2A1AA

Pkr kinase domain-eif2alpha complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
161
Chain Sequence
SHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
total genus 47
structure length 161
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a1aA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a1aA01
1IXRA 3CC7A 4DV6Q 2HHHL 1H95A 1CKOA 2PI2E 5IE8A 5FJ8G 3HOZG 2AKWB 2UUAL 4LF9L 2WAQG 1OTCA 4JI7L 1I94L 4TVAB 1HZ9A 1WCMG 4GNXC 3PUVA 4JBKA 4DR3Q 1GVPA 4DR1Q 5M5XH 3J7A5 4APVA 2VNUD 2UU9Q 3PIOA 1UE6A 4X62L 1KRSA 1NMFA 1HNZL 5IYDG 5DLQE 2AWNA 4LF6Q 2WAQE 3I56A 4IFDI 5LMNQ 4A3EG 1QVFA 2A8VA 4DUYL 4A3BG 2NVXH 2RHSB 2VQEL 4L5SA 1EIYB 1FGUA 1I5FA 1YIJA 4LFCQ 1M90C 4XIGS 4DNIA 4B3RL 4DV3L 3K7UC 4AQYL 2MNAA 1G291 1X6OA 4R4CA 4GN3B 1BVSA 1PYBA 4DUZQ 2Q2IA 4YWMA 1Q7YC 4IPHA 4PG3A 1I50H 4AYBG 4EX5A 3U58A 3H3VH 4JOIC 3S15H 4BBRH 4GNXB 3J7ZC 1IBKL 4A3IG 2UUAQ 2VUMG 4QJFA 1KL9A 1O7IA 2KENA 3F2DA 3HKZE 4A75A 2AMCB 5FJ8H 1Y1VH 2HHHQ 4B3SL 3A0JA 4DV6L 1GKHA 3FKIH 2OTJA 5HGQA 2UUBQ 1G6PA 2QGQA 1ASYA 1JT8A 4DR2L 4OWXB 2A1AA 3I4OA 3GTLH 4KHPL 2NVQH 4LFAQ 1VQOA 1VQ9A 1N32Q 3AQQA 3CCUA 3PCOB 1N32L 4QGUA 4P72A 1VQLA 3OTOQ 4DR7L 1U5KA 1K9MC 1E1TA 3PSIA 4HJ8A 4DV7L 4LUZA 2K14A 2KCTA 2E2IH 3OW2A 1YITA 2OQ0A 3CPFA 5LMUQ 4XTCS 1B8AA 3NELA 4B3SQ 4DV1Q 2NVYH 5JJKA 4HJ7A 4JI8Q 3ULPA 3TREA 3D31A 3H0GH 4A3MH 1BBUA 3NENA 3B6YA 5IYBH 3PF5A 1E22A 2B29A 1IZ6A 2JQOA 4GOPB 4YHHQ 2WB1G 3PO2G 4P71A 5C4XG 2K52A 1AH9A 1VQEA 5IT9c 4GOPA 1Q8KA 2NZHA 5JJLA 4GLAC 2JJQA 2Q2HA 4JI5Q 2ZTDA 1LYLA 3TS0A 4BA2I 1OXVA 4LFCL 4GN4B 1M1KC 4POGA 4K0KL 3IRBA 2JA6H 4BBSG 2FXQA 1JE5A 3HKSA 2VQEQ 1OXSC 3M7NA 2BA0A 4JI6L 5LMNL 2HIXA 3LGJA 4A4IA 4P73A 5GADC 4LF6L 4DR6L 4H02A 1OXTA 4JI0L 3CMEA 1X55A 3E9IA 4L5TA 1UE1A 2UU9L 2D0OA 2E8GA 1CSPA 4BXXH 3I55A 3FHWA 5C44G 3HOXH 4PZ8A 3PO3G 5IP7H 2F3IA 4DV5L 1Y1WG 2PQAA 1PVOA 2CCZA 3S1QH 3M4PA 1Y1VG 3AFPA 5FLMG 2MO0A 3F2CA 4HJAA 4GNXA 1Q46A 3S1RH 3GTKH 3RLOA 1XPRA 1IYJB 4HIMA 4A3LG 3GTQH 3CP0A 4UP9A 5BR8Q 4AH6A 2KHJA 4HJ5A 4IFDG 1EQQA 4OX9L 1PH6A 2K75A 3EBEA 3KDFA 4DK6C 1X9NA 2WFWA 4KI0A 3M4QA 3CQZH 2VQFQ 4A3CG 3T1YL 1V43A 1S3OA 3L2PA 4DV5Q 4X65L 1IBMQ 4X6AH 3U4VA 2EIFA 3CCVA 4L5QA 1WCMH 1YZ6A 3KF8B 3K80C 4PZ6A 1HZBA 2K5HA 4IO9A 5H1SE 2N8NA 2L15A 1Z47A 1QUQA 4P75A 1VQGA 4JI0Q 3AFQA 1TWFH 1Q86C 2OCEA 1X3FA 2LXJA 3H15A 1VQKA 4A3DG 2MQHA 1E7ZA 4TQUS 3HOVG 1Q1EA 1V9PA 4C3HH 4LUOA 3WWVA 1E24A 1P8LA 2Z6KC 5IP9H 5M3MH 2OWOA 1QVGA 3GTOH 1KD1C 1G51A 1J5EL 4IOCA 3PGZA 2JA6G 5IY0A 3HOUG 4B3TQ 2VY3A 4RMFA 4LNQA 1KRTA 1OXUA 4ALPA 1K8GA 1XNQQ 4GKKQ 2EQSA 3T1HQ 1HZAA 3EIVA 4GKJL 4YHHL 3HKZG 1DGSA 4YWLA 2C35B 1Z9FA 3K0XA 1SRUA 2HQLA 5JEAJ 3A5UA 1Q12A 4BXXG 3PV0A 2E5LL 3VDYA 4DV0L 4JI3L 4LF7L 1NE3A 3CCJA 1CKNB 1PH2A 4QQBX 4DR7Q 5HY6A 3OTOL 2GVBA 1L2FA 2JA8G 4JI1L 4OO1I 4YY3L 3E9HA 2IX0A 5C4JH 2ZM6Q 3G71A 3CC4A 1X65A 2Z0SA 4DPGA 1HJPA 2CKZB 4P74A 3UE1A 4BBSH 3HOWH 4LFBQ 2WP8J 1VQHA 4BA1I 1NJIC 1YJNA 1N36Q 2HT1A 2YV5A 1L1OA 3ZJYC 3ULLA 5IWAQ 1UWVA 1K8AC 1SFOH 4B3ML 4JYAL 2F52A 5IYBG 5IYCH 4UY8C 3S17H 4DR4L 2H5XA 1XJVA 5C0XG 3PO2H 5M5YH 4NPSA 1PHJA 4DR5L 2GVAA 2Y0SG 1HNWL 4AQYQ 4LF8L 3GTMH 4B3RQ 3I2ZA 1PH5A 2K5NA 4LF8Q 2ZTCA 4AYBE 1XPOA 1VQBA 1S72A 1S40A 2RF4A 1SMXA 2YTXA 2JEAI 2K5VA 4DR4Q 4GLVB 5J3BA 4JYAQ 3MEFA 4DV2L 1LUZA 1A0IA 1KHIA 2JA5G 2R6GA 1Y14B 1MKHA 4X62Q 4Y7NH 3SGIA 4JOIA 3F8TA 4A3JH 1W2BA 3DM3A 1HNXL 1WI5A 2BH8A 4LFBL 4DR3L 1XPUA 5IP7G 1KAWA 4R4IA 1CKMA 4JI7Q 1K0RA 2ZM6L 4JG2A 2N3SA 4JI1Q 1VS0A 1CUKA 3S24A 1UE7A 4JCVE 1LM0A 1Q81C 3PF4A 3H3VI 2NZOA 4QL5A 3RN2A 3BU2A 4IPGA 4A93H 4LF7Q 4JI3Q 4KLKA 3STBD 1FL0A 1N8RC 4DK3C 4FDBA 5C3EG 4X64Q 4DV0Q 1VQPA 4HIOA 4NXMQ 3CMAA 1XNRL 2NN6I 3M3YH 1B7YB 1TWCH 3S1MH 3EN2A 5ELNA 5AJ3L 4A3KH 1VQ8A 4X66L 1N34L 1JJCB 2UXCQ 2JEBI 1D7QA 4OXPA 2VL6A 1CSQA 1N9WA 2B63H 1EFWA 3T1HL 3A5ZB 2ID0A 1JJGA 2IHFA 3BJUA 3MXNB 4LUVA 1XMQL 3U4ZA 1TWAH 1RL2A 3TRZA 2MO1A 5LMNW 4UPAA 4JI2Q 3UE0A 2ATWA 2R92H 1Q82C 1PH4A 1J5EQ 4BY7H 4NXNQ 1Q1BA 2OQKA 4R1JA 4A3MG 2UUCQ 1MIUA 2JA7G 1B70B 4IJHA 1VQ6A 1VQFA 3AYHB 3HOYG 3J81c 5EAYA 3K7AH 4WJ3M 1YHQA 1VQJA 2GN5A 2YTVA 1WOCA 3RNUA 3F1ZA 1VQNA 2JA5H 2F4VQ 1VQDA 4HIDA 4X65Q 1IBML 1EWIA 3T1YQ 4JV5L 1N34Q 1PH1A 4A3JG 2UXDQ 3A74A 2DGYA 3CAMA 3OYYA 1SROA 1A63A 2UXBQ 4QIWE 4X64L 2ZJPA 5C0XJ 1PH8A 3RZOH 3KJPA 4DKAC 1EOVA 1K3RA 4JBMA 1FJGL 1KC8C 4C2MH 2UXBL 1NBWA 3TQYA 2XTIA 4LF5Q 4LF5L 3KF6A 4GLXA 4GS3A 1L0WA 3KJOA 1X56A 5GQOA 1Y1WH 1HR0L 2PNHA 4DR6Q 2PI2A 2Y0SE 1AE2A 4DAYB 1RIPA 5C0XI 2K4KA 2DUDA 2N78A 1AE3A 4MZ9A 1HNXQ 2MFIA 1EUJA 2UXDL 4HIKA 4JV5Q 1PH3A 3I4MG 2JA7H 4ME3A 3K8AA 1SR3A 1PFSA 4JI4L 1CKNA 1NTGA 1GM5A 3HOYH 5ELOA 4EQ5A 4OONA 4PZ7A 3GTJH 4C3IH 3GO5A 1QVCA 3J81j 2R92G 1PH7A 4K0KQ 2LSSA 4RG1A 1TWGH 4BBRG 3I4NG 5C4XH 3CD6A 2KBNA 4JI5L 1YJWA 1YEZA 1T9HA 3RN5A 2UUCL 1QZGA 1IL2A 1GD7A 3JAMi 4DR5Q 4IPDA 4J15A 3S1NH 4NXNL 3E0EA 3CW2C 2CWPA 4DV4L 1X54A 5GAGC 2NN6G 3G48A 3GD7A 1YJ9A 4MNOA 4AIMA 4IJLA 3RR5A 1MJEA 4B3MQ 3CPWA 3KOJA 3KF6B 1E1OA 3KFUA 2R7DA 5M3MG 5IWAL 2ZJQA 1L1OC 3J80c 1GO3E 5FLMH 4DAMA 2YU9H 2JK8A 4LF4Q 2NVTH 1ASZA 4BY1G 3F2BA 3RZDH 1XTDA 2E2HH 3GTPH 1OXXK 1SN8A 3HOUH 4YY3Q 2YYZA 1QUQB 2N49A 3FKIG 4IOAA 1XNRQ 4OO1G 2QA4A 4LWCA 2UUBL 4KHPQ 2CQOA 1N33L 1N33Q 5M3FH 1EIFA 3W1BA 4DR2Q 1I6HH 1PH9A 2ES2A 5JJIA 3RLNA 1NMGA 2CFMA 1FVIA 3JAMc 2E5LQ 3BZCA 4JBJA 5C3EH 1VQIA 2ASBA 3HOZH 1VQCA 1WFQA 2RHQB 2LXKA 3ERSX 3KDFB 2R93H 3ICEA 1IBKQ 4L5RC 3PUWA 3L0OA 2B63G 1TXYA 4KHZA 1X3EA 2CWAA 4LF4L 4A3DH 4QY7A 1XNQL 2JA8H 2QEXA 4DUZL 2IT1A 3AEVA 3H0GG 1WYDA 4DV3Q 2ZJRA 2I5MX 4DV2Q 4BY7G 1D8LA 3J81i 3K81C 1KXLA 2PQAB 4A3EH 4DV4Q 3UDFA 3S16H 4OWTB 1BKBA 1EYGA 4IPCA 4YWKA 1HNWQ 3NEMA 1LTLA 1UE5A 4DUYQ 3UDGA 3Q8DA 4A3BH 1C0AA 5K36G 5C44H 3HOXG 3I4NH 3W1GA 1VCIA 2I5LX 3G6EA 1X3GA 4R4QA 3I7FA 4A3FG 3PO3H 1HNZQ 2VZAA 1V1QA 3HOVH 1KIXA 3G4SA 4A3GH 1K73C 2VS1A 4JBWA 3CCQA 4DR1L 3CXCA 3CCEA 2KHIA 4IFDJ 3DLLA 1HZCA 4JI4Q 1PYSB 1A62A 4R4TA 4A3FH 1I94Q 2Q2TA 3TS2A 4LF9Q 2VQFL 4A3GG 1C9OA 3RLFA 4YCWA 3CCRA 3L7ZC 3PUZA 4OX9Q 3M9BA 1VQMA 1N36L 1YHAA 3M85A 5BR8L 1VQ7A 2I0QA 4BY1H 3D0FA 3HFZB 2Q2UA 3S14H 1WJJA 1UEBA 4JC0A 4MTNA 1HR0Q 1YBYA 2OTLA 4A3CH 4UP8A 1E3PA 1NY4A 1PA6A 1A8VA 2R7FA 3STBC 2A19A 4A76A 1U0LA 2BA1A 1JB7A 4YCVA 5M5WH 3NBHB 2IHEA 1FJGQ 3TEHB 4A3LH 2I5HA 4C3JH 2IY5B 3UDXA 5IYCG 5FLXc 5GAEC 1YNXA 3S2DH 1K83H 4YCUA 2R93G 1I3QH 1IBLL 3PUYA 3M4OH 5IP9G 1YVCA 2D0PA 2KCMA 2WB1E 4PMWA 2JE6I 4A93G 2PMZE 2V1CC 2YTYA 5IYDH 2F4VL 3I4MH 3HOWG 1SE8A 2K50A 3GTGH 4POFA 4GKJQ 3CCSA 2E2JH 4JI6Q 4GKKL 1P16A 1VQ4A 4OWWB 3PUXA 4A3KG 1W3SA 1YI2A 4B3TL 2VW9A 4GOPC 4O0AA 1XMOQ 2BH2A 4O2DA 5JEAG 1HH2P 4UP7A 4GN5A 4R4OA 1L1OB 1TWHH 5GAHC 1XMOL 3CCMA 3KLWA 3GDEA 1MJCA 1KQSA 3CF5A 2HIVA 3UDIA 3KYHC 1PV4A 3CCLA 2JA9A 3JC66 3W5OA 5GROA 3BZKA 1VQ5A 4JI2L 3J80i 1QZHA 1YZ7A 2R7ZG 1JMCA 3CC2A 4JI8L 1XMQQ 2VUMH 1EQRA 1YHBA 1IBLQ 4Y52H 2AWOA 4DV1L 4HJ9A 3S2HH 5LMUL 2D62A 1SLJA 2B3GA 2RCNA 4DV7Q 2UXCL 2ZTEA 1HR0W 2R7ZH 4NB3A 2XGTA 3ULJA 4X66Q 4LW1A 5AJ3Q 2EXDA 3ER0A 2Z6KA 4WJ4A 1C7YA 2ALYB 4LFAL 4NXML 1R9TH 1BBWA 3PIPA 1VQAA 3U50C 2AHOB 2IX1A 1JJ2A 1J6QA 4A3IH 5E7NA 3FP9A 5M3FG
chains in the Genus database with same CATH superfamily
2BHNA 1H95A 3KHRA 8ICGA 1BPEA 5IE8A 4A8EA 2MHVA 4HSPA 1EIGA 3IRUA 3RH6A 1RF2D 1STEA 5KG7A 3L5KA 1JROA 1CI3M 3RR5A 1WCMG 3EPGA 3UXPA 1F9PA 4JBKA 3TBIB 5ALIA 4DR1Q 4DNTB 4MFCA 1Q3LA 1TV9A 2AXTU 3SAFA 1TKDA 4ZH4A 5J2FA 2UU9Q 3EVQA 2Q0ZX 3LDAA 4JV2A 2R8KA 7ICNA 4CDDC 5AM1A 3MR2A 4J9OA 4KX5A 2XGPA 2PKEA 1KLGD 3HRZC 3I56A 1U9LA 4IFDI 1UAPA 3BYTB 1Y8NB 4ZOHC 2RHSB 3IKJA 5C4HA 4QZGA 1RQNA 2VQEL 3G6VA 4L5SA 3ISCA 1I5FA 2XGQA 5C4ZA 4XRHA 7ICFA 4DNIA 4M47A 3GILA 1PVPA 1SMYD 1JIHA 4AQYL 3PO2B 1G291 2ALZA 2K1BA 4FO2A 3QUQA 1OXJA 2FJ2A 4NLKA 3V05A 5KFVA 1HPCA 1KTKA 2KECA 4IPHA 4L6TB 4PG3A 2Z4HA 4JOIC 3WDNA 4AYBG 4EX5A 4IRDA 3VR6A 4ZRZA 1XU4A 4IN3A 5HHIA 1TS3A 1GUNA 1NNXA 5EPJA 1L3TA 2NRZA 2EVBA 2KENA 2VUMG 3GV8B 3RB0A 2UVUA 3SK6A 1Y1VH 4IRKA 5AKJA 4DV6L 2WF7A 3D3RA 4B3SL 1G6PA 4UAVA 5HGQA 2LS01 1I6HB 4EVOA 4F3OA 4FF4A 3I4OA 4KHPL 1B44D 2DGZA 2FLNA 3R9KA 3PCOB 1MSHA 1SJHD 1ML0D 1RKNA 4MFFA 2IL8A 2G07A 1IW7C 1HQRD 3JPPA 2K14A 1QOHA 2E2IH 4BBSG 3NELA 3QZ8A 3M9NB 4DV1Q 1EY8A 2YMQA 4F87A 2WV6D 1AP0A 4BUGA 4A3MH 4ECZA 3NENA 5IYBH 3T3FA 1QNKA 2B29A 2JQOA 1IZ6A 4UAIA 4YHHQ 2RKSA 4QZAA 1DONA 3M1YA 2KFNA 4CKEA 1HTPA 2JEGA 3NRZA 4CDGA 3RR7A 4I2EA 2BDUA 1VQEA 1X9SA 2QCPX 5AK4A 5IT9c 4FZLA 2HBLA 5DQIA 2HBMA 1D2BA 1D5MC 3DMUA 2ZTDA 3TS0A 2KE7A 4GXKA 1MBYA 4GN4B 4ECYA 4CE6A 4C56C 2H3IA 4YN4A 3UQ0A 4ZAIA 4K0KL 3QNMA 9ICRA 1HRJA 4US9A 3S1NB 1ZRMA 4F4KA 3LX0A 2KEEA 1EEID 4PGQA 2BA0A 4RGTA 2F0FA 5LMNL 1PTOB 3LWLA 2H3QA 4R66A 2RSNA 4H02A 3KKAA 1ZQEA 7ICPA 1VLBA 1X55A 4HEDA 3H8SA 5KFIA 1UE1A 3NBIA 2UU9L 1R4PB 3I55A 1ESRA 2XWBB 2NVTB 2JHDA 2B6GA 1BNZA 3PMLA 5IP7H 2Y1JA 2F3IA 9ICQA 1PVOA 4AYBF 1PZJD 2JXJA 4MEYA 1SBBB 3FC4A 1Y1VG 3C28A 5CWRA 3EJIA 4KD3A 1PRTF 4DSIA 5HURA 4XQQA 3RB3A 4F2SA 8ICJA 3RLOA 2FHTA 1J9OA 2W7OA 1IYJB 5DB6A 3PO5A 1LLRD 3GTQH 3VC8A 5J1ZA 3N52A 3C2KA 4F50A 3V6KA 4DN4M 3P7JA 4OX9L 1K3BC 2FPLA 1HUOA 3FDSA 2RRDA 5ALXA 1KSPA 3CQZH 3N6RA 4L8JA 4A3CG 3VA7A 2FLPA 2EIFA 1ZRNA 3K6OA 1ZQAA 2R8GA 3CNHA 4U68A 5H1SE 2L15A 2BCOA 1ZYRC 1Z47A 3D4WA 1BPYA 3QE9Y 4ABNA 2PO4A 4I2JA 1TWFH 4DFMA 2OCEA 1VQKA 4A3DG 1ZQHA 3DEEA 5AI6A 4LUOA 1U47A 2OWOA 1E24A 3SR6A 2EXZA 1KD1C 3I4MB 2RDHA 3HKZF 2JA6G 4YD2A 2EZYA 5IY0A 4PL1A 3V6JA 4C3IB 5JJZA 1EY6A 3QU9A 5KT7A 5KFEA 4LMQD 5ALKA 2WTFA 3RF9A 2BDPA 4B9TA 4KY6A 2C35B 2PMZB 1EWHA 2YN4A 4IALA 4LAAA 4J9RA 5JEAJ 3A5UA 2ZIVB 2OM6A 1NNLA 3VDYA 2W04A 2NZ1D 1NE3A 4O3OA 1S0OA 3TQ1A 2C9OA 2G9HD 2FI1A 4DQIA 3OTOL 2XI9A 2GVBA 2H1EA 3ONNA 2JA8G 3BDPA 4JI1L 4OO1I 2IX0A 2RVLA 5C4JH 2K4IA 3G71A 1ZEQX 5M5WB 3CC4A 2C2DA 4K4IA 3R2IA 5AK6A 4KLMA 3KBBA 3G7LA 5AM0A 3U26A 5FLXL 1EY4A 4A3EB 2V4RA 1K83B 2YV5A 1KN5A 2KCNA 4DOBA 1KDAA 3ULLA 3ZJYC 1N62A 1U4BA 2JA7B 1QLNA 3S17H 1EL0A 4UY8C 4DR4L 2D8CA 2DUYA 5C3EB 1XJVA 5C0XG 4FP5D 1WD1A 3PO2H 5M5YH 5CV8A 3QJYA 3C2PA 1SKSA 4USAA 4P2HA 3BQ1A 1HNWL 1WCNA 1XSNA 3I2ZA 5GTIU 4LF8Q 2E1FA 1VQBA 3HWTA 1S72A 1SMXA 5KG3A 1K0SA 3BS5B 2F0MA 1UUPA 1A77A 1PVRA 4Q8FA 2K5VA 4F5QA 2B2VC 4DV2L 4JYAQ 5JJKA 2A74C 1PZNA 2D2CC 4XQNA 4X62Q 2K04A 2JGAA 7ICHA 4IQUA 3F8TA 4A3JH 2L5YA 4RPYA 3SHLA 4Y2YA 2ZIWB 5I9PA 4F93B 3PIP3 1STGA 3D2NA 1K1SA 1Z7TA 3BVZA 4OJOA 1BCPB 4C4TA 3TAPA 1YNND 3N7PD 4JI7Q 2ZUBA 2DFLA 1K0RA 2PW7A 8ICXA 1SYDA 2N3SA 4CJ1B 1JMSA 2F0OA 4KKTA 1L3SA 3WKBA 1LM0A 1KLUD 2NZOA 2HDOA 4RQ4A 3BU2A 4IPGA 4RGOS 1NAPA 1QG7A 1SAPA 3RN2A 4A93H 1RG6A 8ICZA 1PRTC 3STBD 4DV0Q 3M3YH 4BGDA 3CMAA 2F0QA 2NN6I 3QU2A 3EN2A 5AJ3L 2KP7A 4RGNA 4K2LA 2I07B 2YMLA 4OJLA 3ISDA 2QILA 3ZDAA 4R8IA 2E3TA 1PMRA 4OXPA 2N1RA 3JAML 2B63H 4ZQ3A 1STNA 2IHFA 9ICAA 4BX9C 1BO0A 3TRZA 2MO1A 1U4LA 2RA4A 3RJJA 4IR1A 5LMNW 4CCHA 3UE0A 2E75C 5CBAE 3TADA 1CEZA 5KG5A 4A3BB 3H09A 1HTLD 2ZIWA 4ED7A 5NUCA 4A3MG 2UUCQ 5G3LF 5KRUA 3X3MA 1VQ6A 3K75D 4OGQC 3AYHB 5BN5A 1O80A 1ZJNA 2D3DA 1HUNA 2BCRA 3MFGA 1S5CD 2GN5A 2YTVA 1QTMA 2KEDA 4F71A 5CP2A 1TT2A 2FPMA 3S1MH 2JA5H 2F4VQ 4RQ8A 3IAYA 4H44C 4JV5L 4H13C 1DD2A 2DGYA 1QSSA 1B22A 3QX7A 3MHBA 4X64L 3TZDA 2FJ6A 3KJPA 4JW0A 1LTBD 1T7PA 2W8KA 3Q8SB 2NRXA 2FINB 3TQYA 1WCLA 1I4HA 1T5XD 3VCBA 4C80A 4GLXA 1IKLA 3HX0A 4GS3A 1L0WA 1Q3UA 1SE3A 1X56A 5GQOA 4Y2QA 2K28A 2PFPA 1NK7A 4F7XA 5JPNC 2HOQA 1AE2A 3K4GA 1RIPA 5E1FA 2LYHA 5EPKA 2DUDA 1Z1VA 4MZ9A 5TISU 1IG6A 2RHFA 2W11A 4MTKA 1X2IA 5EJWA 2MFIA 3UXOA 4WJ3B 4HIKA 3RH4A 2UXDL 4WJWA 4JV5Q 2C2EA 1AZQA 3K8AA 4MN3A 4EQ5A 4OONA 1RXVA 3GO5A 1PH7A 2ISPA 2QW7A 5IT9E 3I4NG 4J9NA 3GIKA 5A35A 1HNWQ 2RQXA 1KEJA 5T14A 3JAMi 2F0GA 3S1NH 4NXNL 4F5RA 2IPKD 4DV4L 5AKIA 3UMBA 1GO3F 2NN6G 3G48A 3C21A 5ALZA 2WB1C 1VF5C 4IJLA 4KKUA 4M8AA 3I73A 1S77D 3KF6B 1E1OA 3KOJA 5EE0A 5I6YA 4DAPA 1NK4A 3QUCA 3DEPA 2ZJQA 3TZUA 1JICA 2EQYA 4B9MA 4YVZA 3B0YA 5CR3A 1F9RA 2LI6A 3H40A 3OSPA 2DPJA 1X3QA 2JK8A 5FLMH 2NVTH 3GTPH 4BY1G 3F2BA 3V96A 2E76C 4HR7B 4QWCA 1OXXK 1SSOA 5AI4A 2ZT9C 4G7ZC 1B9NA 3J7AF 2R8HA 2KQ3A 2N49A 3S6JA 1B4FA 1Z1BA 2A3VA 4LWCA 4KHPQ 3EFXD 1UT8A 1YT3A 4EZ6A 1I6HH 3L3FX 4IUNA 3JAME 1LKYA 1GXDC 2ES2A 5EQ0A 4UB5A 1LT6D 2CFMA 1N61A 3PX0A 1CQVA 3BZCA 1FVIA 1S5BD 2EY5A 5KFYA 1WTRA 3HOZH 1SKRA 1WFQA 1A6XA 1LTGD 3ERSX 2R93H 1V1PA 2K05A 2LY7A 5KT6A 1XO1A 2VIXA 1EZ8A 2JMGA 4RQMA 2E74C 2IT1A 2ZXRA 1PK1B 3AEVA 1F0MA 1ZKOA 4R9WA 3VYRA 3T56B 4BY7G 3Q8LA 1XO0A 4YQWA 3N4MB 4G9BA 1D9DA 1ET9A 4DAVA 4IPCA 5AI8A 2PW5A 4BXOB 3FMCA 3NEMA 3X3NA 5J39A 2KHSA 1RJTA 5C44H 4NY8A 3VA5A 4MEXA 2D9UA 3MVVA 2ZUDA 5FO7B 5CBEE 3KK7A 2I1QA 1V1QA 3OIPA 3G4SA 4IUUA 2HHVA 1K73C 4Y2VA 2BDNA 1EOTA 2A6EC 2G08A 3ZI4A 3CCEA 1DM0B 2B2YC 4RKBA 2DWQA 2MA1A 1D5XC 4ED0A 4QNLA 2JA6B 2PFQA 2Q2TA 2YX8A 3WK4A 8ICFA 4G7HC 3AMUA 5EKLA 2F8KA 3MDAA 4Y2PA 3THVA 1Y1VB 2LMCB 1IW7D 3M9BA 2I0QA 1CFMA 2EAMA 1B53A 4A3CH 4FZMA 1YBYA 4QUCA 4Y7NB 2Y9TA 3UMGA 2RLTA 1N2XA 2BCSA 1E3PA 1NY4A 2JYOA 5KT5A 4UP8A 2EYJA 4A3JB 5AKGA 1MQ2A 7ICUA 4MIUA 4A76A 9ICWA 4YCXA 3RBDA 2ICEC 2H3ZA 5EKIA 2IHEA 4DXGA 5IIJA 3SYZA 1EYAA 2E2IB 3UDXA 5GAEC 4QB4A 2NYZD 2R93G 3IV6A 2K4HA 5KFLA 2B8GA 5IP9G 1RCVD 3TSSA 4A93G 4KHVA 3EROA 5IYDH 3HOWG 1SE8A 4GKJQ 3C2MA 2BQ3A 5J0OA 1EWCA 4DXFA 1M4VA 3M6ZA 1L3UA 1CT1D 1I4GA 4J03A 1SXTA 2F3VA 4PHAA 4HCSA 4B3TL 4GOPC 4O0AA 8ICOA 3GTJB 5JEAG 3WK5A 4MF2A 5DB9A 1LO5D 3PVXA 4UP7A 2G09A 4EQOA 2JA5B 4NL9C 2ICIA 2Z7JA 3CCMA 5J2GA 5KT2A 4OJ5A 2EAPA 4GXIA 1TAMA 1S4ZA 1PV4A 3D6CA 5FO8B 3M9MB 1GHKA 2EYFA 2JA9A 4JI2L 2LHTA 5KT3A 1UA1A 3GP7A 3CC2A 2R7ZG 4YR0A 4UB4A 2I46A 2Z9HA 4HJ9A 3SI8A 4KITB 3GIIA 3S2HH 2BPGA 2B3GA 2JZBA 2RCNA 2K7VA 2OXPA 2ZTEA 1S10A 3TACB 4QIWB 4X66Q 1B50A 1HA6A 4FBUA 5J0TA 1RDPD 2KJ5A 2ZG6A 3PW7A 4K8IA 3PO4A 8ICLA 3PIPA 1VQAA 2SNMA 1J6QA 5E7NA 3D6WA 4DOCA 4K5XA 3N7SC 4NV0A 4DV6Q 3M3YB 2HHHL 1CKOA 2PI2E 5FJ8G 3N7RC 3MTSA 3HOZG 2AKWB 4I2DA 4ECTA 4LF9L 3NWSA 2WAQG 2BQUA 1E2ZA 1I94L 1X6JA 4M9LA 2W9MA 1HZ9A 4X3SA 3PUVA 4NJ8A 2F0VA 5CORA 2WFAA 5ALQA 4TUQA 3C3LA 5M5XH 4IUPA 4QZHA 1NKBA 1JOKA 5CYUA 3PIOA 2KNJA 2W43A 4V190 1UE6A 4X62L 1NMFA 5DLQE 4LF6Q 4DSFA 4C8KA 1I6VC 3NTHA 4A3EG 3KZXA 1H9RA 2A8VA 4IQTA 2W9BB 1KTQA 4DUYL 2NVXH 1Z19A 5DGAA 8ICBA 5EPLA 4Q44A 1LVHA 3TFRA 3A0BU 1D8YA 2EZZA 1JC7A 4LFCQ 1M90C 2NN6H 3I4NB 4XIGS 5ALFA 1VDVA 4O3PA 4DV3L 3K7UC 4PZOA 1GUOA 3WKEA 5FO9B 2B39A 1Z3EB 1SYCA 1X6OA 4GN3B 3D8GA 4QWDA 1M8AA 1PYBA 4JVZA 4EQNA 1AW7A 1WD0A 3U58A 1Q7YC 8ICKA 1I50H 1HA5A 2OEOA 5CEHA 1NKEA 4GNXB 4A3IG 4US8A 3I4LA 4AP9A 1KL9A 3F2DA 1P7DA 2F1MA 5IILA 4QIWC 4YMOA 3JPOA 2AMCB 5ELCA 5KNIA 1GKHA 1MHWC 1Y69U 1HUZA 1TIID 2QGQA 4KTAA 3J7YW 1ASYA 1QQ7A 5G5GA 4HYKA 4OWXB 5AHXA 3GTLH 1TS5A 2VKQA 3AM9A 4LZGA 1YNNC 2J6UA 4ZK9B 5I9OA 4KLTA 4I7ZC 3CCUA 4QJFA 3K58A 2HHSA 4P72A 1OUQA 3SENA 3OTOQ 4DR7L 4J1MA 1E1TA 2R61A 4CKCA 4DV7L 3AL0B 3ISBA 2KCTA 1YITA 5DG8A 5LMUQ 1B8AA 4B3SQ 2NVYH 4F91B 3T5HA 5JOBA 3S16B 3RJEA 3ULPA 2YQEA 3OJUA 4O0IA 2A5HA 5HMLA 5DEHA 1E22A 1MC8A 4GOPB 3HOYB 3RAXA 2WB1G 5ALWA 5IOCA 4P0QB 3IDWA 5CMDA 4A3KB 3DHQA 1ZQJA 1Q8KA 5IIMA 1HQMC 2JJQA 2B21A 2FDRA 3RAQA 3QB3A 4LFCL 3Q8RB 2XRSD 5AKEA 4XQJA 4POGA 2JA6H 2NO4A 2W3RA 1JE5A 5BN3A 1UEAB 4OJ6A 3KFUF 2AQ3B 3HS0C 1SZHA 4JI6L 4NLGA 4QZ9A 3C2LA 8ICQA 1QE6A 5ALDA 1L8OA 2ASLA 4RQ5A 2B2VA 1YNJD 5J0UA 3CMEA 1BF4A 1WUDA 3ETRA 2R8IA 2E8MA 4DCCA 2QDBA 4C2MB 4QZEA 4RUCA 2WF6A 2PFOA 4E0DA 2L9HA 5BN4A 1SE2A 4BXOA 2F0NA 5C44G 4PZ8A 2ZIUB 5ELDA 4KLSA 2YB4A 1NR4A 3Q8PB 1ENCA 3K7AB 2ZXHA 4XYOA 4DV5L 2CCZA 1ZXTA 4IFDH 3NQIA 3AFPA 5ALGA 3I70A 3HILA 3ONAB 4HJAA 1Q46A 1TVXA 3S1RH 4NKLA 3GTKH 1ZYQA 1MSGA 4YD1A 3TP7A 4UP9A 1KNAA 3PIO3 3HOZB 7ICTA 1MN8A 4BJQA 2V4QA 2K75A 4DK6C 1X9NA 2WFWA 1NSNS 3L2PA 2B2TC 4DV5Q 5JUMA 4X65L 4HMJA 3DXJC 3CCVA 1LKYB 2KJ8A 3V7LA 4M6WB 2XIWA 1YZ6A 3KF8B 9ICHA 4PZ6A 2K5HA 9ICMA 5KFPA 1SJED 1K5OA 1CK1A 1X42A 4P75A 3TP6A 3NGDA 1Q86C 5CV7A 1X3FA 1CQFA 1SV0C 4BS9A 2MQHA 2ZJAA 2LFNA 4RGMA 1H9KA 5J29A 2LPEA 4E6IA 4C3HH 3WWVA 1P8LA 2J6TA 2XCAA 4DF4A 1PTOD 4B9XA 4KLOA 1ZYRD 4QWAA 3CYMA 5EE1A 4IOCA 5ALLA 4JK1A 1O78A 5LL6S 3TANA 3HOVB 1Z4NA 3HOUG 4G7OC 3UQ2A 2KJ9A 3IP4B 1F9SA 4ECXA 1K8GA 1XNQQ 2EDGA 2EQSA 2ZXOA 2KFZA 2CQAA 3T1HQ 3V72A 1ZQCA 3L9AX 1SEBD 1DGSA 2NBFA 1QH9A 1NOMA 2UVWA 3HKZG 3C1FA 5EWEA 2OH2A 5KFFA 1NKCA 9ICXA 2Q8IB 2GWSA 1XYIA 1TS2A 3MBYA 2HD3A 3PV8A 3KLSX 3S14B 3PZPA 4JI3L 1COKA 4LF7L 2BKEA 4EYHB 5IT9L 1CKNB 4DR7Q 1PUZA 2VUMB 2P6UA 2RCFA 4N8FA 3H8JA 4YY3L 5K5PA 3AU2A 2K5QA 5ALSA 2ZM6Q 4KKSA 4MFAA 4UB3A 1X65A 4F2RA 1HJPA 3LVVA 2JH1A 2Z0SA 4P74A 3UE1A 2XC9A 3HOWH 4F5PA 2HSZA 2KIWA 4M2YA 1NJIC 2EH9A 1N36Q 4LFBQ 5KTQA 1ZOLA 3PR4A 1RYRA 2F0DA 1B4OA 1UWVA 1SZPA 2RBMA 2NVXB 1RXWA 1QILA 5M9OA 1DK2A 1HFNA 7ICQA 4K2KA 4YFKA 2G5IB 4CDCC 8ICAA 4NPSA 1PHJA 4KN7A 4DR5L 2GVAA 4KLQA 2M2LA 4OL7A 3FPPA 4LF8L 2VJ5A 3Q8QB 3MWYW 4A3DB 1II3A 5K4LA 1TR5A 3FVQA 4AYBE 5KFDA 1JWMD 4JMUA 2LM1A 2BDOA 4UASA 2YTXA 4PMBA 4KMUC 4DR4Q 5J3BA 5GTHU 3OHAA 1U4MA 1LUZA 5L1KA 3MEFA 5AFWA 2R6GA 3C1EA 2JA5G 3SGIA 4RQ7A 1A3TA 2CRXA 4JOIA 3I28A 1HNXL 5COYA 2NUCA 3ITPA 3M7DA 4Y2TA 5J2KA 3NE5B 2VANA 4LFBL 2QB1A 5A0LA 3EQLC 1KAWA 1CKMA 5CRXA 4MHEA 4RQ6A 1AN8A 3LVWA 4JG2A 4JI1Q 4YR2A 3M8SA 1CUKA 2KIVA 1UE7A 3IG5A 1IM4A 2OT2A 4KY5A 4QL5A 1CA5A 2W9CA 4JV1A 4I2IA 4KLKA 1N8RC 4JI3Q 2PXIA 4FDBA 1DRGA 1JRPA 1VQPA 4HIOA 4IURA 4RQ3A 3TDQA 5KG6A 4A3KH 1VQ8A 4AIMA 1N34L 4EEYA 2K8BB 2W7PA 1AEXA 4CF5A 4B9SA 2AU0A 2UVRA 3MC0B 2PI5A 3NWTA 1CSQA 1KLNA 2XSCA 3OWFA 1EFWA 1J2NA 3ZD8A 4R8UA 4ELTA 3A5ZB 2ID0A 1JJGA 4O5CA 4B6JA 2W03A 1RL2A 3I8ZA 2IWHA 3GIMA 2KZMA 2FMPA 2ATWA 5H2FU 1Q82C 2R92H 3VR3A 1PH4A 3BDLA 2XY6A 1I3QB 1V8QA 4C4RA 5KFTA 4PPXA 1RDFA 2OQKA 4KLIA 5J0YA 5J0PA 5ALVA 1B70B 3GTGB 1VQFA 3I76A 2F44A 2VA8A 1EY5A 5DM73 3J81c 2DN8A 5DLFA 5KFNA 4CRXA 1CI4A 1EY7A 1W6JA 3K7AH 4A3GB 3OOCA 3A0HU 2V9WA 4KTQA 3BS5A 3RNUA 5J0SA 3EPIA 3S15B 4C8NA 3I72A 2QB0A 3A55A 5AK5A 1D6EC 1IBML 9ICBA 1TVAA 1N34Q 2UXDQ 2F0IA 3A74A 3O0FA 3CAMA 3OYYA 1SROA 4NMZA 4QIWE 1EOVA 5AIAA 5KFQA 4JBMA 1FGBD 3QYPA 4C2MH 1KC8C 4O3MA 1NBWA 2JEFA 2N88A 3VR5A 4LF5L 3MEHA 1DOQA 1S0NA 8ICRA 3BQ7A 4IQWA 1NI3A 4ZCKA 4RFBA 3KJOA 1ZD5A 5KFAA 1QSLA 2CXYA 2AGPA 5ELBA 1Y1WH 2K8CB 4GC7A 3PX6A 4M04A 1SNOA 2AJQA 8ICNA 2PNHA 4C3JB 4DAYB 5C0XI 3C29A 1VMCA 4FNFA 4ILWA 5G3LD 3HP3A 2BE5D 4U6PA 1PH3A 1LT4D 1SFOB 5BOMA 4P4PA 2JA7H 2RSOA 5J0WA 4F4ZA 4ME3A 3S17B 3HOYH 1N56A 4DF7A 5E4XA 2C2RA 3VYSA 5ELOA 1GM5A 1D1IA 1ZQSA 3GTJH 2AUKA 5J0QA 2KN7A 3J81j 3TP8A 2ZIVA 3EWAA 5DKWA 5CB1A 3GIJA 1TWGH 4RG1A 5C4XH 3PMNA 2KBNA 1YJWA 3C5FA 3NSWA 1IL2A 4J15A 4O3NA 3E0EA 2ASJA 3CW2C 1PTOH 2MGSA 4ECRA 3QOLA 1X54A 5EBDA 4CF4A 3GD7A 1IYVA 1MJEA 4B3MQ 3KFUA 5AM2A 4FBTA 2R7DA 4IQZA 2QARB 3G6XA 5FLXE 1WWVA 2B2YA 3WOFA 1ZQ1C 2W3SA 3CP8A 1L0XB 3E6ZX 5AKYA 1GO3E 3H6MA 3LWUA 4DAMA 5KFGA 3MAQA 2QEJC 1H9JA 4LF4Q 1WG8A 4DFAA 1HCZA 1QB5D 3T79A 1SN8A 5TZVA 3HOUH 5EE9A 4I2FA 2YYZA 4X5VA 1KDHA 3FKIG 4OO1G 2DQNB 4I2CA 3RJIA 3PW4A 8ICEA 2MPMA 1EIHA 2HUGA 1SDFA 1N33Q 5M3FH 5JJIA 2KKVA 2AGQA 1ZQTA 4DR2Q 1PH9A 3H0LB 1FD7D 4FFDA 3I3CA 3JAMc 2E5LQ 4KLDA 4P4OA 1VQCA 1IHZA 2SEBD 2RHQB 3P1HA 4O3SA 4NL9A 1NK5A 3D4RA 4B08A 3D2SA 5AIBA 5T1IA 2B63G 3JPRA 2CWAA 4P2CB 2XCPA 2JA8H 2LKYA 7ICGA 5ELEA 4AYBC 3SQIA 4RQ0A 1SV4A 7ICRA 3TFSA 4DV3Q 4O3QA 1L7NA 3M9OB 2DNCA 2I5MX 1STAA 1KXLA 2KG5A 4DL4A 4WFN3 3MXNA 3UDFA 4OWTB 1EYGA 1L7OA 3H8MA 1NK6A 2FMCA 4CKBA 4QWEA 4A3BH 4Z6FA 3Q8DA 2G06A 4FXDA 2Y9UA 4AYBB 4UAWA 2ODGA 2L4NA 2SNSA 1FNWA 1ZETA 2R3ZA 3FDTA 5C3XA 1X3GA 3J80L 1JWSD 3G6EA 3SV4A 2WACA 4UAZA 5IIFA 2CHBD 3ZDEA 2IMWP 2JRZA 2IOHA 4ED3A 3E0JA 4JBWA 2KTQA 3CCQA 3H0RB 2W9CB 5LL6X 4JI4Q 4PHEA 1A62A 2IOFK 1I94Q 1JQYD 4CBVA 1F2MA 4LF9Q 8ICTA 2VXWA 5L1IA 3CCRA 3L7ZC 3MR5A 5L1LA 3V7KA 1N36L 1YHAA 3I91A 2E8NA 1VQ7A 1I4RA 3S14H 4DR6L 4IUTA 2ZXIA 5J2IA 1UEBA 1WJJA 2OTLA 1GOZA 2VB2X 3HG9A 2JEJA 7ICVA 1A8VA 1DYQA 4KMOB 2GO7A 4GFJA 1U0LA 4M9NA 4M0AA 4YCVA 1ENAA 5M5WH 3NBHB 1D8BA 4K4HA 1FJGQ 9ICFA 4A3LH 5KYLA 5DBCA 2HBKA 5FLXc 1ZQQA 2LBOA 1K83H 4CJ2C 4J9SA 4YCUA 4Q5VA 1IBLL 3A54A 1VF7A 3DWAA 4C3HG 1ZD3A 2WB1E 4PMWA 4FF2A 1X6IA 4DFKA 1ZQYA 4BDPA 2V1CC 2CN1A 3AUOA 1D5ZC 2YTYA 2YTUA 3NPPA 1J8IA 2I9GA 2XIDA 4POFA 1HHVA 4I2HA 4JI6Q 1BNOA 2E2JH 5M5YB 4GKKL 4F5NA 5FP0A 4OWWB 1GUTA 5IIKA 2M9VA 4A3KG 1YI2A 2W9AA 3U9OA 5DBAA 1ZQIA 4JWMA 4O2DA 1FIQA 1HH2P 2PZWA 1QJOA 4C8MA 1SL0A 1JB3A 2K01A 1L1OB 5GAHC 4IR9A 5AI0A 3TP5A 1C48A 4ZUIA 1X9MA 1CTMA 1XX8A 1KNEA 4JV0A 2CH4W 9ICCA 1MD2D 2EYMA 1YZ7A 3NQTA 4Y52H 1XMQQ 1YHBA 1IBLQ 3K1RB 1T3NA 2AWOA 1D9FA 1A2TA 3F5EA 2D62A 2YU9B 3WK8A 4DV7Q 5ALYA 4J6HA 5HMMA 3R93A 2R7ZH 5ALPA 4BBSB 4FYDA 4LW1A 3T53B 1H9SA 2EXDA 2ZIXB 4DF8A 3PW5A 3DWQA 3RTVA 3ER0A 4LJXA 4BWMA 1R9TH 2M0NA 5CA7A 3DEOA 1S9FA 4ECWA 2IX1A 2KZ3A 1B9MA 4A3IH 1JJ2A 1LYLA 2DJGC 1V97A 3FP9A 2A69C 3CC7A 4CGYB 1ZQWA 1NJZA 4DL2A 2F3NA 3QXGA 3QUTA 4YIJA 3SK5A 2XO7A 1AFPA 2DY7A 2UUAL 2Y0SB 4B9UA 4TVAB 5CJ7A 3UM9A 4J9KA 2DNEA 2OF1A 3QEBZ 3J7A5 4K6LA 1B3QA 2AUJD 2CVRA 4DFJA 4Q0FA 1HNZL 3QUBA 3A8JE 1T3QA 5IYDG 1PXUA 2AWNA 2K5WA 2WAQE 2O6KA 1EQVA 1QVFA 2F8LA 1A0PA 5ALNA 4M6WA 3KOOA 4BWGB 4Z6CA 1G91A 3GU3A 3T51B 4NXZA 5J2HA 1YIJA 5KL8B 2F77X 4B3RL 1DCZA 5I4DA 5L37A 2MNAA 2HOFA 1PFNA 4R4CA 2EAOA 2F1JA 3EUB2 2WKCA 2Q2IA 1U4RA 2KEYA 2YB1A 5KFWA 3QU5A 3PSTA 1DXMA 3QWNA 5AM5A 3RJGA 4X3UA 4GZYC 1ZQOA 3J7ZC 2BOSA 7ICOA 2IBKA 1JOOA 3WOEA 4PHPA 2UUAQ 2WAQC 1WWUA 5LHY1 3HKZE 5CV5A 2HHHQ 2HCCA 3A0JA 3C23A 3FKIH 4OO1H 2UUBQ 3RZOB 2ZIUA 4UBBA 2VA2A 4XQ8A 5CC4A 2A1AA 7ICIA 2NVQH 2HCFA 1JUDA 5C5MA 4LFAQ 1VQ9A 1N32Q 3AQQA 2B8FA 4DS4A 4QZBA 2SOBA 4NDXA 1N32L 1VQLA 1GUSA 1U5KA 3PSIA 4HJ8A 2JR5A 1RTNA 2ENBA 1ZQPA 3SR1A 2UUBL 1BCPC 1XNSA 4RUAA 1KQQA 2OQ0A 2QF7A 1O7ZA 3N97B 3CPFA 4KV6A 4QMGA 4HJ7A 1MI2A 5IGCA 2F0TA 1RHPA 1TS4A 3D31A 3HKZC 3R8BA 3BQTA 4FE3A 5J2AA 5KFZA 3B6YA 2AQ2B 1L0YB 8ICIA 1Z4OA 2NB0A 5D14A 5C4XG 1N5WA 4P0QA 4FZNA 8ICVA 1SYGA 2K52A 4P71A 2VJ4A 5IIIA 1RZTA 4XT3B 5KNDA 5K36H 5I2XA 2V4DA 3C5GA 3RRHA 3QR8A 4GLAC 4ULLA 4JI5Q 4BA2I 3H4DA 1M1KC 1N63A 4DSKA 3IRBA 1XWEA 3ZDCA 3J81E 4OJPA 4ECSA 1I4XA 2VQEQ 2XY5A 3ALRA 1K8MA 1OXSC 3M7NA 2PQEA 1IYUA 1TE2A 1X66A 5HR7A 4PGXA 3Q22A 2ZJ8A 1RTOA 2HIXA 3LGJA 1FEZA 2CPRA 4A4IA 5GADC 4LF6L 2OHFA 1DK3A 4JI0L 4KX3A 2H3VA 5J2BA 1NK9A 3E9IA 2K4EA 1BPXA 4I7AA 1ZD4A 1SE4A 4L5TA 1RQLA 4UB6U 3GQCA 2E8GA 4KJOA 3OGUA 3A8IE 3FHWA 3HOXH 4RA8A 2E2HB 3SK8A 3RFAA 3K5MA 4QJFB 3M4PA 3F2CA 2MUTB 2MO0A 3M4OB 4ED8A 3UI2A 4HIMA 4R63A 1T94A 4PQXA 4FS1A 3CP0A 4AH6A 4P4MA 4K8JA 2ES6A 4HJ5A 4DL5A 2FLLA 5DDMA 2E2JB 2R93B 2WF8A 1FO4A 2F0EA 3EBEA 3KDFA 4KLFA 4KI0A 4DLEA 4ED1A 1S5FD 5C5LA 4CJ0B 2VQFQ 1S3OA 3T1YL 7ICJA 1OO9B 1FFUA 2F0LA 1PDQA 1UPHA 1WCMH 2Y0SF 3OW7A 4U7CA 2WB1B 2BCUA 3K80C 4RQ2A 2RP5A 2ZUCA 2F0KA 5ELFA 3H7IA 1TWAB 2EY6A 2IW3A 5D65A 3AU6A 2CW0D 3JPNA 3GZFA 3OSNA 1VQGA 2R92B 4HAEA 4BY7B 3S2DB 2LXJA 2KMDA 1KFDA 2PNRC 3V6HA 4CF3A 1E7ZA 3HOVG 4B9VA 3W3AA 5IP9H 5M3MH 2BPFA 2Z6KC 2W55A 1QVGA 1IV8A 3GTOH 5B66U 2EOTA 1J5EL 3PGZA 4M9GA 3PO3B 3SE0A 5J0XA 2KCCA 1JWUD 4HAIA 4B3TQ 2VY3A 4RMFA 4R8NA 4LNQA 1EY0A 1KRTA 3NVVA 4RU9A 4ALPA 5F9LA 2NRVA 3EIVA 2KK0A 4YHHL 4FVMA 4Z6EA 4YWLA 3VYUA 2JH7A 1U48A 2J4XA 1SRUA 2HQLA 1M6YA 8ICMA 1QWYA 3LYSA 4A3IB 5L1JA 3CRKC 2E5LL 2VA3A 3CRXA 2F0WA 4DV0L 2BQRA 3SMVA 5D3IB 4MHVA 3GFKB 4TQRA 5G5HA 1ZQMA 1L2FA 5KG1A 1QQ6A 3BQ2A 2D6FC 9ICUA 3RB6A 3HRDD 3CKIB 4XDXA 1COOA 4IC9A 1BUVT 4BBSH 1LV5A 1ZQLA 2WP8J 2JV3A 1S0MA 2WF9A 1L1OA 3OHXC 4X3KA 3AMZA 5T1GA 2EZXA 1K8AC 2F1IA 3FAHA 1SFOH 3MXPA 4B3ML 1PLFA 5IYBG 5IYCH 4ZLTF 2DPIA 3FYHA 2EPBA 2HDMA 3RMHA 4UW9A 3TAQA 4C0ZA 1E0BA 3SEIA 2W8LA 4RNMA 3GTMH 5ALMA 1F77A 3RUZA 3RR8A 4K6DA 1PH5A 2KVSA 1DGJA 3GV5B 2J0TD 2K5NA 3CRLC 1XPOA 3WK7A 4F5OA 3L3OC 1D1KA 5AICA 4J9LA 4TUPA 2RF4A 1X3PA 2JEAI 4YXJA 3NBHA 4GLVB 1VDZA 1HUMA 1NK0A 1KHIA 3A8KE 5KNBA 1EU3A 4Y7NH 1SIJA 2F2AB 4ZKBB 3DM3A 5DG7A 3I1YA 2OEHA 1WI5A 4EBDA 2WINB 3HP6A 5FKAC 4DR3L 3QG1A 4J8QA 4R4IA 3T5JA 2EYHA 2XN9C 1R4QB 4DA2A 5HP4A 2R7ZB 2C28A 3S1QB 1SNQA 3S24A 4JCVE 3PF4A 1Q81C 3H3VI 2KSOA 2RQ5A 3KLRA 5KAIU 4QW8A 2DKXA 4LF7Q 1TAQA 1ZQZA 2NWGA 5ALTA 3EA6A 4IQVA 4X64Q 4NXMQ 4DWIA 3MFYA 1CZGA 1SXEA 1B7YB 1TWCH 5JPMC 1XNRL 1JX4A 2DL0A 1UHUA 1HEKA 3NUCA 1DOKA 2JP1A 4M1UB 3L4PA 2JEBI 1D7QA 2VL6A 3E5SA 4X3TA 3T1HL 4R65A 2KSOB 3MXNB 3BJUA 2K5DA 1XMQL 1B43A 3IFDA 3U4ZA 3KLSA 2WB1F 4UPAA 3K5NA 3E3XA 1SNCA 3MXGA 1HXYD 2LM4A 4RCOA 2A68D 1CHPD 4C3HB 3PNCA 5KFCA 4QIWF 1MIUA 1C8CA 2JA7G 4RZRA 3RD4A 4TUSA 1ZQXA 2F0HA 3A7LA 3C1YA 3HOYG 1YHQA 1VQJA 4C3IG 3K57A 4KLEA 1WOCA 1VMPA 4IUQA 3SK4A 3RRGA 5DAUA 3TMEA 4Q8EA 5KFSA 1VQDA 2L55A 4LJZC 4HIDA 3T1YQ 5BPCA 3QZ7A 4A3JG 5ISRA 1PH1A 2DBYA 1QQ5A 3SXHA 4ZKCB 2FE9A 1A63A 2DKZA 3AU7A 5IODA 2UXBQ 2ZJPA 5C0XJ 1PH8A 3RZOH 2WAQB 3T13A 1SYBA 4KN4A 4NLZA 2DY8A 4RH6A 4EX6A 9ICJA 4RT2A 1XC9A 3S2HB 5KNCA 3GV7B 5M5XB 2AH5A 3M4YA 1GJXA 3IFTA 3NTIA 3V2TA 1Q3VA 4PL2A 5KG4A 5DG9A 4Q43A 2Y0SE 2Z1CA 2NVYB 2FMSA 1EYCA 1NZBA 2Q8RE 1HNXQ 1Z00B 3FRPB 3H0MB 5AI9A 1PFBA 4B9WA 4DK0A 4ECUA 4RWSC 3I4MG 1FR3A 5AK3A 4DNRB 3RJKA 4C1NK 1SR3A 1PFSA 2O4XA 3GV3A 2W54A 2NTSA 4C3IH 1QVCA 1KKXA 4YP3A 4DOAA 1SNMA 3SD7A 2R92G 3FEWX 4UBCA 1BNPA 1I50B 2LSSA 4K0KQ 4BBRG 3RBEA 2TMPA 3CD6A 4JI5L 1TQOA 9ICSA 1T9HA 1YEZA 4OIJA 2KOBA 3RN5A 4DR5Q 4DAYA 3IG8A 3T5LA 5DB7A 2NYVA 2R8JA 4GIBA 1B0XA 2CWPA 2CW0C 2VB3X 4UAUA 3NASA 1ILQA 3ICXA 1O08A 4DSJA 2F4IA 2A73B 5DQGA 2QDLA 1YJ9A 5KAFU 5M3MB 9ICKA 4DEZA 1L7PA 2DF4B 1L1OC 4Y2JA 5M3MG 3GTLB 2AQ1B 3GTOB 3FM9A 5J8YC 2YU9H 4KK7A 1B2TA 1ZQVA 2A6HD 1ASZA 4Y2RA 1XTDA 4QZCA 2PCFB 4ZUJA 2BGWA 1SWWA 2P35A 1ONLA 4YY3Q 5C5JA 1QUQB 2IHNA 2A1JB 5F9NA 1CRXA 4V0BA 3S1RB 1XNRQ 2R18A 2ATLA 1UT5A 3WKAA 2CQOA 5CV9A 1PZKD 2RDFA 4NLBA 1V38A 1Y8PB 1W6KA 2DJFC 1NMGA 2ASBA 2PPBC 4UB1A 4JBJA 5C3EH 1VQIA 1A2UA 2PMZF 3WK6A 1G2SA 2LXKA 3LK9A 4FO6A 1IBKQ 5B5EU 3G6JB 3L0OA 1TXYA 4KHZA 1X3EA 5C0YA 3IHQB 4QY7A 4ICAA 5DLGA 1H38A 1QNUA 2F0JA 2QEXA 3J7AV 4HMIA 4FS2A 4ZYSA 5AKZA 2MUTA 1WYDA 4UATA 1AQ6A 4F4YA 4JK1C 4TQSA 1SYFA 4DV2Q 3K81C 5CHGA 4F88A 2PQAB 3B9JA 4I2BA 4A3EH 1RYUA 4ME5A 4QF4A 5AI5A 1CA6A 2WKDA 3S16H 1BKBA 4R8UB 4YWKA 1JXEA 4DUYQ 1LTLA 5K36G 3H0GB 4M9JA 3TADC 3EW9A 3W1GA 1VCIA 1PYWD 2I5LX 5JVH3 1Y8OB 3PO3H 8ICCA 4A3FG 4EYIB 1QCKA 3C46A 3HOVH 1KIXA 2WHEA 1L7MA 2B2TA 4A3GH 4PV1C 4ACOA 5J22A 2VS1A 3KBGA 3MXUA 4DR1L 4C4SA 1F5SA 4NM2A 4M9HA 1HZCA 2F3WA 2JEIA 1PYSB 3DLLA 2EDUA 4A3FH 3GQBA 4N9PA 2M00A 1NZPA 2HBJA 1C4QA 1C9OA 3RLFA 4YCWA 4NLNA 8ICWA 4OX9Q 1O03A 1TWCB 3FKIB 4UHVA 5BR8L 3M85A 3LWEA 5AKLA 5IGBA 3QEAZ 2KA7A 3HFZB 4BY1H 3BVGA 4XYQA 4QQBX 1HR0Q 1CZWA 1NUCA 1FNUA 3MR6A 5KFKA 3JPSA 4P0PA 9ICPA 1TY0A 1PA6A 9ICNA 2WAQF 2R7FA 3BZDB 5HHHA 2KJXA 3IN5A 2F0SA 2A6HC 2KZZA 1DOMA 4IZ8A 5HR6A 2BA1A 1JB7A 3ZDDA 1A3UA 1K28A 3DWPA 5D4BA 4EBEA 1XXGA 5DDYA 4DS5A 4DSLA 3TEHB 4C3JH 4NWIA 2IY5B 4LK1C 1MA7A 1SXDA 1YNXA 2J6SA 1X9XA 3NVZA 1BPZA 3NHHA 1SNPA 1YVCA 2KCMA 4EX7A 4A3MB 1JI7A 3Q6SA 2PMZE 2MAXA 4DL6A 2F4VL 3MC1A 2BR0A 2K50A 3LNNA 3CCSA 2O2LD 1P16A 5JVG3 4IS7A 3PUXA 2L11A 2VW9A 1XMOQ 1X40A 4O42A 1WVLA 1KAAA 1ED1A 4PZNA 1A15A 1EU4A 1Q90A 2IOFA 3SEBA 5E4WC 4F72A 3LWMA 2P5ZX 1XMOL 2KOLA 1J2MA 3K1ZA 5KG0A 5FOBB 3CF5A 4QWBA 1KQSA 5C3WA 4FF1A 2K89A 5E79U 5KL1B 5KT4A 2B2UC 1SV0A 4H7BA 4UARA 4RPXA 3UDIA 3W5OA 3R2TA 5I6WA 5IGEA 3K59A 4DL7A 3BZKA 3JPTA 2ISOA 1PZID 5EOZA 4O5EA 8ICHA 3SDZA 1JMCA 4JI8L 2VUMH 1EQRA 2HOIA 1SNDA 2G9DA 5KEEA 5LMUL 3NP8A 2PI4A 3WK9A 4J9QA 1L3VA 5DB8A 2A69D 4NB3A 3ULJA 3HOUB 3RJFA 1KDCA 3A7AB 3HOWB 4GXJA 3UMCA 3JPQA 2X69A 4KJNA 1C7YA 4WJ4A 5EWFA 2F0PA 2AHOB 3U9SA 3KBXA 5KGUA 5M3FB 5D3DA 5M3FG 1IXRA 4C1NI 3HT3A 3PQIA 2F03A 4F92B 1ZXIA 3MR3A 3TARA 9ICEA 2WIIB 4MNOA 3K5LA 1OTCA 4JI7L 4KLHA 4YG2A 4DK1A 4RPZA 4GNXC 2LYBA 1WCMB 4DR3Q 1GVPA 3K5OA 2AQ0A 3M7GA 2XRQD 4APVA 2VNUD 1IIPA 2KUMA 5EGTA 2ZIXA 1KRSA 1H9SB 4EBCA 2A68C 3TI0A 4OEMB 1EXNA 4YR3A 3OIQA 5LMNQ 2BCVA 3KF8A 1TKWB 2Q4TA 2YMMA 4A3BG 7ICLA 4DSEA 1T4GA 1KW4A 1EIYB 1FGUA 1XWLA 4DFDA 4DGZA 4CGZA 2UVVA 3VYTA 1ZQRA 1KRPA 1BVSA 4DUZQ 4YWMA 3H3VH 1U49A 1JN3A 2X6LA 2FMMA 4EQPA 2N55A 3S15H 3NRWA 4BBRH 9ICTA 1IBKL 1G2TA 5L1MA 1TU2B 3GV6A 4RHRA 1O7IA 4A75A 2GLEA 2B2WA 1FFVA 1GUGA 5FJ8H 1LTAD 3NTUA 2OTJA 3EZ5A 4DR2L 3DM1A 2NV3A 1CM9A 1URJA 1SL2A 2KHVA 5D46A 2L5TA 3IM1A 5ALOA 4I2GA 1STHA 2P6RA 1VQOA 2PZTA 1RPLA 2LMRA 4QGUA 1A3VA 4DFPA 1K9MC 4Q45A 4QCLA 2GH1A 1DOLA 3BYYB 3J80E 5DGBA 1A76A 4LUZA 4Z9CB 3OW2A 2K8AA 4XTCS 1LABA 1GUWA 2L1BA 4JI8Q 3TREA 5ALHA 3H0GH 3ND8A 1BBUA 4IRCA 4P0PB 3PF5A 4NW2A 4O9MA 2PMZC 4OO1J 5AKKA 3T5KA 2HHXA 3PO2G 3ORYA 2EJFC 2EY1A 2F1HA 3KZIU 3QOJA 1YNJC 4TRDA 5E3FA 3FPUB 1AH9A 4YXMA 1BQQT 4GOPA 3H4BA 2HHQA 2EJGC 3TKAA 2FFKB 2NZHA 4HN7A 3T16A 2Q2HA 3GTMB 5JJLA 4HSVA 4UB8U 1NCVA 3MDCA 1OXVA 2RDGA 4A3FB 2FXQA 3CCLA 4XA5A 4PGYA 3HKSA 4O3RA 1T8EA 3HPOA 4MF8A 5IGFA 9ICGA 1NR2A 3D4DA 1F2YA 2F0UA 4P73A 1AZPA 1OXTA 5KFJA 2IHMA 4EEKA 2D0OA 4TSSA 1CSPA 4BXXH 1JOQA 1UNSA 2HCIA 1S97A 3RZDB 1S5LU 3GTPB 4DQQA 3PO3G 1Y1WG 2PQAA 5J2EA 1EY9A 1Y1WB 3S1QH 3PMFA 5KIXA 5FLMG 4GNXA 4R64A 3KKAC 1KDBA 3OSOA 3GDXA 5L9XA 4L63B 1XPRA 3P20A 4QZ8A 4A3LG 2PZUA 2G0AA 3HGBA 4IFDG 5BR8Q 2KHJA 2KVCA 4UAYA 1EQQA 5CGKA 1PH6A 4ECVA 3M4QA 4X6AH 4H0LC 3NVYA 1V43A 1IBMQ 3U4VA 1JE4A 2B63B 4L5QA 2L0CA 5C4XB 4G4KA 2W9BA 3AB9A 5EWGA 1HZBA 4IO9A 3VR2A 2N8NA 4WRDA 2A1JA 3SAHA 2RDJA 1QUQA 4DU9A 4JI0Q 1H9MA 3Q8MA 3AFQA 5KFMA 1S0VA 3A56A 5JEAH 1WTOA 1OW5A 4B9LA 1FNVA 3O13A 5JAVA 3H15A 5ALEA 2E8OA 3WKCA 5ALJA 5AKXA 4TQUS 1Q1EA 1TFRA 1V9PA 4Z6DA 2KHQA 3AQEA 4J9PA 1S5ED 4WORA 1G51A 2QARA 2ASDA 4QW9A 4KD4A 1LTTD 4J9MA 3PR5B 2FMQA 1L6NA 3PW2A 4RNOA 5J2CA 1LB2B 4CDEC 4ELVA 1OXUA 3BDOA 4GKKQ 1ZD2P 2BE5C 4JPBW 1HZAA 4K5WA 1S76D 1TWGB 4XXEA 4GKJL 1AROP 1Z9FA 3K0XA 3MABA 1LTSD 2YMPA 1GHJA 1NJYA 2LKVA 1Q12A 4BXXG 1Z6HA 3PV0A 2BPCA 4PNYA 1DZ1A 2EJMA 2Z6BA 2HVIA 2JZBB 4BY1B 1KFSA 4G57A 3PY8A 3CCJA 1PH2A 4EGVA 3R3OA 1XSPA 4NM1A 5HY6A 5J2DA 1ESFA 2JA8B 1Z00A 3D2QA 4YMMA 3E9HA 4K4GA 2MRLA 1BGXT 4DPGA 2ZXPA 2O5JC 1N48A 2CKZB 1SWVA 4BA1I 3UXNA 1VQHA 1YJNA 2HT1A 3CHBD 5IWAQ 3S9WA 1JORA 2QKIC 3QU4A 1TY2A 4ID6A 3SAGA 4C8LA 4JYAL 2F52A 1BDOA 2H5XA 3DV9A 1DJRD 5AKHA 3V7JA 5CV4A 2E1EA 2Y0SG 4KY7A 4AQYQ 1UQVA 4B3RQ 2H3FA 4C7YA 1KABA 2GA4B 3KD3A 3NK9A 5HGTA 2ZTCA 4QUFA 5HNKA 1LT3D 1JXLA 3NVWA 1N60A 2OXOA 2QB0B 1ZQFA 5CV6A 1S40A 1TK0A 1CHQD 3H91A 3Q23A 2HHUA 5F3XB 1UA0A 3H94A 1J97A 2XICA 7ICMA 1EFID 3K0YA 5F2DA 2SDFA 4F8MA 2K60A 1B1ZA 3NTKA 1A0IA 1Y14B 3OTQA 1BCPD 1MKHA 3QIAA 7ICSA 4TKOB 1U9RA 1PVQA 2IX3A 8ICYA 1W2BA 2KVMA 2JN4A 4Y2XA 3HW8A 1SGGA 2BH8A 1XS9D 3MFIA 2IJ0A 1XPUA 5IP7G 2ZM6L 1STBA 5D49A 3RB4A 1VS0A 5CR0A 5ALRA 1EYDA 3BG3A 4IUVA 8ICPA 1WTWA 4XT1B 7ICEA 1MQ3A 3ZD9A 2B0CA 3OHBA 3ERQA 1FL0A 4DK3C 1JT8A 5C3EG 2UXBL 1I4PA 3DDHA 2L12A 4G3IA 2EE1A 4EELA 5ELNA 3PW0A 2XWJB 4X66L 1TK5A 1ENFA 4OELB 3ED5A 3CQZB 9ICVA 4F4XA 1JCKB 1XSLA 3SZ2A 1JJCB 4C3JG 2UXCQ 5FK9C 4RCNA 1N9WA 3F5AA 4DQPA 4LUVA 3AN1A 4DL3A 1TWAH 5JRTA 4KLUA 2QLTA 3B0XA 1S8OA 4TURA 1ZQKA 4ECQA 3ZDBA 1LV9A 2A6ED 4N9TA 1TWFB 4JI2Q 3Q0AA 1J5EQ 1PK1A 4QZIA 4BY7H 4OCZA 3TN2A 3KUPA 3SV3A 2JXMB 4NXNQ 2EY2A 3H3VC 1Q1BA 2B2WC 2EYOA 4CDFC 4R1JA 5C44B 3HJEA 1WTPA 3BJYA 1SB3C 2PFNA 4JUZA 1ET6A 4IJHA 5KFBA 5AM4A 2LYAA 5DM63 1V1PB 3F53A 4I2AA 2Z4IA 2HHWA 5EAYA 4WJ3M 5JTIA 5KFHA 1G8ZD 4HCEA 4KN7C 5J8YA 5EE3A 4PHDA 3F1ZA 1L8LA 1V85A 2PYKA 1VQNA 4BBRB 4X65Q 1TWHB 9ICOA 1EWIA 2M9NA 2K33A 3RJHA 1JALA 5A2QE 2NRWA 4I28A 1ICWA 1PFMA 4DKAC 1ZQBA 1K3RA 4DQRA 2X6GA 3HZXA 1FJGL 3MGVA 4PH5A 2XTIA 4LF5Q 1LTID 4B9NA 2KD1A 3KF6A 1LACA 2K6AA 3F2UA 4O5KA 1K1QA 1STYA 2NTTA 5C4JB 2XY7A 2XVSA 2K32A 1HR0L 5C6AA 2MUYA 5EKKA 4QZFA 4DR6Q 2PI2A 1K8OA 1SL1A 4HTHA 2K4KA 2N78A 1AE3A 4Y2SA 2TSSA 1R9TB 1TAUA 2MJ8A 4KN4C 1EUJA 4S3SA 1FYCA 1PK3A 4PJ0U 2P66A 3HEJA 5C0XH 1VJ5A 5KFOA 1WTQA 4JI4L 1CKNA 1NTGA 2XNAC 4UB2A 4RT3A 4N8X1 4PZ7A 1X9WA 1X32A 1I4QA 4O1NA 1V1OA 2ESEA 4ED6A 2JSOA 1PTOC 5ALUA 1SYEA 3BDCA 1TK8A 2GOLA 1E2WA 1ECWA 1BXTA 2UUCL 1G6ZA 1SMYC 1QZGA 1EEFD 1GD7A 3OPOA 1UCVA 4IPDA 2Y0SC 2HI0A 4UQGA 3OWEB 2C22A 4I29A 2HDLA 1LT5D 4U673 4QZDA 4CNQA 4PMCA 5KFXA 5KG2A 5GAGC 1HFGA 2KKPA 3UPQA 1B3AA 3I90A 3CPWA 2HQEA 7ICKA 3MA2B 2B2UA 2Z8LA 3T4AC 5IWAL 2NVQB 3J80c 1BPDA 1JR0D 2F76X 2QKQA 3G6YA 5JU5A 1IKMA 5DQHA 8ICUA 4NP5A 3RZDH 2E2HH 4FXKC 2C5CA 3BS1A 1IL8A 1F2ZA 4OD0A 1ZQNA 2HVHA 2EANA 3AQFA 3H8WA 4IOAA 1DXSA 1ILPA 4OHJA 2QA4A 5J0RA 1E2VA 3GTKB 1U45A 3OJSA 1N33L 1RYSA 1EIFA 3W1BA 3BVMA 1U4PA 3BS7A 3RH5A 3RLNA 1F9QA 2CH4A 4Y2UA 1KFTA 3KDFB 1NJXA 3ICEA 1ZQDA 1ZJMA 4KLGA 4FXGC 4OIKA 1RM6C 4L5RC 3PUWA 3IL8A 4LF4L 4A3DH 1O7LA 3SVMA 1XNQL 2WF5A 4DUZL 4JB3A 2Q8TA 3H0GG 1F2LA 3CU7A 1XTCD 3PSPA 2MP1A 2ZJRA 3E0FA 2IA6A 1D8LA 3J81i 2HW3A 4K5VA 4K14A 4DV4Q 4KMUA 2MU2A 1EZ6A 1T5EA 1F44A 3UDGA 2HMXA 1UE5A 4FF3A 1C20A 1C0AA 2E5SA 1MGSA 2NO5A 8ICSA 3HOXG 3I4NH 3HOXB 4I27A 4I65A 3HKZB 1NJWA 4R4QA 2D5DA 3I7FA 3NXWA 1HNZQ 2VZAA 5TSSA 3VR4A 2NRTA 5A2QL 4RNNA 5IINA 3URYA 1BR9A 4EENA 3WU2U 3CXCA 1HIWA 3D6JA 1ICFB 2KHIA 4IFDJ 5KFUA 3OMGA 4YMNA 2E8PA 5EBCA 4R4TA 4C8OA 3TS2A 2K4PA 4DQSA 3MGIA 4RHSA 2VQFL 3EYZA 2H4OA 4A3GG 2HHTA 3GTQB 1WYGA 2XVTA 3PUZA 3WKDA 1VQMA 5IIOA 5J2JA 5DNFA 3Q24A 4DLGA 3D0FA 3QO2A 2Q2UA 4JC0A 4MTNA 2AGOA 4KLJA 1RODA 2G5HB 4RQNA 3OPXA 4GC6A 1PRTD 3STBC 1KBUA 2A19A 2EYLA 2I6XA 1QSYA 2O5IC 2I5HA 2BCQA 3PSFA 5IYCG 2G5DA 3S2DH 4EZ9A 4IL6U 1ZQGA 3KHGA 2Y1IA 9ICIA 1I3QH 1O7YA 3PUYA 3KTQA 4RKLA 4UDUC 1NK8A 2D0PA 4BWJA 4ODGA 3M4OH 3QU7A 1BOSA 1LTRD 2JE6I 1BPBA 2ZJ5A 3I4MH 3PX4A 3E58A 3GTGH 2MSNA 4LZDA 2EYPA 3MGHA 3MFHA 1VQ4A 3MZ5A 4KLLA 1W3SA 3W2DA 1Y88A 3ND9A 2BH2A 1EQTA 5DBBA 5IGGA 1A6SA 4GN5A 2KICA 5I2YA 1WTVA 1L5UA 1N5XA 2J7ZA 4R4OA 1TWHH 3E2EA 5AM3A 4F8RA 1PTOF 3KLWA 3GDEA 1MJCA 5IGDA 5KYIA 1WTXA 2EZVA 3C1ZA 2E2DC 3NS1A 2HIVA 4C7ZA 4JWNA 3KYHC 2KV2A 3JC66 2RDIA 1BBXC 4ED2A 5GROA 1VQ5A 3J80i 1QZHA 3J81L 1SKWA 3NUQA 4LVSA 4ELUA 4DV1L 3N28A 1WTHA 1SLJA 2AQ4A 1MSWD 3M8RA 3KHHA 4DO9A 2OYYA 1BCPF 2BZFA 2UXCL 1HR0W 3KHLA 1PRTB 3OMCA 4XUSA 1ZQUA 5KFRA 1S5DD 2XGTA 3Q8KA 9ICLA 4CHTB 5AJ3Q 2Z6KA 1Q8IA 1RD9D 2ALYB 3P75A 4LFAL 4NXML 3ETLA 1BBWA 2K03A 2YY6A 5BOLA 4A93B 4NLCA 3U50C 3M6KA 1QCBD 4RAUC 4RQ1A 2FPKA 4F4WA 3DUZA 3BQ0A 3ZYYX 3S1MB
chains in the Genus database with same CATH topology
1IXRA 3CC7A 4DV6Q 2HHHL 1H95A 1CKOA 2PI2E 5IE8A 5FJ8G 3HOZG 2AKWB 2UUAL 4LF9L 2WAQG 1OTCA 4JI7L 1I94L 4TVAB 1HZ9A 1WCMG 4GNXC 3PUVA 4JBKA 4DR3Q 1GVPA 4DR1Q 5M5XH 3J7A5 4APVA 2VNUD 2UU9Q 3PIOA 1UE6A 4X62L 1KRSA 1NMFA 1HNZL 5IYDG 5DLQE 2AWNA 4LF6Q 2WAQE 3I56A 4IFDI 5LMNQ 4A3EG 1QVFA 2A8VA 4DUYL 4A3BG 2NVXH 2RHSB 2VQEL 4L5SA 1EIYB 1FGUA 1I5FA 1YIJA 4LFCQ 1M90C 4XIGS 4DNIA 4B3RL 4DV3L 3K7UC 4AQYL 2MNAA 1G291 1X6OA 4R4CA 4GN3B 1BVSA 1PYBA 4DUZQ 2Q2IA 4YWMA 1Q7YC 4IPHA 4PG3A 1I50H 4AYBG 4EX5A 3U58A 3H3VH 4JOIC 3S15H 4BBRH 4GNXB 3J7ZC 1IBKL 4A3IG 2UUAQ 2VUMG 4QJFA 1KL9A 1O7IA 2KENA 3F2DA 3HKZE 4A75A 2AMCB 5FJ8H 1Y1VH 2HHHQ 4B3SL 3A0JA 4DV6L 1GKHA 3FKIH 2OTJA 5HGQA 2UUBQ 1G6PA 2QGQA 1ASYA 1JT8A 4DR2L 4OWXB 2A1AA 3I4OA 3GTLH 4KHPL 2NVQH 4LFAQ 1VQOA 1VQ9A 1N32Q 3AQQA 3CCUA 3PCOB 1N32L 4QGUA 4P72A 1VQLA 3OTOQ 4DR7L 1U5KA 1K9MC 1E1TA 3PSIA 4HJ8A 4DV7L 4LUZA 2K14A 2KCTA 2E2IH 3OW2A 1YITA 2OQ0A 3CPFA 5LMUQ 4XTCS 1B8AA 3NELA 4B3SQ 4DV1Q 2NVYH 5JJKA 4HJ7A 4JI8Q 3ULPA 3TREA 3D31A 3H0GH 4A3MH 1BBUA 3NENA 3B6YA 5IYBH 3PF5A 1E22A 2B29A 1IZ6A 2JQOA 4GOPB 4YHHQ 2WB1G 3PO2G 4P71A 5C4XG 2K52A 1AH9A 1VQEA 5IT9c 4GOPA 1Q8KA 2NZHA 5JJLA 4GLAC 2JJQA 2Q2HA 4JI5Q 2ZTDA 1LYLA 3TS0A 4BA2I 1OXVA 4LFCL 4GN4B 1M1KC 4POGA 4K0KL 3IRBA 2JA6H 4BBSG 2FXQA 1JE5A 3HKSA 2VQEQ 1OXSC 3M7NA 2BA0A 4JI6L 5LMNL 2HIXA 3LGJA 4A4IA 4P73A 5GADC 4LF6L 4DR6L 4H02A 1OXTA 4JI0L 3CMEA 1X55A 3E9IA 4L5TA 1UE1A 2UU9L 2D0OA 2E8GA 1CSPA 4BXXH 3I55A 3FHWA 5C44G 3HOXH 4PZ8A 3PO3G 5IP7H 2F3IA 4DV5L 1Y1WG 2PQAA 1PVOA 2CCZA 3S1QH 3M4PA 1Y1VG 3AFPA 5FLMG 2MO0A 3F2CA 4HJAA 4GNXA 1Q46A 3S1RH 3GTKH 3RLOA 1XPRA 1IYJB 4HIMA 4A3LG 3GTQH 3CP0A 4UP9A 5BR8Q 4AH6A 2KHJA 4HJ5A 4IFDG 1EQQA 4OX9L 1PH6A 2K75A 3EBEA 3KDFA 4DK6C 1X9NA 2WFWA 4KI0A 3M4QA 3CQZH 2VQFQ 4A3CG 3T1YL 1V43A 1S3OA 3L2PA 4DV5Q 4X65L 1IBMQ 4X6AH 3U4VA 2EIFA 3CCVA 4L5QA 1WCMH 1YZ6A 3KF8B 3K80C 4PZ6A 1HZBA 2K5HA 4IO9A 5H1SE 2N8NA 2L15A 1Z47A 1QUQA 4P75A 1VQGA 4JI0Q 3AFQA 1TWFH 1Q86C 2OCEA 1X3FA 2LXJA 3H15A 1VQKA 4A3DG 2MQHA 1E7ZA 4TQUS 3HOVG 1Q1EA 1V9PA 4C3HH 4LUOA 3WWVA 1E24A 1P8LA 2Z6KC 5IP9H 5M3MH 2OWOA 1QVGA 3GTOH 1KD1C 1G51A 1J5EL 4IOCA 3PGZA 2JA6G 5IY0A 3HOUG 4B3TQ 2VY3A 4RMFA 4LNQA 1KRTA 1OXUA 4ALPA 1K8GA 1XNQQ 4GKKQ 2EQSA 3T1HQ 1HZAA 3EIVA 4GKJL 4YHHL 3HKZG 1DGSA 4YWLA 2C35B 1Z9FA 3K0XA 1SRUA 2HQLA 5JEAJ 3A5UA 1Q12A 4BXXG 3PV0A 2E5LL 3VDYA 4DV0L 4JI3L 4LF7L 1NE3A 3CCJA 1CKNB 1PH2A 4QQBX 4DR7Q 5HY6A 3OTOL 2GVBA 1L2FA 2JA8G 4JI1L 4OO1I 4YY3L 3E9HA 2IX0A 5C4JH 2ZM6Q 3G71A 3CC4A 1X65A 2Z0SA 4DPGA 1HJPA 2CKZB 4P74A 3UE1A 4BBSH 3HOWH 4LFBQ 2WP8J 1VQHA 4BA1I 1NJIC 1YJNA 1N36Q 2HT1A 2YV5A 1L1OA 3ZJYC 3ULLA 5IWAQ 1UWVA 1K8AC 1SFOH 4B3ML 4JYAL 2F52A 5IYBG 5IYCH 4UY8C 3S17H 4DR4L 2H5XA 1XJVA 5C0XG 3PO2H 5M5YH 4NPSA 1PHJA 4DR5L 2GVAA 2Y0SG 1HNWL 4AQYQ 4LF8L 3GTMH 4B3RQ 3I2ZA 1PH5A 2K5NA 4LF8Q 2ZTCA 4AYBE 1XPOA 1VQBA 1S72A 1S40A 2RF4A 1SMXA 2YTXA 2JEAI 2K5VA 4DR4Q 4GLVB 5J3BA 4JYAQ 3MEFA 4DV2L 1LUZA 1A0IA 1KHIA 2JA5G 2R6GA 1Y14B 1MKHA 4X62Q 4Y7NH 3SGIA 4JOIA 3F8TA 4A3JH 1W2BA 3DM3A 1HNXL 1WI5A 2BH8A 4LFBL 4DR3L 1XPUA 5IP7G 1KAWA 4R4IA 1CKMA 4JI7Q 1K0RA 2ZM6L 4JG2A 2N3SA 4JI1Q 1VS0A 1CUKA 3S24A 1UE7A 4JCVE 1LM0A 1Q81C 3PF4A 3H3VI 2NZOA 4QL5A 3RN2A 3BU2A 4IPGA 4A93H 4LF7Q 4JI3Q 4KLKA 3STBD 1FL0A 1N8RC 4DK3C 4FDBA 5C3EG 4X64Q 4DV0Q 1VQPA 4HIOA 4NXMQ 3CMAA 1XNRL 2NN6I 3M3YH 1B7YB 1TWCH 3S1MH 3EN2A 5ELNA 5AJ3L 4A3KH 1VQ8A 4X66L 1N34L 1JJCB 2UXCQ 2JEBI 1D7QA 4OXPA 2VL6A 1CSQA 1N9WA 2B63H 1EFWA 3T1HL 3A5ZB 2ID0A 1JJGA 2IHFA 3BJUA 3MXNB 4LUVA 1XMQL 3U4ZA 1TWAH 1RL2A 3TRZA 2MO1A 5LMNW 4UPAA 4JI2Q 3UE0A 2ATWA 2R92H 1Q82C 1PH4A 1J5EQ 4BY7H 4NXNQ 1Q1BA 2OQKA 4R1JA 4A3MG 2UUCQ 1MIUA 2JA7G 1B70B 4IJHA 1VQ6A 1VQFA 3AYHB 3HOYG 3J81c 5EAYA 3K7AH 4WJ3M 1YHQA 1VQJA 2GN5A 2YTVA 1WOCA 3RNUA 3F1ZA 1VQNA 2JA5H 2F4VQ 1VQDA 4HIDA 4X65Q 1IBML 1EWIA 3T1YQ 4JV5L 1N34Q 1PH1A 4A3JG 2UXDQ 3A74A 2DGYA 3CAMA 3OYYA 1SROA 1A63A 2UXBQ 4QIWE 4X64L 2ZJPA 5C0XJ 1PH8A 3RZOH 3KJPA 4DKAC 1EOVA 1K3RA 4JBMA 1FJGL 1KC8C 4C2MH 2UXBL 1NBWA 3TQYA 2XTIA 4LF5Q 4LF5L 3KF6A 4GLXA 4GS3A 1L0WA 3KJOA 1X56A 5GQOA 1Y1WH 1HR0L 2PNHA 4DR6Q 2PI2A 2Y0SE 1AE2A 4DAYB 1RIPA 5C0XI 2K4KA 2DUDA 2N78A 1AE3A 4MZ9A 1HNXQ 2MFIA 1EUJA 2UXDL 4HIKA 4JV5Q 1PH3A 3I4MG 2JA7H 4ME3A 3K8AA 1SR3A 1PFSA 4JI4L 1CKNA 1NTGA 1GM5A 3HOYH 5ELOA 4EQ5A 4OONA 4PZ7A 3GTJH 4C3IH 3GO5A 1QVCA 3J81j 2R92G 1PH7A 4K0KQ 2LSSA 4RG1A 1TWGH 4BBRG 3I4NG 5C4XH 3CD6A 2KBNA 4JI5L 1YJWA 1YEZA 1T9HA 3RN5A 2UUCL 1QZGA 1IL2A 1GD7A 3JAMi 4DR5Q 4IPDA 4J15A 3S1NH 4NXNL 3E0EA 3CW2C 2CWPA 4DV4L 1X54A 5GAGC 2NN6G 3G48A 3GD7A 1YJ9A 4MNOA 4AIMA 4IJLA 3RR5A 1MJEA 4B3MQ 3CPWA 3KOJA 3KF6B 1E1OA 3KFUA 2R7DA 5M3MG 5IWAL 2ZJQA 1L1OC 3J80c 1GO3E 5FLMH 4DAMA 2YU9H 2JK8A 4LF4Q 2NVTH 1ASZA 4BY1G 3F2BA 3RZDH 1XTDA 2E2HH 3GTPH 1OXXK 1SN8A 3HOUH 4YY3Q 2YYZA 1QUQB 2N49A 3FKIG 4IOAA 1XNRQ 4OO1G 2QA4A 4LWCA 2UUBL 4KHPQ 2CQOA 1N33L 1N33Q 5M3FH 1EIFA 3W1BA 4DR2Q 1I6HH 1PH9A 2ES2A 5JJIA 3RLNA 1NMGA 2CFMA 1FVIA 3JAMc 2E5LQ 3BZCA 4JBJA 5C3EH 1VQIA 2ASBA 3HOZH 1VQCA 1WFQA 2RHQB 2LXKA 3ERSX 3KDFB 2R93H 3ICEA 1IBKQ 4L5RC 3PUWA 3L0OA 2B63G 1TXYA 4KHZA 1X3EA 2CWAA 4LF4L 4A3DH 4QY7A 1XNQL 2JA8H 2QEXA 4DUZL 2IT1A 3AEVA 3H0GG 1WYDA 4DV3Q 2ZJRA 2I5MX 4DV2Q 4BY7G 1D8LA 3J81i 3K81C 1KXLA 2PQAB 4A3EH 4DV4Q 3UDFA 3S16H 4OWTB 1BKBA 1EYGA 4IPCA 4YWKA 1HNWQ 3NEMA 1LTLA 1UE5A 4DUYQ 3UDGA 3Q8DA 4A3BH 1C0AA 5K36G 5C44H 3HOXG 3I4NH 3W1GA 1VCIA 2I5LX 3G6EA 1X3GA 4R4QA 3I7FA 4A3FG 3PO3H 1HNZQ 2VZAA 1V1QA 3HOVH 1KIXA 3G4SA 4A3GH 1K73C 2VS1A 4JBWA 3CCQA 4DR1L 3CXCA 3CCEA 2KHIA 4IFDJ 3DLLA 1HZCA 4JI4Q 1PYSB 1A62A 4R4TA 4A3FH 1I94Q 2Q2TA 3TS2A 4LF9Q 2VQFL 4A3GG 1C9OA 3RLFA 4YCWA 3CCRA 3L7ZC 3PUZA 4OX9Q 3M9BA 1VQMA 1N36L 1YHAA 3M85A 5BR8L 1VQ7A 2I0QA 4BY1H 3D0FA 3HFZB 2Q2UA 3S14H 1WJJA 1UEBA 4JC0A 4MTNA 1HR0Q 1YBYA 2OTLA 4A3CH 4UP8A 1E3PA 1NY4A 1PA6A 1A8VA 2R7FA 3STBC 2A19A 4A76A 1U0LA 2BA1A 1JB7A 4YCVA 5M5WH 3NBHB 2IHEA 1FJGQ 3TEHB 4A3LH 2I5HA 4C3JH 2IY5B 3UDXA 5IYCG 5FLXc 5GAEC 1YNXA 3S2DH 1K83H 4YCUA 2R93G 1I3QH 1IBLL 3PUYA 3M4OH 5IP9G 1YVCA 2D0PA 2KCMA 2WB1E 4PMWA 2JE6I 4A93G 2PMZE 2V1CC 2YTYA 5IYDH 2F4VL 3I4MH 3HOWG 1SE8A 2K50A 3GTGH 4POFA