4PHDA 4DXFA 4ALPA 1AFPA 4B9XA 2PQEA 2A68C 3QNMA 1ZD3A 1TS4A 2SDFA 4JBWA 5BR8L 2UXCQ 1PTOD 5DBBA 1OXJA 4ECWA 3M8SA 3HOWH 5KFAA 4F5RA 5C0XH 2W3SA 4O2DA 4DA2A 4GLXA 2HOQA 4R63A 1SRUA 5ALMA 1TS2A 2JV3A 3H8MA 5IILA 1GUTA 1SJHD 2HDMA 2JYOA 4RHRA 1Z4OA 1I94L 3ICXA 4NLGA 4BY7B 3QU5A 3OHBA 2F4VL 1QQ6A 1QQ5A 4E0DA 4K6LA 2EANA 5EGTA 4OJOA 4CNQA 3UXPA 3A0BU 2XC9A 2MU2A 4KN7A 1JE4A 5AI0A 2TSSA 3HKZE 1RPLA 1YEZA 1PVPA 3TP6A 4LFCQ 3S1NH 3SR1A 4M04A 3DM1A 4I2AA 1EYGA 2K4IA 1EQTA 2FJ2A 1KFDA 1IG6A 4DR1Q 4A93H 1N56A 2HVIA 3TQYA 1JRPA 1BBXC 1D9DA 2HOIA 1B43A 3BDPA 1MSWD 1SFOB 5J1ZA 3PIO3 2Z8LA 3CNHA 4NLNA 4YR0A 3PIP3 3GTMB 1GO3E 2E2HB 2ZUBA 5TZVA 1YNXA 1F9QA 1NK5A 1VMPA 2FMPA 2LSSA 3AMZA 4XQQA 4B08A 3MBYA 4B9TA 1CSPA 1DK3A 1KLNA 3IL8A 2KEDA 2IPKD 2JRZA 4IPHA 2NRXA 1UE7A 3IHQB 3A56A 4EEKA 3V7KA 1GJXA 7ICQA 1JCKB 3HOZB 3F5AA 4P73A 2HUGA 3HP6A 5G3LD 1T7PA 5DGBA 2ZIVA 2A69D 2JZBB 4ZUJA 5IIFA 4IQTA 3TAPA 2NVYB 4G57A 3GD7A 3L4PA 1NJWA 2D62A 1PZJD 3C1FA 1EOVA 4IUPA 3GTMH 5KT5A 3D0FA 4K5WA 2ZIVB 4NL9C 4PZOA 2WB1C 1I4HA 2Z4HA 4BBRB 5IP9G 8ICMA 3VYRA 1U4RA 4JI3Q 3C23A 3Q8RB 2A1AA 4PGYA 3AMUA 3H4BA 1UE5A 1C0AA 1Z6HA 1ZQPA 1QB5D 4OJ5A 2FPKA 5IGGA 3K5LA 4DL5A 2EH9A 4XQJA 5FJ8G 4GZYC 4BGDA 1ENAA 4GKJL 5HHHA 4F3OA 1LTBD 2PMZE 5T1GA 2UVRA 3ZDAA 7ICVA 4DR3Q 3PO3H 2NB0A 2BPFA 3NXWA 2G08A 3KF8A 5EE0A 5DM73 4NDXA 1CFMA 4YVZA 4DQQA 3J80L 3ERQA 5CRXA 4ZAIA 3ZI4A 5KFFA 4I2CA 4GC6A 1DK2A 1E7ZA 1DOLA 1SYEA 1WD0A 1X6IA 3OHXC 5IY0A 1ED1A 4X3UA 2H3ZA 2PKEA 8ICWA 5I4DA 1UEAB 4DV3Q 3EZ5A 4HJ5A 1ZQXA 5DQIA 3T3FA 3BZKA 2WB1B 3S14H 4YWLA 3T1YL 2IBKA 2HCCA 2B2WA 4Y2RA 1GHJA 3GV7B 1YVCA 4YD2A 3R2IA 4IALA 3PO4A 3ZDBA 1HNZQ 1LTAD 7ICIA 1XTDA 5J0TA 4M9NA 2R92H 2W55A 2OT2A 4QZ9A 1F44A 1SYFA 4K2LA 1CTMA 5K5PA 1EYAA 4DV6L 1PFMA 5FO8B 3F1ZA 4BUGA 3DWQA 4QIWE 4Z6DA 4FP5D 3Q23A 2CW0C 1E3PA 5HGTA 3QJYA 3IAYA 5J0YA 3NRZA 3SVMA 2P6UA 4PZNA 3V6JA 1XSLA 1NK6A 1BPZA 1CEZA 1PH2A 4OJ6A 3NE5B 1SIJA 7ICRA 4JI0L 3Q0AA 1O7LA 2KN7A 3K4GA 3RJEA 1B3AA 1B53A 1ZXTA 3S17H 4BX9C 4XT3B 3D31A 2B63B 2A6HC 4KKSA 2R3ZA 2DBYA 5AJ3Q 2NYZD 2UXCL 4Q8EA 5KFTA 1IBKQ 4RPZA 5J0QA 4MHVA 4XQ8A 5AKHA 1SEBD 2DFLA 1T9HA 3I91A 4A4IA 3OWEB 1BNOA 2EDUA 1WOCA 4QQBX 1UT8A 3N7RC 4UB4A 1LT3D 1GUSA 3VDYA 8ICHA 3Q8QB 4AYBE 4U7CA 2HIXA 1I5FA 4V190 5IWAL 4ULLA 4B9UA 4OEMB 1KQSA 4DR4Q 4DV4Q 1PMRA 1K5OA 4CDGA 4IJHA 2WHEA 4LFCL 1WVLA 3J80c 1LB2B 1HPCA 2PW7A 4DQRA 3H3VI 2O4XA 5M3FB 4DR1L 3ULJA 2KJXA 5M5WB 4I2JA 1NSNS 5KFOA 3G6JB 3ED5A 2M2LA 2M9VA 2ZXOA 5E1FA 1D8BA 1WG8A 1E22A 2JA5H 1QJOA 4R4OA 5FO9B 5DAUA 2F76X 4TUSA 2LMRA 4A76A 4A3IH 3EIVA 1YITA 1TU2B 1Y1VG 2E75C 3ETRA 1RCVD 2F0IA 4BWMA 5IGBA 3M7NA 4LF9Q 1QSYA 2A1JB 4BBSG 2V9WA 2AQ4A 4A75A 1EYDA 2ZT9C 4FYDA 4YD1A 3EVQA 5J0PA 4FZLA 1NTGA 4TQUS 2LY7A 4KV6A 4DNTB 2MRLA 5KT4A 4QWCA 3T5JA 4QWDA 3VR5A 4DUZQ 2HCFA 2PFOA 2ZUCA 4DL6A 3K1RB 1W3SA 2PI2E 2H3VA 4FVMA 3SE0A 3AYHB 4JUZA 1Q12A 3FP9A 2DGZA 1Z00B 1TWGH 2ATLA 1NNLA 1YBYA 3CRLC 3K80C 4PHAA 2X6LA 4JI3L 2ZJQA 2NN6G 1ZRNA 3A8JE 3PW0A 5J0WA 5CV8A 5EWFA 1X3GA 2KJ9A 1E2ZA 1PDQA 1DM0B 4AYBG 3QXGA 2KKVA 2BE5D 5GAEC 3CC2A 3S1MB 2DKZA 3WDNA 5KFCA 1SL2A 5A2QL 3HRDD 1IL2A 4BXXH 2JK8A 3EPIA 2F3NA 1ML0D 3PQIA 4KJNA 4CDCC 1IL8A 2BDUA 5EWGA 2V1CC 5HY6A 2AJQA 3VCBA 1IHZA 4J9KA 3GFKB 3H3VH 1VQ6A 3K5MA 1IM4A 5J2KA 2VNUD 3Q6SA 3G6VA 4LJZC 3JPQA 8ICNA 2A68D 2F0PA 3FHWA 5EPJA 1HFNA 1DOQA 3QYPA 5J0RA 4X5VA 4BXOB 3C28A 1IW7C 3EW9A 3ORYA 9ICGA 2OEOA 5LMUL 4DV7Q 2IY5B 2C2DA 1EFID 3EUB2 4DV3L 3SQIA 7ICPA 3HOWB 1TAUA 2V4DA 5AK6A 3I90A 4FF2A 3J80E 2ZG6A 1RZTA 3OTQA 3WKDA 1J8IA 1Q46A 1LUZA 3TRZA 1SNMA 2IJ0A 3PV8A 4KTQA 4DQPA 4TQSA 4WJ3M 5A35A 3PZPA 4KY7A 2A3VA 2W04A 4ILWA 1HNZL 2LXJA 2K33A 3CCVA 9ICJA 5CV5A 2NZHA 3DMUA 3IFTA 2JA8G 5ALSA 1H9SB 3CQZH 2FMMA 4QW9A 2JEAI 4HIMA 4KI0A 4AH6A 3K5NA 4B9VA 2PNHA 4KMUC 2PMZC 4BY1G 4NKLA 1K3BC 5L1KA 5IGDA 2ZJ5A 3UDXA 2F0OA 4UBBA 4F4XA 2N3SA 3OW7A 2QKQA 3C2PA 2KEYA 2B29A 2K5DA 4KJOA 2ESEA 1Q3VA 2R18A 1Z9FA 3M9NB 2PO4A 3M7DA 2B0CA 5CB1A 4KX3A 4FF3A 3UQ2A 4C1NI 4DOCA 1ENFA 2J6TA 4GOPA 1VQ9A 4C3JH 5CV7A 2B21A 5M9OA 1UT5A 2EZZA 5AJ3L 1D7QA 2IL8A 1VQGA 1ASZA 1ZD2P 4G4KA 4A8EA 1D1IA 3U58A 1IBKL 3H0GG 2M0NA 3WK8A 2Y9UA 4YY3L 5C3EG 1DXSA 4JYAQ 4AP9A 4ED2A 2O6KA 1ZQEA 4F87A 3C1ZA 1ET9A 2DUYA 3E9HA 4H44C 3RF9A 3T51B 3AQFA 5EE3A 3H0RB 4KMUA 1S5FD 4IR1A 4DV4L 2WF5A 4EGVA 3F53A 2JEFA 3MXUA 1QLNA 2JJQA 9ICOA 1FEZA 2PMZB 4DSJA 2AQ2B 4ZYSA 1RHPA 1BCPC 4A3BG 4J9SA 2QB1A 5KFWA 3QEAZ 3RJIA 1TAQA 2W54A 2WV6D 1A77A 3MTSA 2LMCB 2F77X 3SK4A 1S5DD 3OWFA 4UHVA 3NTUA 2E8MA 2K4EA 4C8OA 1QVCA 1XMOQ 2P66A 1R9TB 1Z4NA 2XIDA 3EPGA 4RWSC 1GOZA 3L0OA 2NWGA 5JJKA 2ATWA 1VQOA 1KEJA 4LF9L 5KFDA 2YV5A 4C2MH 5ALHA 4Y7NH 3PSIA 2K50A 4L63B 4FZMA 1OW5A 3DDHA 3U4ZA 1KTQA 2R93G 1LVHA 4A3DG 2F8LA 3BVMA 9ICKA 4QZEA 3UQ0A 4MF8A 4DUZL 3AU2A 5DQGA 8ICYA 1S97A 1HTLD 4PNYA 4RQ6A 4DOBA 1NE3A 2K04A 3A5ZB 3BDLA 2IOFA 5ELCA 4JV0A 4CHTB 1BF4A 1R9TH 4AIMA 5CBEE 3J7YW 3R2TA 2D2CC 4F5PA 4RHSA 3OGUA 1PZNA 1LKYA 4N9TA 4Y2QA 4AYBC 2F0TA 1NCVA 2IWHA 1BO0A 1L7PA 4QF4A 1EY9A 1X9WA 3BYYB 4PMWA 4DOAA 3HOYH 3QOLA 4JI1Q 2LYBA 1BCPB 5IYDH 1L3UA 1E1OA 4ME3A 2UXDL 9ICLA 1HZ9A 4DUYL 4JBKA 4PQXA 2VA2A 1KDBA 5F2DA 1WTHA 1Y1VB 3I1YA 4IUVA 1FFVA 3ISCA 1F2YA 4BBSB 3GTLB 1ZQKA 1U4PA 3PIOA 3HOVG 4HSPA 2A6HD 4CKEA 5D65A 1EY6A 1ZQNA 4QL5A 4CF4A 3N6RA 1ZQFA 1VQKA 5A2QE 3KYHC 4L5TA 2EAMA 1VQBA 4I7AA 4DV7L 5KTQA 4HIKA 2C28A 2EPBA 1ZQQA 1EY7A 1Y14B 4TVAB 1UCVA 2DWQA 1C9OA 3KHHA 4KTAA 4DV5L 1TK0A 5KFLA 4RQMA 2ZIXA 4LVSA 2AGOA 4QUFA 3GTLH 2AGQA 1PH6A 2K4PA 3HPOA 2WACA 4HTHA 4AYBB 2Y0SE 2PNRC 4GNXA 1TE2A 1KAWA 4UAIA 2ZIXB 3KKAC 1J9OA 1ILPA 2XCPA 3MHBA 3V7LA 7ICTA 3Q24A 1ZQZA 1A6XA 5KG0A 4B3RL 3HOXG 4GNXB 4M6WB 1L0XB 4US8A 4JI8Q 5IOCA 4GLAC 2XGPA 2F1JA 5ALXA 3AUOA 3Q8PB 2NBFA 3GQBA 1IXRA 1N61A 1DOKA 5AKGA 2WF9A 4AQYQ 2F2AB 4OIJA 3VYUA 4POFA 1N34Q 4O3PA 2O5JC 3ALRA 3IDWA 4Q0FA 3W1BA 1NMFA 2PI5A 1NR4A 3S2DH 4HJAA 2W7PA 4R4CA 2BQRA 1WCNA 4ACOA 4KLHA 2B8FA 4L5QA 1ZEQX 4A3KG 3NELA 3S1RH 4OJPA 3PW7A 1RQNA 3PO2H 4KLTA 2UXDQ 2KHJA 2F0SA 4US9A 3I4NB 3KKAA 1J5EQ 2D5DA 1V97A 3V96A 2ZJRA 4JYAL 3GP7A 3WOFA 1ZQ1C 2NRZA 5DM63 2KEEA 1TAMA 2JA8B 1WWUA 3CCLA 2HBKA 3K75D 3L7ZC 4FO2A 1PV4A 1RQLA 2NVQH 2KCCA 1FFUA 4Y2JA 5AKYA 1PYSB 3G71A 3B0YA 3S6JA 3KF6B 4X3SA 1YHQA 2KK0A 3M9MB 1N9WA 4BY1B 1WWVA 2Y0SG 2ZXHA 3SYZA 1S0NA 4RZRA 1F2LA 3D4RA 4KN4C 4RA8A 2G5DA 2UUAQ 5AI8A 1JXEA 4C8LA 1PTOH 2EYHA 2XICA 5KFRA 1STNA 9ICNA 1XWLA 3QU7A 1ZJNA 2L5TA 5EAYA 1ZYRC 2R8JA 2Q2HA 5ALNA 4WORA 2F0LA 3CC7A 1WD1A 4I2HA 4C56C 4GFJA 2LXKA 4ELTA 3M6KA 3I4OA 3QR8A 4MFAA 1WUDA 3A0HU 1PZKD 1XMOL 3BG3A 1QSLA 2JXMB 3AU7A 5J22A 1ZXIA 5J0OA 4B3SQ 1RJTA 1ZKOA 2ASDA 1IW7D 2VIXA 2B8GA 5AM2A 2YMQA 1UA0A 3H0GB 3OMCA 1B4FA 5FKAC 2Q8TA 4UY8C 5C3EB 4Q43A 1PRTC 4ZUIA 3ER0A 4K6DA 3PW2A 1BR9A 1AH9A 4NM2A 3KBXA 4LF7Q 2PFQA 2V4RA 1HA5A 2K05A 1A76A 1HA6A 2KCMA 3SK6A 3GTGH 4JI2Q 4C3HG 3T13A 3T79A 4KLGA 3ULLA 4IUNA 3CPFA 3GTKH 4KLQA 5M5YB 4KN4A 7ICKA 1YHBA 5KL8B 2Y9TA 2F3WA 2LFNA 4K4HA 3I2ZA 3PUZA 4XQNA 2JN4A 1TWAB 1UHUA 2G09A 2I46A 2JA6G 2UU9Q 4A3BB 2EY5A 4HAIA 3KK7A 1Y1WH 2NO5A 1BBWA 2CWPA 4XT1B 5ISRA 4JI1L 2XI9A 2ZTCA 3P7JA 4POGA 4HIOA 4UB8U 4IFDJ 1JC7A 1CA5A 1RYSA 9ICBA 1WCMH 1VQ4A 2B2VC 4MF2A 1V1PA 3HT3A 4R66A 3A0JA 1U0LA 2RDJA 4A3EG 4F71A 2VY3A 3C2MA 2OYYA 1KRPA 2F0UA 4P72A 4JV2A 1HUNA 4ME5A 5JEAJ 2R93B 1SE2A 1S5BD 3JPNA 1IYVA 3ND9A 2OQKA 3K7AH 4A3DB 1PRTB 2K5VA 3TACB 3E3XA 2GO7A 1S10A 4Z6FA 1AE3A 8ICOA 1LT5D 1OXTA 1Q1EA 4QMGA 1NKBA 3T56B 3J81E 3RZDB 3RRGA 2DJGC 4DF7A 1ESFA 3I73A 4C1NK 4BS9A 1S76D 2Z4IA 3VYTA 4R1JA 1GUWA 3WWVA 1Y8NB 1RG6A 2RHSB 3GTQB 2KCTA 4L6TB 5IIKA 3ZD8A 4MN3A 2FXQA 3PMLA 4DV1Q 2YU9H 9ICSA 2KFZA 2AH5A 4I2DA 2MAXA 4A3DH 5CV9A 2IMWP 1SXTA 2BA0A 1CSQA 2JSOA 4BA1I 5IYCH 3PF5A 3OSOA 2AU0A 1EWHA 4O5KA 2M00A 4OWXB 1KABA 5DDMA 2HHVA 1L7MA 5HR7A 1K8MA 4GKJQ 2J6UA 1KDCA 4Y52H 2VKQA 2WINB 4JI8L 5I9OA 5ALEA 3PY8A 3HOVB 1MKHA 4EENA 3M6ZA 1JXLA 1NJZA 2K6AA 3O13A 5EWEA 2RF4A 4AQYL 2EZXA 1N33L 4P75A 4CGZA 1SYCA 5AI4A 4XYQA 3GIIA 5HURA 4RQ3A 4YWMA 5KFXA 1I4GA 3EYZA 1ENCA 3N97B 3BQ1A 1JB3A 3LX0A 3A8KE 3RR5A 2E2IB 3NRWA 4NXZA 2VXWA 5AIBA 3B0XA 5I6YA 3MC0B 1JWUD 4OO1J 1C4QA 2I1QA 3MXGA 1ICFB 2GA4B 1J5EL 4Q44A 5IE8A 2EE1A 4UARA 2RHFA 5ALIA 7ICFA 4RQ8A 5K4LA 3M9BA 4ECRA 1CKNB 3H0MB 5GTHU 3KJPA 1KL9A 2FLPA 1ZQHA 3HOXB 3GTOH 5AM5A 1JUDA 2Y0SC 5KGUA 1BVSA 3FM9A 3SAGA 3QB3A 3G4SA 2D0PA 4DR2Q 4MFFA 1AZPA 3ISDA 2VJ4A 1GVPA 2RCFA 5LL6X 5FLMH 2UUAL 2JEIA 4C8MA 5B5EU 4J9MA 1NNXA 3GTOB 1TWFB 4A3GG 1M8AA 1HIWA 4IQUA 1L5UA 2WF8A 5BOLA 4UB6U 1CHPD 3NVYA 2K5NA 4ED0A 4CKCA 1D8LA 2E2JB 2F3IA 3CAMA 2LM4A 4XYOA 3S2HH 3NBHA 4IFDG 5DB7A 3WK9A 2V4QA 3T5LA 1VS0A 4DK1A 1S5CD 2DNCA 1NK4A 1KW4A 1H38A 4ZKBB 4EQOA 2EJMA 3NP8A 2ASJA 1KTKA 3C5GA 3HOXH 4EZ9A 4M47A 3RJHA 3G6YA 4B3SL 3HFZB 1AP0A 2KZZA 1B50A 2MPMA 5JEAG 5JJLA 4C8NA 2ZIUB 4O5EA 2IOHA 3ZJYC 3MXNB 3X3NA 3RN5A 1LTLA 5F9LA 2W43A 1JOKA 4ECUA 2ZM6L 4LF7L 1ZRMA 3CCJA 1TXYA 1EXNA 5C5MA 5M3MG 3MZ5A 1ECWA 1LTID 4JI2L 4UQGA 3MVVA 1W6KA 3BDOA 1RIPA 3K59A 2Y0SB 1B4OA 3RLOA 4A3KH 2YTXA 2IW3A 2JR5A 5IWAQ 3M7GA 2O5IC 3FKIH 1LTTD 2OTJA 2UU9L 4F8MA 1Q90A 3PO5A 1SNPA 1M90C 1NK8A 4YCVA 1I6HB 1SMXA 9ICPA 1B22A 5C44G 2H3FA 2KD1A 3HX0A 3TREA 2AQ3B 1L0YB 5EQ0A 3WK7A 2WIIB 1WTVA 1JT8A 5NUCA 1CA6A 1MC8A 1DJRD 2RVLA 4MTKA 2CWAA 3NS1A 2ALYB 5KFQA 4BY7H 4TUPA 1PXUA 4O3RA 4X64L 5JU5A 3CW2C 2BPGA 1HZAA 2YX8A 5KAIU 1ZQCA 3TFSA 4WFN3 3CCMA 1KLUD 3B6YA 2JGAA 1D6EC 4G7HC 1I6HH 3F2CA 1HXYD 3N7SC 4NP5A 1X9NA 4C3HB 5E4XA 3VR2A 1YNND 5J2FA 2LPEA 1G2SA 1SV4A 3KTQA 3NQIA 2VZAA 2NRTA 1T3QA 2NYVA 3OYYA 3PV0A 2WF6A 1SFOH 3TN2A 3M9OB 4X66Q 1X54A 2E2HH 4JI4Q 1STGA 1EOTA 4OO1G 3BJUA 2JA6B 2RDIA 4LUVA 1KFTA 1CKMA 4DV1L 2L1BA 3K5OA 5D3DA 4UASA 1S5ED 2C2RA 1J2MA 3CC4A 2K1BA 4ED7A 2ZJ8A 3C21A 5J2JA 1ZQWA 1OXXK 2MUYA 3AFQA 2KZ3A 1U5KA 5J29A 3OTOQ 3HOUB 4ICAA 3HOZH 8ICTA 2KV2A 2B2WC 1ZYRD 9ICEA 4A3EB 4UBCA 3R93A 5KG3A 2UUCQ 2NVYH 4JI7Q 4O3NA 3RB0A 1L2FA 4LUOA 3UI2A 2MO0A 5KFHA 3VR6A 5L37A 1SL1A 3AEVA 2A6EC 3OW2A 5DB8A 2VUMG 1JMSA 1PFNA 2AKWB 4BBRH 2NVXB 5IYBH 4ECXA 4DV0Q 1HNXQ 1GUOA 1JX4A 3KF8B 4RU9A 5DB6A 4RQ0A 2XY6A 7ICLA 2CH4W 1PRTD 2GLEA 3WK4A 2FI1A 1LV9A 3OOCA 1IKMA 1HR0W 1U4LA 1MA7A 5LMUQ 4J9NA 4IJLA 3V05A 1Q8KA 1N5WA 2VB3X 5HGQA 3MAQA 2CHBD 2F0KA 4DR7Q 3I7FA 1QSSA 1RD9D 2E3TA 2MA1A 2F0EA 2C2EA 2NVXH 4LZDA 4YCXA 4JV1A 1L6NA 2KOLA 5KNCA 3CF5A 1BQQT 2NTTA 4R8IA 3KJOA 3MA2B 2W9CA 1XPRA 3DEEA 1ZQLA 1B70B 5DG9A 5C4JB 1W2BA 4DR2L 2W8KA 3TP5A 5AI6A 1T3NA 1A3VA 2MHVA 3E0EA 1SYBA 4J9QA 2W9CB 1L3TA 2IT1A 1VQMA 3FC4A 2CPRA 2BCOA 1Y8OB 2W9MA 2EYMA 4M2YA 2R8KA 3ERSX 1L3SA 3RJJA 1TY2A 4MTNA 4RPYA 2EIFA 4QZBA 2XO7A 2J7ZA 2F0MA 4FFDA 4IFDI 5AKXA 1K8OA 2F0DA 4KLUA 3LWMA 2QARA 4CCHA 2EZYA 4K4GA 2AQ1B 2RRDA 3CD6A 1FL0A 4FS2A 4HR7B 4KITB 8ICQA 1MGSA 3HKSA 3KDFA 1YZ7A 1H9KA 3A8IE 2HMXA 5ELEA 2QARB 3RR8A 2K4KA 2XY7A 4QJFA 1FVIA 3V72A 9ICQA 1RM6C 1STYA 4ECYA 2G9DA 3RH6A 2N78A 2RKSA 3KDFB 1LLRD 3NQTA 3HKZF 2BCUA 4YY3Q 1EFWA 3I72A 4N9PA 3RFAA 3K58A 3UDIA 3M1YA 4F5NA 4L8JA 1J97A 4KMOB 1N2XA 8ICZA 1X3QA 4Z6CA 1TK8A 1XNQQ 3QUQA 3Q8MA 4M0AA 2A74C 3GV6A 4A3GB 3S9WA 4GIBA 4EBCA 3TADA 1Q1BA 4U6PA 1GO3F 4KD4A 4YN4A 2B63H 2WFWA 2KHQA 4DQSA 3BVZA 4X65Q 1JJ2A 1I4PA 2WFAA 3H8WA 4RQ2A 1A62A 4NM1A 3OSNA 5J2BA 3AFPA 4JI6L 1XPUA 1VJ5A 2RLTA 4UP7A 1V85A 3GDXA 4MEXA 4IUQA 1G6PA 2KIWA 3B9JA 1MQ3A 3PUVA 2E8GA 2D9UA 5IP7H 4A3JG 2B2UA 2E8PA 1FGBD 1RL2A 1YHAA 1EQQA 1KRTA 4G7OC 4M9JA 1BXTA 4M8AA 2AMCB 1VQEA 5AHXA 3EWAA 4QUCA 2KHVA 1WYDA 5I9PA 1TIID 3CCQA 5M3MB 3TMEA 1D9FA 5H2FU 3W2DA 1WTRA 5M3FH 5DG7A 1KXLA 5HNKA 5L1IA 5M5WH 3T1HL 3HS0C 4JI4L 3RNUA 1C48A 3QU2A 1KRSA 2HSZA 4Y2UA 4UP8A 2H5XA 2KSOA 4X66L 1L0WA 3DLLA 1XMQQ 1RYUA 2UUBQ 1QNUA 2QEJC 4OO1I 4ZOHC 2DY8A 2OQ0A 1JE5A 5DNFA 5D49A 4DK0A 5KEEA 5C44B 2XGTA 1Y69U 3L2PA 4XRHA 5K36G 4RQ4A 1AROP 3D6WA 4CJ2C 3OTOL 5AIAA 3IP4B 1RODA 2AWOA 3HGBA 4RQ7A 2WAQF 3GV3A 2AUJD 1JN3A 3MGIA 4U673 2BDOA 1VCIA 4A3MG 1ZJMA 3ZDDA 2BOSA 2UUCL 4JI7L 3T5HA 4DUYQ 2Z1CA 3SENA 1TS5A 4JWMA 1K1SA 8ICFA 3JAMi 2HHSA 4NW2A 3RJFA 1UAPA 4ODGA 4RAUC 1JICA 2QGQA 5KG6A 4ECZA 2FE9A 1ZQSA 4DV0L 4KKUA 4FE3A 1HNXL 1XNRQ 1X65A 4I29A 4ZKCB 1EIYB 4O3OA 1Z1BA 4KLKA 1OXSC 2I5HA 2BHNA 4NB3A 4ED6A 4DNRB 2KCNA 3NEMA 8ICBA 5KFPA 3AQEA 4IL6U 2D6FC 3WKCA 2HIVA 3SEIA 3S1MH 3M8RA 1X55A 2VANA 1NZBA 1A0PA 5CWRA 1UNSA 3EN2A 2N55A 2JEGA 4DV5Q 5E4WC 1HH2P 1K28A 1VQDA 2L9HA 4IZ8A 4DFAA 4DU9A 4QGUA 4LF6Q 4GOPC 4RMFA 5EPKA 4QIWF 3M3YB 3TKAA 1PA6A 3I4NG 4JWNA 7ICHA 2PZWA 4H13C 4YXMA 4X62L 2XVSA 3RBEA 1SR3A 5AKJA 1NK0A 2JH1A 5F3XB 1SROA 2QDLA 1NJIC 2BA1A 4R64A 4XDXA 4OO1H 4IS7A 2VA8A 2W9BA 3LNNA 4B3RQ 3BZDB 2VUMB 2M9NA 5IP9H 2L0CA 5AI5A 3S15B 1B2TA 2B3GA 1LT4D 1IZ6A 4JC0A 3DEPA 3NGDA 1UE6A 1DGJA 2WF7A 3OHAA 8ICIA 9ICCA 2Y1IA 2OXOA 5EPLA 3KHGA 4Y2TA 5EKLA 8ICUA 5FJ8H 1U48A 3TP7A 1S0MA 1UWVA 2FLNA 4YIJA 4DSFA 4KLMA 4Q8FA 1GUGA 1N62A 3RZOB 3UM9A 2F44A 3NHHA 4LFAQ 2BCQA 4DR5Q 2VUMH 5BOMA 4AYBF 4J15A 3S15H 1QNKA 2SEBD 4YFKA 4A3LG 2K8AA 3PX6A 3FRPB 3RB4A 4GOPB 1CZGA 2W3RA 2QB0A 2IA6A 3R8BA 4A3FG 1IBLQ 5C4ZA 4GN4B 4DLGA 4RUAA 3GDEA 1AE2A 3MR3A 1X3PA 4O3SA 2HQLA 2FFKB 2DL0A 1XNQL 4KD3A 3J7A5 2K75A 1TS3A 1ZQTA 4YXJA 2F1IA 7ICNA 2ZIWA 2EYFA 3EFXD 3RZOH 3CCEA 1U45A 2Z7JA 3RJKA 9ICFA 3PMFA 4EELA 4IUTA 3OPOA 2AHOB 2EQSA 1EU3A 4X65L 3S16B 4LFBQ 3GTJB 1BUVT 1HUMA 3MFHA 1DOMA 5J0UA 4CGYB 2MSNA 3MXPA 5T14A 2YMLA 3PSPA 2ZXIA 4YR2A 2SNSA 2FMCA 4K5XA 2I6XA 4C4RA 4DPGA 2P6RA 5DGAA 4QZGA 4KLIA 2JEBI 9ICRA 1QOHA 3MFGA 4PGXA 1PTOF 1KAAA 2L5YA 3TFRA 2UXBQ 4CDEC 4DFJA 4BA2I 3NUQA 2OWOA 1JJCB 4Y2SA 2QDBA 3G7LA 1XYIA 3MC1A 5ALYA 4JI5L 3I4MG 4FBTA 2QKIC 1X2IA 1SSOA 2J0TD 5CR3A 3DWAA 4CDFC 3RD4A 3RH4A 3FEWX 2AUKA 3TP8A 2R61A 1A8VA 1B44D 5KG4A 1SKSA 5EBCA 4XA5A 4O0AA 4P0QA 1WTOA 1N32L 3KHLA 1OXUA 3QU9A 1SKRA 3I4LA 4J03A 5BN3A 1F5SA 2K8BB 3X3MA 4QY7A 1XMQL 2UUBL 1DD2A 3IN5A 3UMCA 2A8VA 5DBCA 1TWHB 4P0QB 1X6JA 3UPQA 4ZRZA 2HHHL 4RQNA 4C8KA 4F93B 2VB2X 4KHZA 4RGMA 3SV4A 4A3CG 1LYLA 2VQEL 3E6ZX 4EYHB 2NN6I 3GO5A 2W9AA 2CFMA 2OCEA 2JA7G 2LYHA 2CW0D 4I2IA 2HD3A 2W7OA 1LKYB 3JPOA 2FINB 1L8LA 1KNAA 2MFIA 4R8UA 3SEBA 1HZCA 4GNXC 5KT7A 2HVHA 3E2EA 3QX7A 2IHFA 1A63A 1BNZA 4HMIA 4N8X1 1JJGA 1STBA 1SN8A 4DS5A 4PH5A 2CKZB 3H40A 5DLQE 5G3LF 5AK4A 4R8UB 5I6WA 3BS1A 2L4NA 1XNRL 2ICIA 1E2VA 1DXMA 4GLVB 2H3IA 8ICGA 2ZUDA 1Q81C 2MUTA 3F2UA 3L5KA 1Q3UA 4DAPA 1I6VC 2KZMA 2EYOA 1SWVA 3C46A 2JHDA 5AI9A 3PUXA 2HBJA 1ZQGA 1MSGA 2GVBA 1N8RC 3BQ0A 1R4PB 3IRBA 4M1UB 4A3JH 2K7VA 3KLWA 4I2EA 2NVTB 2LKYA 1M6YA 4GN3B 2RSNA 5KIXA 2KG5A 5KAFU 2F03A 1Y1VH 4PZ8A 1IV8A 7ICJA 3M4OB 1UA1A 1K83B 4LF6L 2G0AA 4UB5A 1TVAA 3PCOB 4BBSH 4UAVA 5EJWA 1V9PA 1QWYA 4GS3A 4FXDA 2XRSD 3JAML 2YB1A 4OX9Q 1SGGA 4QW8A 1EEFD 1NR2A 2XSCA 3I8ZA 4NPSA 5I2YA 1D5XC 1SV0C 3FVQA 4A3MB 3MGHA 1AQ6A 2HHUA 5CBAE 1U4BA 3FYHA 3HILA 3OIQA 1JIHA 4GXJA 1X3FA 1SE4A 2F1HA 2Q4TA 1CI4A 4OJLA 2HOFA 2E74C 1SZPA 1EQRA 1B1ZA 3FDTA 1UQVA 1I3QB 5DBAA 5J2HA 4IRKA 1PRTF 5ALTA 8ICXA 3D8GA 4M9GA 2JH7A 4RH6A 2NN6H 1TKDA 2IHEA 1M1KC 1NJXA 5J2EA 3K57A 1RTNA 1N33Q 4FXKC 2IHMA 3CP8A 5C5JA 4A3MH 4F8RA 1ZQRA 5DDYA 5EE9A 3AM9A 1NK7A 2DKXA 2EAPA 8ICRA 3HJEA 1ICWA 2ID0A 3M4QA 4R9WA 4X6AH 5LHY1 3MABA 1C7YA 4LFAL 4DR5L 1DONA 4RGTA 1SB3C 2JMGA 4DSLA 2CXYA 2YN4A 3SGIA 2F0WA 1SV0A 3PVXA 9ICWA 1HNWQ 3I28A 1IBLL 3MFIA 1TK5A 3RBDA 1EWCA 3HOWG 4BJQA 5KRUA 1Q7YC 1YIJA 1WCLA 2AWNA 3H0LB 4EBDA 2R6GA 3TS2A 1HHVA 1DGSA 4QWBA 3WK6A 4XUSA 4EEYA 1MIUA 3SXHA 3M4PA 4KX5A 3OIPA 3PX0A 4PZ7A 1CKOA 4LFBL 2HBLA 1VLBA 3KFUF 5AICA 4LK1C 2E5SA 4DS4A 5COYA 3I4NH 3L3FX 3C1EA 1WTPA 4KLJA 1AZQA 4IOCA 2HCIA 1VQIA 2YMPA 1COOA 4UB1A 1QZHA 5DLGA 2DGYA 5DG8A 2JA8H 4P0PA 2XNAC 4GKKQ 3VYSA 3O0FA 3N4MB 4A93G 2UXBL 2N1RA 1BKBA 2KA7A 3D6CA 4L5SA 1HQMC 4DO9A 1NK9A 2K5HA 3UE0A 1X9XA 2K4HA 1E2WA 2Q2IA 2QCPX 4DN4M 4BY1H 4YP3A 4I7ZC 4H02A 4JG2A 4NMZA 2RQ5A 5KNBA 2R8GA 4A3FB 3Q22A 3JAMc 4NV0A 3SZ2A 2B2TA 2ZM6Q 4DR7L 2C22A 1VDZA 4USAA 4C4TA 2ICEC 1PYWD 1NJYA 5C3XA 1XJVA 3A55A 1BPXA 1NZPA 5J2CA 4C7ZA 2FLLA 1EZ8A 1NMGA 4TRDA 5L9XA 3S1QB 4KHPL 3UDGA 4RGNA 3NSWA 1FNUA 2PQAA 5BPCA 4JCVE 4CDDC 4DFDA 1LV5A 3H0GH 4HSVA 2PPBC 3WU2U 5C3EH 4B9SA 7ICMA 2WP8J 1WTWA 1EIHA 4O9MA 1FNVA 3D4WA 1NOMA 2QILA 5IGEA 3C2LA 3HOUG 4OD0A 4I27A 3NASA 1LTRD 4PJ0U 4DGZA 3Q8KA 5M5YH 1BPDA 4V0BA 3GV5B 3I4MB 1V1PB 1TWAH 3PO3G 4X64Q 2Z9HA 2F0JA 3PUYA 4HEDA 4A3BH 4QZ8A 4KKTA 2IHNA 2DF4B 2QA4A 2EQYA 4UB2A 4NWIA 5D4BA 1H9MA 3PGZA 2F0QA 4K8IA 4EVOA 3ULPA 2KOBA 1JOQA 2W8LA 1NUCA 5KFUA 4HAEA 4LAAA 3BU2A 1PVOA 1T94A 2FPMA 3N7PD 4OCZA 1YT3A 1SKWA 4L5RC 2I0QA 1RYRA 1DZ1A 2PW5A 3AQQA 4DK3C 3I4MH 1PK1A 1ZQJA 2JA7B 2E5LQ 4F88A 2PI4A 1EIFA 2R93H 4OX9L 3SK8A 4DLEA 1DYQA 5C6AA 1XSNA 1N48A 2BCSA 5KYIA 2ALZA 2HBMA 3ZDCA 1PK1B 2JXJA 1FIQA 2LBOA 4GXKA 2XWBB 3WK5A 1BCPD 1EEID 4BWGB 3E0JA 5KFSA 4R65A 1QUQA 3CKIB 3RZDH 1KDAA 1GUNA 1S5LU 5ALOA 4P2CB
chains in the Genus database with same CATH topology
1BBUA 1VQ7A 2VNUD 2RCNA 4HJ9A 2AKWB 4BBRH 5IYBH 4DV0Q 2R92G 1HNXQ 3FHWA 4B3MQ 1QUQB 2NVTH 1IBMQ 3GTQH 3KF8B 1FGUA 2ZTDA 2CCZA 3M4OH 1I50H 1JB7A 5LMUL 4DV7Q 1K83H 1K8AC 2IY5B 3F2BA 4DV3L 5FLMG 4R4QA 1O7IA 1HR0W 5LMUQ 4IJLA 1Q8KA 4IOAA 4NXNQ 5HGQA 4DV2L 1Q46A 1LUZA 2K52A 5GROA 1K9MC 3TRZA 4B3TQ 1N36Q 4DR7Q 3I7FA 3F8TA 4WJ3M 4DAMA 4PG3A 2NVXH 3HOVH 1HNZL 2LXJA 3CF5A 4JV5Q 3CCVA 1HNWL 2YTYA 1I3QH 3KJOA 2NZHA 2JA8G 1PH4A 3CQZH 1XPRA 1B70B 2JEAI 4HIMA 2HT1A 4KI0A 1W2BA 1HJPA 4AH6A 4DR2L 1S40A 3E0EA 3CCRA 2PNHA 1VQMA 2IT1A 4BY1G 1WJJA 2E2IH 3UDXA 2N3SA 3ERSX 3K7UC 5C0XG 3BZCA 2VUMG 2Z6KA 4MTNA 4DR6L 1H95A 2B29A 2EIFA 5LMNW 4LF5L 3PF4A 1Z9FA 4LF4Q 4IFDI 2A19A 2PI2A 4LF5Q 4GOPA 3TS0A 3FKIG 4C3JH 1PH3A 1FL0A 1VQ9A 1QZGA 4NXMQ 3CD6A 1PYBA 3J7ZC 3HKSA 5AJ3L 1PH5A 1D7QA 4GKKL 1VQGA 1CUKA 1YZ7A 3KDFA 1ASZA 1IBKL 3NBHB 5E7NA 3U58A 2K4KA 3H0GG 4QJFA 3KF6A 3ICEA 2VS1A 1FVIA 4YY3L 1X6OA 5C3EG 4JYAQ 1A0IA 2XTIA 3KOJA 2N78A 3KDFB 1MJEA 2JA5G 3J81c 4A3IG 1TWFH 4YY3Q 1EFWA 3E9HA 2E2JH 1VQLA 4BY7G 3UDIA 2GVAA 1IYJB 4LW1A 1EWIA 1KD1C 5J3BA 1GM5A 4DV4L 4FDBA 4IPCA 1XNQQ 4LUZA 3U4VA 2JJQA 1Q1BA 3K8AA 2ZJPA 4LNQA 2B63H 2WFWA 4X65Q 4LF8Q 4A3BG 1JJ2A 1HZBA 4JI4Q 5IT9c 1JMCA 1A62A 1P16A 2VW9A 3AFPA 4JI6L 2QEXA 1KC8C 1XPUA 1QVCA 4UP7A 5GAGC 1XMOQ 4A3LH 1E24A 2VQFQ 1G6PA 2NZOA 3PUVA 4JI6Q 1VQ8A 2E8GA 3L0OA 5IP7H 4A3FH 5JJKA 2ATWA 5BR8Q 4A3JG 4HJ8A 1YHAA 2YV5A 1RL2A 2PQAB 1KRTA 4C2MH 2KHIA 4Y7NH 1OXVA 1XPOA 2AMCB 2K50A 3PSIA 1VQEA 2VL6A 3U4ZA 2R93G 1YI2A 1Q82C 3HOZG 4BXXG 3A74A 1WYDA 2WB1E 4YHHL 4A3DG 3CCQA 1I94Q 3S1QH 1VQNA 2N49A 1HR0Q 2F4VQ 4DUZL 5M3FH 4RG1A 4DKAC 1KXLA 5M5WH 4LF9L 3A5ZB 1NE3A 3T1HL 3F2DA 5FLXc 4JI4L 2MNAA 3RNUA 1KRSA 4AIMA 3DLLA 4UP8A 4X66L 2H5XA 1R9TH 4BBRG 1L0WA 4K0KQ 1XMQQ 5IYBG 3T1HQ 2UUBQ 2K14A 4OO1I 3I55A 4PMWA 2OQ0A 1JE5A 3CP0A 3HOYH 3M85A 5JJIA 2XGTA 4JI1Q 1L1OC 3L2PA 5IYDH 2YTVA 5K36G 1E1OA 4YCWA 2E5LL 4ME3A 3OTOL 1SLJA 2UXDL 2AWOA 2N8NA 1HZ9A 3UE1A 4DUYL 4JBKA 1X3EA 1VCIA 4A3MG 4EQ5A 2UUCL 1PH9A 4JI7L 5LMNL 1G51A 4DUYQ 4HIDA 4C3HH 3JAMi 3PIOA 3HOVG 2QGQA 5LMNQ 1YZ6A 4JBJA 4DV0L 1XNRQ 1HNXL 4B3ML 1X65A 4QL5A 2R7FA 2JA6H 1IBML 2D0OA 4UP9A 1K3RA 1EIYB 1VQKA 3J80i 4KLKA 3KYHC 4L5TA 3I56A 1OXSC 1VQBA 2I5HA 4DV7L 1NY4A 4DK6C 4NB3A 5C4XH 4OONA 4TVAB 3NEMA 1Y14B 2Z6KC 4HIKA 2JA7H 4A3CH 1C9OA 3UDFA 2HIVA 4DV5L 1Z47A 3S1MH 3HOUH 1X55A 4NXNL 4OWTB 2WB1G 3EN2A 4EX5A 3GTLH 1L1OA 1PH6A 4A3EH 4B3TL 4DV5Q 1V1QA 1N36L 1HH2P 1VQDA 4QGUA 4LF6Q 4DR7L 2Y0SE 4GOPC 4HJ7A 4RMFA 4GNXA 3HKZG 1KAWA 4JV5L 1L1OB 1PA6A 3I4NG 2JQOA 1GD7A 1S3OA 1P8LA 3H15A 1KHIA 1X56A 4X62L 4B3RL 1FJGL 3HOXG 4GNXB 3KFUA 1SR3A 2WAQE 1NJIC 1SROA 4JI8Q 2BA1A 4GLAC 4IO9A 4X62Q 4B3RQ 1FJGQ 4MZ9A 5IP9H 1N34L 5M5XH 2R7ZH 1IXRA 2KBNA 1OTCA 2B3GA 2MO1A 5C0XI 1IZ6A 4JC0A 3A5UA 4AQYQ 4OWWB 1UE6A 4C3IH 4POFA 1VQFA 1N34Q 4LF4L 1PH8A 3W1BA 1NMFA 3CMEA 5FJ8H 3S2DH 4HJAA 1UWVA 4R4CA 2ZTEA 1CKNA 4OXPA 1WFQA 4L5QA 4NXML 1UEBA 4A3KG 2B63G 3NELA 3U50C 3S1RH 1B7YB 4JBMA 3PO2H 4LFAQ 2KHJA 3T1YQ 4DR5Q 5C4JH 2VUMH 5GAHC 1YJWA 4J15A 1J5EQ 3RN2A 3S15H 2ZJRA 2Q2UA 4JYAL 2MQHA 4P71A 4A3LG 4IPGA 3CCUA 4GOPB 2Q2TA 2CQOA 3CCLA 2ES2A 3L7ZC 5IP7G 4A3FG 1WI5A 1IBLQ 1PV4A 4MNOA 2NVQH 1VQ5A 4GN4B 1PYSB 2EXDA 3G71A 4DV6Q 3GDEA 1AE2A 3KF6B 1YHQA 1N9WA 3LGJA 1GKHA 2HQLA 2I5MX 5ELOA 1XNQL 2Y0SG 3J7A5 2K75A 3JC66 5GQOA 1KIXA 2UUAQ 3RZOH 3G48A 3CCEA 4X65L 4LF8L 4LFBQ 2AHOB 2EQSA 3MEFA 5EAYA 3STBD 2Q2HA 5M3FG 3CC7A 1YJNA 4JI0Q 2LXKA 2WAQG 3I4OA 1XMOL 2VQFL 1VQPA 2GN5A 4DPGA 4ALPA 2JEBI 4B3SQ 4JBWA 5BR8L 3HOYG 2UXCQ 2L15A 4UY8C 2UXBQ 5IYDG 3HOWH 4BA2I 2OWOA 1JJCB 4O2DA 3ER0A 4GLXA 1SRUA 4PZ6A 4JI5L 3I4MG 1ASYA 4A3GH 1AH9A 1I94L 4LF7Q 1HR0L 2F4VL 2KCMA 3GTGH 4JI5Q 1A8VA 4JI2Q 3ULLA 3GTKH 3CPFA 4O0AA 1YHBA 1N32L 4K0KL 3I2ZA 3PUZA 1OXUA 3HKZE 1XMQL 1YEZA 2UUBL 4QY7A 4LFCQ 3S1NH 2JA6G 1N32Q 2UU9Q 2A8VA 1EYGA 1PFSA 3G6EA 1BBWA 2CWPA 4DR1Q 1Y1WH 2HHHL 4A93H 4JI1L 2ZTCA 3TQYA 2JA9A 5GADC 4HIOA 4POGA 4KHZA 4IFDJ 4A3CG 3W5OA 1LYLA 2VQEL 1VQJA 1WCMH 2CFMA 2NN6I 2OCEA 1GO3E 3GO5A 1VQ4A 2HHHQ 2JA7G 1YNXA 2LSSA 2VQEQ 3A0JA 1U0LA 1CSPA 2MFIA 4A3EG 5M3MH 1HZCA 2VY3A 4P72A 3J81i 2IHFA 4GNXC 1A63A 1V43A 3RLNA 1SE8A 4IPHA 1JJGA 5JEAJ 1UE7A 1SN8A 2CKZB 5DLQE 4P73A 4R4IA 2OQKA 3K7AH 1XNRL 1NBWA 2K5VA 4GLVB 1Q81C 3GD7A 1AE3A 2D62A 1EOVA 1OXTA 1Q1EA 3CXCA 3GTMH 3D0FA 4GN5A 4XTCS 5C44H 3PUXA 2GVBA 4YWKA 4R1JA 5IP9G 3WWVA 1N8RC 3IRBA 2RHSB 4A3JH 3KLWA 4JI3Q 1LM0A 2A1AA 2KCTA 4GN3B 1C0AA 1UE5A 4DV1Q 2FXQA 1Y1VH 4PZ8A 2YU9H 2IX0A 4LF6L 4WJ4A 3J81j 3PCOB 1PH1A 4BBSH 2JE6I 5FJ8G 1UE1A 4DR3L 4A3DH 1V9PA 2BA0A 4GS3A 1CSQA 4BA1I 5IYCH 3PF5A 4GKJL 4UPAA 2PMZE 4OX9Q 2RHQB 4OWXB 4NPSA 4DR3Q 3PO3H 3CPWA 1VQ6A 3EBEA 5ELNA 3PO2G 4GKJQ 4Y52H 1K0RA 2C35B 4JI8L 1X3FA 4P74A 1EQRA 1MKHA 3TEHB 1K73C 2ASBA 3CMAA 2RF4A 4AQYL 1E7ZA 1N33L 4P75A 2IHEA 1M1KC 4YWMA 5IY0A 1N33Q 1QVGA 3RR5A 2DUDA 2Z0SA 4LWCA 4DV3Q 4HJ5A 4A3MH 2R7DA 3M3YH 2BH2A 2ID0A 3M4QA 3BZKA 4X6AH 4DV2Q 3S14H 4YWLA 3T1YL 1C7YA 4LFAL 4DR5L 1J5EL 5IE8A 1YVCA 4JOIC 3K0XA 3M9BA 3SGIA 1HNZQ 1CKNB 1HNWQ 1XTDA 1B8AA 3KJPA 2R92H 1IBLL 1QVFA 1KL9A 4R4TA 3GTOH 2OTLA 3E9IA 4DV6L 1BVSA 3G4SA 3F1ZA 4DR2Q 2D0PA 4QIWE 1Q7YC 3HOWG 1YIJA 2AWNA 1E3PA 1GVPA 3TS2A 2R6GA 5FLMH 2UUAL 1DGSA 4DNIA 4A3GG 1MIUA 1TWCH 1K8GA 3M4PA 4PZ7A 4LFBL 1PH2A 2K5NA 1CKOA 4IPDA 1D8LA 4DR6Q 2F3IA 3CAMA 3Q8DA 2BH8A 1PH7A 3S2HH 4IFDG 1G291 4XIGS 4JI0L 1VS0A 3I4NH 3S17H 4YCUA 2IX1A 4IOCA 1PHJA 3HOXH 3D31A 1VQIA 4B3SL 2JA8H 1QZHA 2DGYA 3HFZB 1EUJA 3K81C 5AJ3Q 1Y1WG 4GKKQ 4JOIA 4A93G 2UXCL 5JEAG 1IBKQ 2UXBL 5H1SE 5JJLA 1BKBA 1J6QA 1MJCA 3ZJYC 4L5SA 3MXNB 3RN5A 2K5HA 1LTLA 3UE0A 1YJ9A 1WCMG 2Q2IA 4BY1H 1T9HA 3DM3A 4A4IA 3CCSA 1VQHA 4H02A 4JG2A 1WOCA 4QQBX 2ZM6L 4LF7L 3JAMc 3CCJA 1TXYA 5M3MG 3NENA 3VDYA 4DR4L 4AYBE 4JI2L 3S16H 2HIXA 3GTJH 1I5FA 2ZM6Q 5IWAL 3W1GA 1RIPA 1KQSA 4DR4Q 4DV4Q 3RLOA 4A3KH 1VQAA 2YTXA 4IJHA 1XJVA 4LFCL 5IWAQ 2KENA 3FKIH 3J80c 2OTJA 2UU9L 1NMGA 3H3VI 4KHPL 5C0XJ 3UDGA 1M90C 4YCVA 4DR1L 3ULJA 2PQAA 1SMXA 4JCVE 5C44G 3H0GH 2YYZA 3TREA 4KHPQ 1JT8A 5C3EH 1E22A 2JA5H 4R4OA 5C4XG 2WP8J 4A76A 4A3IH 2CWAA 1YITA 3EIVA 2ALYB 1Y1VG 4APVA 1EQQA 4BY7H 3M7NA 3HOUG 4LF9Q 4BBSG