2A1AA

Pkr kinase domain-eif2alpha complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
161
Chain Sequence
SHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
total genus 47
structure length 161
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a1aA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a1aA01
1VQMA 2MQHA 1JB7A 1B7YB 4LW1A 4LF5Q 4OO1I 3A74A 4JI8L 1YHAA 4X65L 2QEXA 2N78A 2KBNA 3GTLH 4DNIA 2YTXA 1Z9FA 4JBWA 4B3SQ 3U4VA 3CP0A 2ZJRA 4R4OA 3KDFA 1AE3A 3HOWG 2JEBI 4DV3Q 4UPAA 5JEAJ 4JYAL 2WP8J 1ASYA 3G4SA 4A3MH 3HKZE 4GNXB 3U58A 3BJUA 3S16H 3UDIA 1Q1BA 4A4IA 2R93H 1LUZA 1EYGA 2LSSA 2VNUD 5IT9c 3ZJYC 4IJLA 1K73C 4UY8C 1OXUA 4QIWE 3GTMH 1HZBA 4A75A 3BZKA 3I2ZA 4AQYL 2R93G 2D0PA 2C35B 4PZ8A 4IJHA 2LXJA 3CCVA 3ULJA 1JMCA 3CAMA 5GROA 1SN8A 3PUXA 5AJ3L 1KC8C 4BXXG 1CKNA 4R4CA 3S17H 3HOVH 3PF4A 3MEFA 4LFAL 4DV4L 4KI0A 4A3DH 5M3FH 2UXBQ 1KRTA 4LF8L 1XNQQ 3I55A 3T1HL 5FLMH 4AQYQ 1GVPA 1A8VA 3KF6A 2WB1G 1TWHH 3CMAA 1XMOQ 1KL9A 3CC2A 1SFOH 3L2PA 2JEAI 2NVTH 1EQQA 1Y1VG 4X66L 2F3IA 2CWPA 4A3MG 1X3EA 4DV4Q 1JJGA 1E1TA 3K81C 4YWLA 4AYBG 4PZ7A 4DUYL 1VQCA 3E0EA 4DV1L 4DV2L 1VQ4A 5M5XH 1PHJA 2PI2E 3K7UC 3HOUH 3PO2H 2B29A 2MO1A 2AKWB 3HFZB 5C3EH 3F2CA 3PUWA 4DUZL 4X66Q 3FP9A 4UP8A 1V43A 2D0OA 3GTJH 4NXMQ 3I4NH 3STBD 4DV7Q 1HZ9A 4DUYQ 3VDYA 4JI6L 4JI3Q 3HOVG 3G6EA 1TWCH 4L5TA 4DV1Q 1HNZL 4A3DG 5M3FG 3S2DH 1QUQB 3K80C 1NY4A 5C0XJ 3KJOA 1L1OC 1SE8A 1N9WA 3GTPH 5IWAQ 3S24A 1EIFA 3J7ZC 2ZJPA 1VQFA 1W2BA 2UU9L 3TS0A 3CPWA 2K14A 1X3FA 4B3RL 4JI6Q 1YZ7A 2N49A 4GOPC 3PGZA 1HNWL 3Q8DA 2BH2A 4A3CH 1IBLL 5K36G 3S2HH 1E7ZA 4JI2Q 3CCUA 4J15A 2QA4A 1UE6A 3H0GH 2E2HH 4GLAC 4DV6L 4B3MQ 2HQLA 3PO2G 3CCEA 1XNRL 3PCOB 1DGSA 1L0WA 3EN2A 2V1CC 3RLFA 5C3EG 2JA5H 3HKSA 4JI4Q 4B3RQ 1N32L 4LF7Q 2UUCQ 2R92H 3A0JA 1HNWQ 5JJIA 3I4NG 1IBLQ 4BBSH 4C3JH 2JA7H 3K8AA 4GN3B 4RMFA 3GTKH 1YHBA 4GN4B 1PH7A 2ES2A 1KHIA 1T9HA 5HY6A 2Q2UA 2FXQA 4HIMA 4GNXC 4OWWB 5JJLA 3AEVA 1U0LA 2PQAA 2WB1E 1AH9A 1PH1A 1EOVA 3EBEA 2Q2HA 1Q86C 4BY1H 1N32Q 1PV4A 1AE2A 3D31A 3TEHB 4WJ4A 3RNUA 1NMFA 4A3CG 3F1ZA 4DKAC 4A76A 1SRUA 4A3KG 2UXCL 2Z6KA 3M9BA 3GO5A 1QVFA 3UDGA 3ER0A 3S1NH 4GKJL 3CC4A 2YTYA 3M4OH 4OO1G 3GDEA 5H1SE 1YI2A 1N33L 1VQHA 4HJ9A 2JA5G 4QY7A 1JJ2A 1WOCA 5BR8L 4YHHL 3L0OA 1XMQL 2ZJQA 4DV0L 4YCUA 2R92G 5E7NA 1IZ6A 1PH5A 1BVSA 2NVYH 4OWXB 4BBSG 1K3RA 1VQAA 2B3GA 4BBRG 1PH9A 4EQ5A 1Q46A 2UXCQ 4BA1I 2CKZB 3RZOH 4QGUA 2OQ0A 5GAEC 4GKJQ 5C0XI 4IOAA 2KENA 1TWGH 4DR4Q 2IY5B 3CCLA 1SROA 1N33Q 4JCVE 1HR0W 5BR8Q 4YHHQ 1XMQQ 2HHHQ 4DV0Q 1L2FA 3PSIA 4BY1G 4JBMA 4K0KL 4IPGA 3DLLA 1K0RA 4B3TL 1VQNA 1QVGA 2K75A 3PIPA 1QZHA 1Y1VH 1OXSC 4JC0A 4JI8Q 4X65Q 4Y7NH 4A3JG 3E9IA 3M7NA 1BBUA 1CKNB 4JI5L 3TS2A 4DR5L 1Q81C 5FJ8H 1N34L 4IFDG 1I50H 3U50C 3J80c 1WJJA 1VQKA 4C2MH 3G48A 4B3TQ 3A5ZB 4A3BH 4JYAQ 1EWIA 3PUZA 3STBC 2AMCB 2JA6H 1GD7A 1M1KC 4DAMA 4IOCA 1HR0L 5ELNA 4X62L 4JI7L 4KHZA 4DR5Q 1N34Q 1K9MC 2A8VA 3PF5A 1CKOA 4QL5A 2RHQB 1I3QH 4DK3C 4JBJA 3DM3A 1X3GA 2XGTA 3CD6A 4A3IH 4GKKL 5IP7G 3HOZH 3GTGH 3AYHB 5AJ3Q 4A3FH 1N8RC 1HR0Q 3I4MH 4TQUS 1CUKA 3J81j 1Q12A 2BH8A 3PV0A 4LFAQ 4JI1L 5FLXc 2MNAA 5IYDH 1A63A 3M3YH 1NE3A 4GNXA 1VS0A 3JAMc 3T1HQ 5LMUL 5GAGC 1YJWA 1S40A 5FJ8G 1J5EL 2RHSB 4KHPL 1S72A 1WI5A 1YEZA 1V9PA 2VZAA 1VQ9A 4LNQA 3D0FA 2NVXH 4A3BG 3M4QA 2JA6G 2HIXA 2I0QA 4DV5L 1WFQA 1LM0A 4P75A 4JI1Q 5JEAG 4HIKA 3K7AH 3F8TA 3F2DA 1MJEA 2CWAA 2AHOB 1PYSB 1SMXA 4DV2Q 1I94L 4BY7H 3TQYA 1ASZA 4KHPQ 4O0AA 2OTJA 1NMGA 4A93H 1X54A 1KIXA 1VQJA 4NB3A 4C3IH 2HT1A 4MNOA 3CMEA 4IPCA 2OCEA 1N36L 4A3IG 4DUZQ 2N3SA 1YITA 2I5LX 3SGIA 4DR1L 2ALYB 1E24A 3HOZG 4GN5A 4A3FG 3I4MG 1JT8A 5M5YH 4OX9L 3GD7A 1U5KA 2E8GA 1I94Q 1HNZQ 3W1GA 1MKHA 5IYDG 1LYLA 2B63H 3OYYA 4A3KH 4YCWA 4DK6C 2RCNA 2I5HA 1CKMA 1VQBA 2UUBL 2F4VL 2NN6G 2UU9Q 1UE1A 3TREA 2PQAB 3KLWA 4OX9Q 2VQEL 1H95A 1G291 1OTCA 2ZM6L 1C9OA 2ZTEA 4GLVB 3I56A 1R9TH 3HOXG 3JC66 2N8NA 4JG2A 4BBRH 4IFDI 2PMZE 3OTOL 2JQOA 4BY7G 4O2DA 3CF5A 3E9HA 4A93G 3UDXA 4DV6Q 2DUDA 1TWFH 3T1YL 2UUBQ 4LFBL 3RLOA 3RZDH 1XNRQ 1JJCB 1MJCA 3KJPA 1VQ5A 2JA8H 2YTVA 1SLJA 2I5MX 2IHEA 4JOIC 2VQEQ 3HKZG 2F52A 4R4QA 4DAYB 3AFPA 4HJAA 4AH6A 3BU2A 1J6QA 3S1MH 5IE8A 1B8AA 1GKHA 1Q7YC 4AYBE 2ATWA 4R4IA 4A3GH 5IP9G 1E3PA 2VY3A 4A3JH 2B63G 1X6OA 1YVCA 4LFBQ 2GN5A 2NZHA 1PA6A 1PH2A 4A3LH 5IYBG 1EQRA 1NBWA 3AQQA 5C0XG 1PH4A 4IFDJ 4WJ3M 2VQFL 3WWVA 1D7QA 1GO3E 4DPGA 1S3OA 1C0AA 4EX5A 3S1RH 4HJ5A 3MXNB 3KDFB 2JE6I 4XTCS 4KLKA 4APVA 2YV5A 5EAYA 2DGYA 2UUAL 3G71A 1A62A 3ULLA 1IBKL 3CCJA 5IY0A 1YJNA 2R7ZH 4POGA 3S15H 2K52A 4P72A 1UEBA 2JA8G 2VQFQ 2UXDQ 5DLQE 1X55A 1G51A 5IP7H 5GQOA 5JJKA 2LXKA 2A1AA 4LUVA 4L5SA 4LF5L 3M4PA 4IPHA 4MTNA 1P8LA 5C4XH 5GADC 2UUAQ 2ZTDA 2Q2IA 1Z47A 2HIVA 3M85A 4ME3A 4BA2I 3GTQH 4A3GG 3K0XA 1KD1C 4HIOA 1I6HH 4LF6L 4JV5L 2ZTCA 4DV3L 4A3LG 2UXDL 1L1OA 1G6PA 2IX0A 1IYJB 3LGJA 1FL0A 2Z0SA 4DR2L 4LUOA 3NEMA 1VCIA 5IYCG 2XTIA 2E5LL 1I5FA 1LTLA 2EIFA 2JJQA 3KF6B 4X64L 3J81c 4GOPA 4A3EH 2VUMH 3NBHB 2D62A 4LF6Q 3ICEA 4JI5Q 2L15A 1V1QA 1WCMG 4NPSA 3NENA 2R7ZG 3HOYH 3CCQA 1TWAH 2K50A 4TVAB 1GM5A 2NZOA 1OXTA 2GVBA 3ERSX 3W1BA 4DR2Q 1X9NA 2NVQH 4QQBX 5M5WH 2Y0SG 2R6GA 1VQ6A 1VQIA 3FHWA 3I4OA 2E5LQ 2JA9A 4K0KQ 4X64Q 3PO3G 4P73A 4YCVA 3NELA 5LMNW 2UXBL 5C4XG 1XNQL 4X62Q 4JI7Q 1RL2A 1Q1EA 3S14H 1IBML 1XMOL 4FDBA 4HJ8A 4GLXA 1C7YA 1D8LA 3CCRA 1E1OA 1SR3A 1MIUA 2R7DA 3RR5A 3OW2A 1YJ9A 1Y1WH 1YBYA 4DR6L 4JOIA 4GKKQ 4OONA 3EIVA 2Z6KC 4P71A 1P16A 3H3VI 3S1QH 5ELOA 2VUMG 2MO0A 4A3EG 3GTOH 3UE0A 1K83H 2JK8A 1IBMQ 2EQSA 1QVCA 3HOXH 3F2BA 1HNXL 1XTDA 1PH6A 1J5EQ 4LF8Q 5LMUQ 4YWKA 3TRZA 4PZ6A 1K8GA 3HOYG 5J3BA 1QZGA 4ALPA 4DR6Q 1K8AC 2KCTA 4R4TA 1HZCA 1TXYA 2VS1A 1KQSA 4NXNL 3UE1A 3B6YA 2AWNA 4OWTB 4QJFA 5LMNL 1VQEA 4NXML 4DV7L 4C3HH 4L5RC 4Y52H 3CXCA 1KXLA 1BBWA 2ID0A 2K5VA 1KRSA 3AFQA 4JI3L 3RN5A 3I7FA 4DV5Q 1FJGL 1W3SA 4YY3L 2BA0A 3IRBA 1HNXQ 3W5OA 1EFWA 1HZAA 4JI0L 2IT1A 2VL6A 4PMWA 1IL2A 4P74A 5IWAL 5IP9H 1CSQA 4LF9L 4JV5Q 4YWMA 4NXNQ 5LMNQ 4PG3A 1VQGA 2MFIA 3UDFA 1Y1WG 1PH8A 1N36Q 5IYBH 3CQZH 2WAQG 3A5UA 4DR1Q 1YIJA 4DR3L 1BKBA 1B70B 1XPRA 1FJGQ 2AWOA 4YY3Q 1VQ7A 2VW9A 3KFUA 4JI2L 1Y14B 2PNHA 5FLMG 4JI0Q 2PI2A 1Q82C 4XIGS 2E2IH 2K5NA 4L5QA 1XPOA 3FKIH 3H15A 1VQPA 4B3ML 2OTLA 4LF4L 4LF9Q 2R7FA 1Q8KA 5C44H 5M3MH 3PUVA 4MZ9A 1M90C 3J80i 1FVIA 4LFCL 1HJPA 4JI4L 4LF7L 2UUCL 4OXPA 2Y0SE 2KHJA 1UE5A 4GS3A 3KYHC 4DR3Q 2F4VQ 1PYBA 1PFSA 1QUQA 1VQDA 2YYZA 4H02A 2K4KA 4RG1A 3CCMA 1XJVA 3KOJA 3J81i 2ZM6Q 3J7A5 2A19A 1IXRA 1UWVA 3L7ZC 4UP9A 2RF4A 4LF4Q 3HOUG 3OTOQ 1VQLA 2IHFA 1YNXA 4IO9A 3BZCA 4LFCQ 1X65A 2CFMA 1NTGA 3PUYA 3T1YQ 3CCSA 1A0IA 2QGQA 1VQOA 4UP7A 4IPDA 1E22A 2OQKA 1VQ8A 3CPFA 3CC7A 4LUZA 1CSPA 2EXDA 2NN6I 1FGUA 4POFA 4DR7L 5C4JH 3CW2C 4X6AH 3U4ZA 5IYCH 1X56A 1KAWA 1UE7A 3FKIG 3ULPA 3KF8B 4R1JA 4AIMA 3JAMi 2CQOA 5GAHC 5M3MG 5C44G 2WFWA 2YU9H 1OXXK 2ASBA 3HOWH 2Q2TA 1WCMH 2K5HA 1YZ6A 1WYDA 2E2JH 3RLNA 2IX1A 2CCZA 2KCMA 5HGQA 4HIDA 2H5XA 3RN2A 4DR7Q 1HH2P 1L1OB 1EUJA 3H0GG 1PH3A 1O7IA 4HJ7A 1RIPA 3PO3H 1EIYB 4DR4L 2GVAA 2BA1A 2KHIA 1IBKQ 1XPUA 4LWCA 2HHHL 1JE5A 3H3VH 4B3SL 1PVOA 4GOPB 1NJIC 1YHQA 3PIOA 2WAQE 2JA7G 2OWOA 4BXXH 1OXVA 4JBKA
chains in the Genus database with same CATH superfamily
4DFJA 2NVXB 1IM4A 1PK3A 3E58A 3KBXA 4LW1A 4OO1I 3A74A 4X65L 5D3IB 5A2QE 3GTOB 2HHTA 2XIWA 5BN4A 5DB9A 1Z9FA 2R8JA 4F5PA 3HZXA 1NK5A 2DWQA 4HCSA 4O5CA 2IBKA 1X9SA 5HP4A 4R4OA 2V9WA 4DV3Q 3TFRA 4JYAL 2B2WA 5ALGA 1QNUA 3TACB 4A3MH 3HKZE 1BCPF 4TUSA 3HKZB 5IT9E 1EFID 1Q1BA 5KNCA 3GIKA 1NNLA 1Z19A 1SAPA 3WK8A 3C23A 1W6KA 4IQZA 1EYGA 3ZJYC 4N9TA 3GTMH 1OXUA 4MFAA 4WJ3B 5E79U 3G6XA 2XVTA 4A75A 1A3VA 3ISDA 2BZFA 2B63B 1SE2A 1UA1A 1NK8A 3CCVA 4N9PA 1JMCA 2XCAA 3MDAA 5GROA 4UAVA 5J2CA 4IRCA 2PMZC 3Q22A 4BXXG 1CKNA 4R4CA 5DG7A 3M9OB 3IG8A 4KKUA 2KIVA 3MEFA 3SVMA 4LFAL 2UXBQ 3QU2A 3SAHA 3PV8A 4F2SA 3DWAA 1XNQQ 2E2IB 1SNCA 2F0TA 3I55A 3V7KA 3T1HL 3ZDEA 3C46A 1GVPA 3A8IE 5KFSA 4U6PA 1HFNA 4M2YA 4ECWA 2WB1G 3KF6A 1BDOA 3CMAA 1I4RA 3CC2A 4G57A 5CBAE 2NVTH 1WVLA 3OJSA 2JA8B 3KD3A 1PLFA 3BVMA 1MGSA 1AN8A 3VYTA 1WG8A 4YWLA 3C3LA 1H9SA 1RXWA 4DV1L 3MDCA 1BXTA 4DL4A 7ICJA 4A3GB 4MHEA 3F2CA 2F2AB 3G6JB 3C2LA 1B9MA 4Y2VA 4UP8A 3MR6A 2XNAC 9ICKA 1JXLA 1IW7C 3QU4A 2L55A 4C8MA 4ZYSA 4DUYQ 1KFTA 2QARB 4JI3Q 1ECWA 3N7PD 3HOVG 2ISOA 4CF4A 2EZZA 1QUQB 1ZQIA 3X3MA 2IWHA 2MUTB 5C0XJ 1SE8A 2H3IA 3UXPA 3MZ5A 3QR8A 2Q8IB 2K14A 3TS0A 5KFCA 3S15B 1V38A 3NWSA 4I7ZC 4XA5A 1S9FA 1HNWL 3WDNA 2BH2A 3VR6A 2JHDA 5KAIU 3FRPB 1FO4A 3M7DA 3OW7A 3CCUA 1BPXA 1KFSA 5BOLA 2W9AA 4M9LA 5KFXA 2J6TA 3TP5A 1ET6A 1FNUA 5CB1A 1N63A 2JR5A 2IA6A 4KD3A 2E2HH 2HQLA 4R8UB 3RJGA 1KAAA 1V8QA 3EN2A 5AKKA 4XT3B 3HT3A 1ZQKA 4G3IA 1F2ZA 5C3EG 5KFKA 4B3RQ 4KY6A 1I6HB 2WF5A 3CRXA 2MUYA 2YTUA 4OHJA 3K8AA 4F4XA 3EYZA 4GN3B 2W9BB 4RMFA 3V7JA 1NNXA 1YHBA 3ED5A 4GN4B 3GQCA 4EZ9A 2OT2A 5HY6A 1PH7A 5KFLA 4ECXA 1T5XD 4OWWB 4OJ6A 2JXMB 3UMCA 1B4OA 1TU2B 1WTHA 2PQAA 4UAUA 1WTPA 1AH9A 1E2VA 1PH1A 5DQIA 5L1LA 1EOVA 2BHNA 4P4OA 3PW2A 2MAXA 1CQVA 1KTKA 2F3WA 2J0TD 2PW5A 4BY1H 4QIWC 3ZDCA 2CXYA 3MR5A 4IL6U 4X3TA 3TEHB 3UMBA 5ELBA 2YY6A 1SZHA 2G5HB 4F8MA 4A3CG 4M1UB 3AMUA 1CEZA 4A76A 2QW7A 2UXCL 4CRXA 3M9BA 1BCPB 4ECSA 3GO5A 2AGQA 3NWTA 4ODGA 3S1NH 4GKJL 3SAGA 2F0HA 2DKZA 3FEWX 3PIO3 5H1SE 1YI2A 4FS2A 2CQAA 4K4IA 2JA5G 4YHHL 3L0OA 2B2YC 1XMQL 4DV0L 4Z6FA 1SNDA 5CBEE 1NJYA 2I07B 3PSFA 1PH5A 4RGNA 1N5WA 3BYTB 3R3OA 4FO2A 2B3GA 2IL8A 3I76A 2O5JC 4H44C 2LPEA 1IV8A 2WKDA 4BA1I 3RZOH 3ZDDA 4QGUA 1RPLA 3WK5A 9ICRA 1EY5A 2FINB 4PHEA 1U4LA 2A68D 2KENA 5GAEC 1LKYA 1TWGH 4EEYA 1VF5C 1JN3A 3JPOA 3UQ0A 4I2GA 1PZJD 2NB0A 1U9LA 4U673 1HR0W 2OHFA 4CDDC 1N33Q 2XRQD 4JW0A 1IKLA 2LY7A 2EYHA 3N7RC 1K0RA 4UHVA 1VQNA 7ICFA 1PZID 2K75A 5DBBA 2X6LA 4YR2A 4K5VA 4CJ0B 4JC0A 4Y7NH 2EANA 1QSYA 4YP3A 3MWYW 5J1ZA 1F5SA 3BQ1A 5C4ZA 4DO9A 4K4GA 4DR5L 1N34L 5EWEA 2DFLA 1I50H 3C2KA 1WJJA 2LFNA 4OELB 5HHIA 1MI2A 3QJYA 1G2SA 2A6ED 5D3DA 5IILA 1F9SA 3J81E 2B39A 3A5ZB 2NYVA 4A3BH 3PUZA 3STBC 2GWSA 2JA6H 2JH7A 5KRUA 1AP0A 1GD7A 3RR8A 4UB5A 1STYA 3PSPA 2Z1CA 1HHVA 2C2EA 3V6JA 1ESRA 2EXZA 3S2DB 5I4DA 3PF5A 4C4TA 1ZQHA 1ZEQX 9ICQA 3FKIB 2VA3A 3THVA 7ICUA 4A3IH 5M3MB 4GKKL 2G5DA 3QUQA 2FHTA 3R2IA 3RAQA 5AI6A 3OHBA 2PQEA 5ALSA 3QE9Y 4A3FH 5D14A 1GHJA 1ZQYA 5J22A 2NZ1D 3JAME 1DONA 1CUKA 2BH8A 5C5MA 5FLXc 2MNAA 1A63A 4O5EA 2KA7A 1J5EL 7ICRA 3SE0A 4LF8L 2F0QA 1S40A 5FJ8G 1S72A 9ICNA 4FXDA 2FMPA 5E3FA 2NN6H 2BCOA 2NVXH 1Y88A 4XUSA 4DL5A 5KIXA 2ZXHA 2HIXA 5D65A 3BQ7A 5J0XA 3GTKB 4C4SA 2J4XA 4BXOA 1SMXA 1I94L 1JXEA 1XU4A 2EJGC 3TQYA 1ASZA 2OH2A 4KHPQ 2OTJA 1K8OA 5HGTA 4DNRB 5KFMA 4CKCA 5EPKA 4DAPA 2RDJA 1JICA 2I46A 4MNOA 1YNNC 3KLSA 5AICA 2B2TA 4K2LA 3SGIA 2ALZA 3KTQA 1E24A 2ALYB 4DR1L 4QWDA 4I65A 2E2JB 2ZIWB 4KLDA 4C8NA 1JT8A 2XWBB 4OX9L 1B3QA 3DWPA 3E3XA 2PO4A 3HILA 3D6CA 3KKAA 2B63H 4J9MA 1FYCA 2WAQC 2L1BA 5IGDA 4LVSA 4DQRA 1U47A 4MTKA 1BO0A 5KG3A 2LKVA 1UE1A 2CW0C 2NVYB 3VCBA 1TY2A 2WV6D 1RTNA 2BCUA 1H95A 1OTCA 2ZM6L 1C9OA 3UI2A 4EBDA 4GLVB 3I56A 3JC66 4NJ8A 5CA7A 1X2IA 5J0RA 1X32A 1J2NA 1QOHA 1O03A 2XWJB 5KFJA 8ICOA 1IYUA 1WTVA 3GTLB 1Q90A 2MHVA 1GUWA 3RLOA 1MHWC 5L1IA 3KJPA 2JA8H 4RZRA 2JSOA 2I5MX 2EYLA 8ICFA 1K0SA 4DAYB 2RCFA 5E4WC 2F0NA 1BF4A 4HJAA 1AZQA 1J6QA 2C5CA 3ITPA 9ICVA 5IE8A 4DF4A 3BVGA 1GKHA 5JPMC 3S16B 2KFNA 4R4IA 4A3GH 4DLGA 2YN4A 1X6OA 3WOEA 1SKSA 3BQ2A 3J7YW 2FPKA 4QZCA 1B9NA 3M8RA 4O3PA 1D6EC 1FNWA 1HFGA 3A56A 3A55A 1IW7D 5J2FA 5DG8A 4IFDJ 1ZRNA 4WJ3M 2K4PA 2FMCA 1D7QA 2R8HA 4OIJA 4GFJA 4KLHA 1LV9A 4EX5A 1ILPA 2JEGA 3KDFB 2PMZF 1EQTA 2JN4A 2QILA 4RCNA 3G71A 5KAFU 2B6GA 1A62A 2K60A 3ULLA 4KLIA 5IY0A 1I3QB 4J9QA 3S15H 1X40A 4DEZA 2BQUA 4IR1A 3FYHA 1HUMA 1UEBA 1ZQXA 2KD1A 3ISCA 1TWHB 1ZKOA 2KHSA 1V97A 3MVVA 4J03A 4DXFA 1WCLA 2V4DA 2VJ4A 2LXKA 3PO5A 5AHXA 3ZI4A 4KX5A 4AYBF 8ICBA 1Z47A 1ZQSA 4S3SA 4EZ6A 4ME3A 3M3YB 2BCSA 1XTCD 1UUPA 3D4DA 1I6HH 1U9RA 2BE5C 1DOMA 2ZTCA 5AI5A 1V1PA 4DV3L 4TKOB 4A3LG 3NVZA 1E2WA 1G6PA 5AI4A 4KLSA 2NTTA 3Q8QB 1PFMA 3QYPA 5JJZA 4P0PB 3SHLA 3NE5B 1QE6A 2E5LL 2HDMA 5T14A 4R66A 2EIFA 3GILA 2JJQA 2QCPX 2ZJ5A 3FDSA 3NBHB 4QUFA 2D62A 4F5OA 3DWQA 1V1QA 4K5WA 3QU5A 9ICFA 2LM1A 3NENA 2BQRA 1NI3A 3GTPB 2WF6A 1EEFD 4RU9A 2GVBA 1SMYC 4DR2Q 1CA5A 4QQBX 1D1IA 4JV2A 5EPLA 3I4OA 4K0KQ 1P7DA 4X64Q 4HMIA 4EQNA 5AM0A 5ALQA 1LO5D 4P2HA 3NELA 2UXBL 2I6XA 1TIID 4IUNA 2Y9UA 1XNQL 3EPGA 3MFHA 1SYDA 3S2HB 1AQ6A 4IQUA 4YD2A 4R9WA 2Y1JA 2KSOA 1Q1EA 4A3KB 2F0PA 1IBML 3D2SA 4DLEA 5AFWA 4FDBA 4HJ8A 4EELA 1RD9D 3MA2B 1YJ9A 4JOIA 3A8JE 2LS01 1MC8A 3EIVA 2R92B 4P0QB 1HQMC 4ZAIA 3OPXA 4DAVA 2A3VA 4BBSB 3SD7A 4GXIA 2L11A 5T1GA 2ASJA 3UE0A 1B50A 3LDAA 2EQSA 4QNLA 4TQRA 3FPUB 1T3NA 3T16A 1HNXL 2Z7JA 1BPDA 3IN5A 2L0CA 4DU9A 3HOYG 3C28A 1HZCA 1TXYA 4O9MA 3H0LB 9ICJA 2F44A 2KEEA 2XVSA 1KNEA 1VQEA 4QJFA 3HRDD 1O7ZA 3CXCA 3N97B 8ICEA 1S5BD 1JMSA 4O3OA 1ZQDA 1GOZA 1X9WA 4JI3L 3H8WA 4DV5Q 3BDOA 3BG3A 3CKIB 3AUOA 1EU3A 4B9UA 3A8KE 3H8JA 2RDIA 4RQ6A 3IRBA 3W5OA 4JI0L 4PMWA 4MF8A 5J2AA 4I2IA 8ICSA 3QU9A 2V4QA 1CSQA 3RB4A 3WKEA 3M8SA 2FMSA 4YWMA 4Y2JA 4YQWA 3DV9A 5H2FU 4LMQD 3A5UA 1DD2A 1BKBA 1B70B 1TY0A 1FJGQ 4YY3Q 2G06A 3PQIA 4OO1J 2KJ5A 4XIGS 2KFZA 4ED8A 3D2NA 9ICAA 3QOLA 4L5QA 1QB5D 3FKIH 5AI0A 4LF4L 5I2XA 5M3MH 4MEXA 7ICEA 1HJPA 1T8EA 2KQ3A 3FVQA 4DFAA 2CPRA 1ZYRD 2Y0SE 5KG1A 5AKJA 4EBCA 3TN2A 2F4VQ 1PYBA 2YYZA 5DDYA 3MEHA 2K4KA 4Y2XA 5EKIA 1DJRD 3EJIA 1F2YA 3J7A5 5KFQA 3NK9A 1NK7A 1EY7A 1DYQA 1G2TA 5KFGA 2YB1A 1UWVA 7ICGA 4OGQC 4ZH4A 2K8CB 4RQ7A 3IG5A 4J9PA 1U48A 1RXVA 1JWUD 4UP9A 3M9MB 3K57A 2E2HB 3NTIA 2HDLA 4MIUA 3VA5A 1X65A 1LT3D 3RRGA 4B9LA 1VQOA 4IPDA 4C2MB 2DF4B 4NLZA 3BS1A 2C2RA 1KN5A 3MTSA 1PRTC 4H13C 5KG7A 1SV0C 4KLUA 1ZD3A 4POFA 1CZGA 1V85A 3M6ZA 4FZNA 3RH4A 1JCKB 3RBDA 3OIPA 1TVAA 2D8CA 1ENCA 1EY4A 3JPQA 4NV0A 1D1KA 3HWTA 1C48A 4R1JA 4AIMA 3LVWA 5EE1A 4DQIA 1NK9A 2EY5A 3Q6SA 4CF5A 3TARA 1F9PA 4M0AA 5KFTA 2E2JH 5M5WB 1FIQA 5J0PA 5DQHA 5HGQA 1SXDA 3HOZB 5ALLA 1XYIA 1UT5A 5KFWA 3L4PA 4Y2PA 8ICMA 4RQ5A 2W43A 2K8BB 1XPUA 2IHNA 2B2TC 3WK7A 1JE5A 1PVOA 4B3SL 4RPXA 1PTOC 2CW0D 1NJIC 2F0DA 4JWNA 4KKSA 4F2RA 4U7CA 1T7PA 5ALHA 3PIOA 1YHQA 2JA7G 4BS9A 2FLNA 4G7ZC 3KKAC 1VQMA 3ETRA 4QW8A 3TADA 1MQ2A 2XICA 2XCPA 5IODA 1JWMD 4DA2A 2QEXA 1XO0A 1EIGA 4Z9CB 1I4GA 3H91A 4UB6U 4UDUC 2YTXA 4DNIA 3GTLH 2FJ6A 3HOXB 3PW5A 3QNMA 2WTFA 3U4VA 3CP0A 4BY7B 2KICA 2PFNA 3E5SA 4ECTA 3MXNA 3HOWG 1CA6A 1HA6A 4A93B 5AKYA 4F50A 4P2CB 2QB0A 3SYZA 4C3IB 4E6IA 5C0YA 4C3HB 3G4SA 3U58A 1X9MA 2ZG6A 1GUTA 4J9KA 3S16H 3KUPA 5KFEA 4CJ1B 4JK1A 1JRPA 1E0BA 5FLXL 2P5ZX 4PL2A 4ZK9B 2VNUD 4IJLA 3GV7B 2KMDA 1A3TA 1DCZA 1QSSA 1HZBA 2XY7A 1LTBD 3D3RA 4Y2QA 4QIWE 4QIWB 3RJEA 4AQYL 2RDHA 2R93G 2I9GA 2D0PA 4F92B 1L3TA 3D6WA 2F0LA 4ULLA 3TAQA 3F5EA 3LNNA 3PUXA 1DXSA 2ES6A 5HURA 2ZIUA 3NVYA 4Q8EA 3N52A 5FK9C 1F9RA 5EE0A 4DV4L 2LMCB 1CHQD 1RCVD 1SXTA 5FOBB 1D8YA 5DQGA 4DOCA 1Y8PB 4E0DA 1U49A 7ICVA 1E2ZA 2ZIVA 3UXOA 1ZQLA 1B53A 1H9JA 1COKA 1TWHH 4PMBA 3WK4A 4B9WA 1XMOQ 5L1MA 3QEAZ 1KSPA 3L2PA 3RZDB 2AQ3B 2JEAI 4X66L 2ZJ8A 4YXJA 3HKZF 4A3MG 1TKDA 4KK7A 1TK5A 4DK1A 2HI0A 4DL3A 4AYBG 1VQCA 1RYSA 1EOTA 3QIAA 2BE5D 1ZXIA 1KRPA 3HOUB 4Z6CA 2JEFA 1Z7TA 4C8LA 3PO2H 2PI2E 3K7UC 3NTUA 2EAOA 1QCKA 5CJ7A 5KL8B 1MA7A 2AKWB 2MO1A 3SMVA 4BJQA 2RVLA 3HFZB 4EGVA 1SJHD 4O3QA 4ZUIA 4NXMQ 5IGGA 4DV7Q 3K6OA 5CV4A 5M9OA 4JI6L 5AK5A 2R8GA 5KTQA 1TWCH 4L5TA 2WINB 2F0SA 2O2LD 1ML0D 3SI8A 2BDOA 3GTPH 5IWAQ 4ICAA 2KHVA 3V72A 1RZTA 3AU2A 4MHVA 1SMYD 3S24A 1VQFA 3HRZC 2JV3A 3J7ZC 1KLGD 4Q0FA 1X3FA 1U4BA 4BX9C 4US8A 4MF2A 2RQXA 2G9DA 3DEPA 4OIKA 2WKCA 1ZOLA 1ED1A 2R8KA 4R8NA 4FF2A 3RF9A 4RT3A 2E74C 3EW9A 1IBLL 3MR3A 2VKQA 3S2HH 4MFFA 4JI2Q 4NLGA 5LHY1 1MBYA 2W03A 2E3TA 3NRWA 5KT7A 5B66U 4RCOA 4O3RA 2A69C 2IJ0A 4B3MQ 1SL1A 4OO1H 3K0YA 1L0WA 4ECZA 1IIPA 3VC8A 3H4DA 1FR3A 1QTMA 1N32L 5KFIA 2R92H 3A0JA 3I73A 1SV4A 3MXUA 5IIJA 4B08A 4BBSH 4N8X1 5D46A 2JA7H 3S6JA 5KT5A 1Q8IA 1T9HA 4RHRA 4IR9A 2FXQA 4GNXC 1STNA 8ICTA 2BPCA 2VUMB 3HW8A 2NRZA 2J6UA 3AEVA 1U0LA 2WB1E 3BDCA 2QB1A 1AFPA 3MC0B 1CZWA 3OPOA 1UA0A 4IRDA 1BPZA 4WJ4A 2F0VA 3RNUA 4KJOA 4OJOA 2BCQA 5BN3A 3JPRA 2NRVA 3T79A 4LJZC 7ICOA 2PW7A 3Q8MA 1SRUA 4QZGA 5DLGA 1WTQA 1GHKA 1ZETA 4G7OC 3CC4A 2YTYA 2JZBA 3P20A 4IQTA 1VQHA 4BWMA 3J7AF 4QY7A 3S14B 1WOCA 3AU6A 2JRZA 5BR8L 5F9NA 2R93H 4DF7A 1A6XA 3KHLA 1EY0A 2K1BA 1EXNA 1Y1WB 3P75A 4BBRG 4O0IA 3GU3A 1ZQNA 2WAQB 4EQ5A 4DWIA 3BS5A 5KNDA 1M4VA 3ONAB 1R4QB 4QMGA 5EWGA 2P66A 1SROA 2Z6BA 4Q43A 1K83B 3MABA 3SDZA 3CCLA 3T5JA 2BKEA 3E6ZX 5EE9A 3H4BA 3PSIA 2B2VA 2MGSA 1F44A 1X42A 4BY1G 8ICVA 3O13A 3SK4A 4IPGA 3NTHA 3I1YA 2K7VA 4LAAA 3DLLA 3N4MB 1OXSC 2K04A 2D9UA 4F4YA 4PV1C 3GIIA 4JI8Q 3LWLA 1C4QA 4ME5A 5AM1A 3QZ7A 4XQQA 5C6AA 1BBUA 1CKNB 1FEZA 4QZFA 1ZQGA 3D6JA 1GXDC 3RFAA 1ZQMA 3SV4A 2ZUDA 3U50C 4RGOS 3J80c 3Q8KA 1WD1A 4NL9A 4C2MH 3G48A 3MGVA 3BDPA 4F88A 4B3TQ 3NXWA 4RKLA 1ZQUA 1PZKD 2XN9C 8ICQA 1Q3VA 1ZRMA 1KLUD 3GDXA 2AMCB 1R4PB 2A1JA 5GTHU 5CHGA 1EY8A 2IOFA 3CQZB 4DAMA 2F0IA 5CR3A 1SBBB 4IOCA 1HR0L 4KN7A 1HUNA 2FI1A 2P6RA 1SIJA 2A8VA 2AQ4A 2M9NA 4F8RA 2Y0SC 1RTOA 1CKOA 1PYWD 2K8AA 3V2TA 4QF4A 2FPLA 3ICXA 5F2DA 1H9SB 3GZFA 1KBUA 4HR7B 3NUCA 5ALMA 1HTLD 3LYSA 3QX7A 3SK5A 3T51B 3HOZH 2R8IA 1KLNA 4I29A 2W9MA 4I7AA 2UVVA 2NBFA 2UVUA 1PVRA 1XSLA 2F4IA 3H0GB 2ICIA 3RUZA 4FF1A 2W11A 2YQEA 4KMUA 5AI9A 1NKBA 1J9OA 1QNKA 1YJWA 4PHPA 1ZD5A 1V9PA 2BDUA 4A3BG 5G5GA 2NTSA 2JA6G 3I90A 4C3JB 2H3FA 4C1NI 4DV5L 1WFQA 5HNKA 4P75A 4JI1Q 1S76D 4QZBA 5TSSA 1VLBA 1A77A 3F2DA 1SL2A 2AHOB 1PYSB 1L8OA 2GO7A 5KG0A 1PRTF 1A3UA 4BY7H 3PW0A 1TVXA 4A93H 1X54A 1KIXA 8ICIA 4PH5A 4F93B 4C3IH 2KCCA 5IGBA 1Z3EB 5ALZA 2E8NA 3TADC 2EYFA 5ALNA 2IHMA 2N3SA 3A7AB 4DUZQ 4A3IG 1TFRA 4J9RA 2KVSA 1RODA 4RQ1A 2F0FA 4A3FG 1XXGA 2IOHA 8ICKA 1LYLA 2HMXA 5AK4A 3G6YA 4YCWA 3CNHA 3RB6A 2VA2A 2IW3A 1JB3A 5CR0A 2RCNA 1CKMA 2EJMA 2F4VL 2NN6G 3M7GA 3QEBZ 2UU9Q 2IPKD 2MPMA 2PQAB 4JK1C 1S0OA 1LTAD 2VQEL 5JVH3 1X3QA 1R9TH 1SWVA 4BBRH 1D5MC 5AIBA 2E1FA 2QARA 4HTHA 3E9HA 5KFUA 3H7IA 4K5XA 2DUDA 3QUTA 5ELFA 4J9NA 2UUBQ 3RZDH 1XNRQ 1MJCA 1JI7A 4HSPA 4FF3A 4PHDA 3GV5B 2K5QA 3HKZG 1TE2A 2DN8A 1QQ5A 4XDXA 3C21A 5ALXA 1I4HA 1ONLA 2EYOA 1Y1VB 4WJWA 4YFKA 3RAXA 5AKZA 2B0CA 1IL8A 5J2GA 2EYPA 5IP9G 1L3UA 1D9FA 4J1MA 4RGMA 2B63G 4LFBQ 2GN5A 2K05A 2NZHA 5HMLA 2E76C 3C1FA 3PZPA 1RDFA 2AUJD 5IYBG 1PA6A 1PH2A 1NBWA 2IOFK 3AQQA 5ELEA 7ICLA 4GZYC 5C0XG 5DAUA 1UHUA 9ICWA 1U4RA 3WWVA 4R8UA 1XC9A 1PZNA 1GO3E 2L9HA 2VQFL 1I6VC 5AI8A 1S3OA 2B8GA 3PVXA 2ESEA 2JYOA 2F8LA 1TV9A 4RKBA 2VANA 3MBYA 2JE6I 4TQSA 4PNYA 3S17B 4KLKA 2DGYA 1EZ6A 2XGPA 1TT2A 2UUAL 1O78A 3VYUA 3KLRA 5M3FB 4A3DB 2LYAA 1JOOA 2KJ9A 2EY1A 4QUCA 1FFUA 1URJA 4POGA 4JMUA 5DBCA 5FO7B 5KT6A 2JA8G 2UXDQ 1BNOA 3LVVA 1NZBA 2ZUCA 1VF7A 5DLQE 3K1ZA 1JC7A 5ALRA 3OWFA 3GTGB 4C8OA 1SFOB 4FBTA 2A1AA 3AU7A 4LUVA 4JV1A 5C4XH 5CV8A 2ZTDA 4I28A 3M85A 5EJWA 4A3GG 2G5IB 4HIOA 1F9QA 3A0BU 2IX0A 5KG2A 3GV6A 1D8BA 2HHVA 5IOCA 4LUOA 1JOKA 3GTJB 3I4NB 4DQQA 2XTIA 5IYCG 1I5FA 2VUMH 3IDWA 2SOBA 1U4PA 2E1EA 4X3UA 4LF6Q 9ICHA 4JI5Q 2QLTA 2E8PA 5ALJA 5EWFA 2SEBD 2G09A 3PO4A 4TVAB 1PRTB 1ET9A 4B9VA 4TUQA 1VDZA 4I2CA 3ERSX 2RA4A 3W1BA 2JXJA 5COYA 1I4XA 4WRDA 3FMCA 3PR4A 1VQIA 1N56A 4FBUA 5C5LA 3EUB2 1B43A 3M6KA 2ASLA 9ICMA 1HIWA 1DOLA 4P73A 3H3VC 3HS0C 4X3KA 4X62Q 4JI7Q 4M6WB 1JOQA 4K6LA 5KL1B 1VDVA 3S14H 4F4WA 4DOBA 1NAPA 2Z4HA 3Q8PB 4DL6A 2F0EA 1XMOL 1D8LA 4BXOB 8ICAA 1SR3A 1KDBA 2EYMA 1Y1WH 7ICPA 4DR6L 5AKIA 1YBYA 2TMPA 4QZEA 5AKXA 2WB1C 3H3VI 3EROA 5ELOA 4ELUA 3GTOH 2VIXA 1SWWA 1K83H 3KBGA 2JK8A 1PTOB 2KECA 4ID6A 2KP7A 3AN1A 4CF3A 3F2BA 4ECYA 2DNCA 1STAA 4FXGC 3RBEA 4LK1C 2PXIA 5NUCA 1K8GA 5DLFA 2LM4A 2Z4IA 1QZGA 2KCTA 4JV5L 4KLFA 4Q44A 3UQ2A 4OWTB 4NXNL 4NXML 5J2EA 5ALKA 2C22A 4DV7L 4EQPA 4FVMA 4I2EA 2KJ8A 2X6GA 4R8IA 1W3SA 3D4RA 3I28A 4A3JB 2VL6A 3T53B 1EEID 1XSPA 5IWAL 3GV3A 3TBIB 5IP9H 4LF9L 1TS4A 3TANA 4XT1B 2B2WC 2KKPA 5E1FA 5LMNQ 2H3VA 1PH8A 4GC6A 1N36Q 5IYBH 3CQZH 2N1RA 5A35A 2AQ0A 4RAUC 4DR3L 1KDHA 1XPRA 5C0XH 2AWOA 4JI2L 5ALVA 2GA4B 3ORYA 3WK6A 2PNHA 2QEJC 1Q82C 1HRJA 9ICPA 4NL9C 1WYGA 2PI4A 2E2IH 2WF8A 2D3DA 4O3NA 4B3ML 2PYKA 2R7FA 2FJ2A 1Q8KA 2D5DA 2RSNA 3J80i 4LFCL 5AM2A 2OXOA 2PZWA 3P1HA 2KHJA 1UE5A 4GS3A 4OXPA 5CWRA 4RNOA 3VA7A 4HAIA 4KN7C 4UBBA 5KNIA 4FYDA 1Z00B 4LJXA 3LX0A 3CCMA 1XJVA 2F76X 4DS4A 4KLTA 3ETLA 5IIMA 2AQ1B 1AZPA 1XX8A 4KV6A 3GTQB 3OTOQ 2ZIWA 2IHFA 2H1EA 2KJXA 5EBDA 3BZCA 4KLMA 2CFMA 4IUQA 3PUYA 2F1IA 2K4IA 3CCSA 1H9RA 2OYYA 3GFKB 1NOMA 1STHA 2QGQA 2NUCA 1E22A 3CPFA 3HX0A 3OHAA 3RH5A 3E2EA 1Y8OB 2HCIA 2EXDA 2NN6I 2BCVA 2HOIA 3MFYA 4KY5A 4KMUC 2EZVA 3CW2C 2A6HC 1X56A 2N88A 3T5HA 3I70A 5IYCH 1A6SA 3FKIG 3ULPA 1ESFA 3WKBA 3Q8LA 1NSNS 3D4WA 5EKKA 1N61A 5M3MG 2NRXA 2WFWA 5GAHC 2Q2TA 5DB8A 1AEXA 2K5HA 1YZ6A 3M1YA 2Y0SF 1WYDA 3IP4B 4KJNA 4Y2RA 2G0AA 3MXPA 3RLNA 4DK0A 2CCZA 1SZPA 2CRXA 4QZ8A 2H5XA 1V1PB 4DR7Q 1DZ1A 3K75D 2RRDA 4ED6A 1HH2P 5CYUA 1WTRA 2FE9A 3I4MB 2Q4TA 5DM63 2GVAA 2BA1A 4F4ZA 3J80L 4JWMA 2K03A 1JUDA 3L5KA 1SEBD 2HOFA 4KTQA 3GQBA 2RBMA 1O80A 3UPQA 1A2TA 1L7OA 4F87A 2OWOA 3OMGA 3CU7A 1H38A 4JBKA 2MQHA 2RSOA 1B7YB 1K3BC 4BWJA 4LF5Q 4JI8L 4RH6A 3TP8A 2B21A 2KBNA 2A73B 4JBWA 3BJYA 4ED0A 2F0KA 3MGIA 3KDFA 1TAUA 3T5LA 2FMMA 4B9NA 2JEBI 4UPAA 5JEAJ 4DF8A 2WP8J 2XC9A 2K4EA 2KSOB 2DJGC 3H6MA 9ICIA 2AGOA 4PZOA 5DB6A 4GNXB 1L3VA 1SL0A 4MN3A 2W8LA 2UVWA 4OJPA 3UDIA 1RM6C 1XS9D 4A4IA 2B2UA 5J0UA 2LSSA 1RKNA 2L5TA 5IT9c 4UY8C 4Z6EA 1ZJMA 3K59A 1K73C 3F53A 3BZKA 3H09A 2V4RA 3I2ZA 1COOA 3U9OA 1JE4A 1S8OA 5JVG3 3CAMA 3HP6A 2AGPA 3B9JA 1SN8A 2K28A 4ZKCB 2HVIA 4BUGA 3S17H 4H0LC 3PF4A 3MXGA 4A3DH 3BS7A 1ZQ1C 1LTSD 1EYAA 5M3FH 4UATA 4OCZA 3CYMA 3NBIA 1KABA 4P0PA 1Z1VA 1A8VA 3PW4A 2K5DA 1RF2D 2R61A 1KL9A 4I2HA 1PVQA 1TWFB 1SFOH 3TZUA 2SDFA 3KK7A 2P6UA 4IC9A 2CWPA 5C5JA 1MSHA 2F3IA 3EPIA 1X3EA 2JP1A 3FAHA 4CHTB 3BQTA 1NKEA 1JJGA 1E1TA 3K81C 3QG1A 4DUYL 4PZ7A 4DNTB 3L3OC 1FFVA 3KOOA 1XNSA 1NKCA 5ELCA 2EH9A 1N2XA 4QIWF 1S97A 5ALYA 5KYIA 4NM2A 7ICTA 1SNOA 4XXEA 2KVMA 3J7AV 2KV2A 3MFIA 3PUWA 4DUZL 4FNFA 1YNJC 1TK8A 3FP9A 2KKVA 2D0OA 4NY8A 3GTJH 3I4NH 3STBD 4M9GA 1WTWA 4ECVA 5AM5A 2EDGA 3G6EA 4KMOB 4DV1Q 4FZLA 4YN4A 3RH6A 3S2DH 3QOJA 4KLQA 3S1RB 1NY4A 3KJOA 5G3LD 3OWEB 5J2KA 4F5QA 1N9WA 3R8BA 1D5XC 3LK9A 1HEKA 1WCMB 4DL2A 3C5GA 1W2BA 5CV7A 2UU9L 2CH4A 1ICFB 5LL6S 2R7ZB 4B3RL 4C7ZA 5J0YA 2RKSA 7ICNA 5AKLA 2YX8A 3EFXD 3Q8DA 2Y0SB 1UPHA 9ICTA 9ICSA 4F5NA 3MGHA 1E7ZA 4KD4A 2QA4A 1UE6A 5ELDA 3AMZA 2F0OA 3PO3B 2LHTA 2ZT9C 3KFUF 3VR2A 5J2DA 4GLAC 4KKTA 3PO2G 3CCEA 1XNRL 1DGSA 4BDPA 4G9BA 3HKSA 2Z9HA 5JU5A 3SV3A 4L8JA 2NO5A 1HNWQ 5JJIA 4RQ8A 3GTKH 4PL1A 3U9SA 1PTOH 4KN4A 2HHQA 1B3AA 2AH5A 1KHIA 2Q2UA 2O4XA 2F0JA 5KT4A 2DPJA 1IYVA 4OJ5A 4HCEA 4RWSC 5TISU 3OGUA 4A3EB 4IZ8A 1LACA 1XWEA 5C4HA 3NS1A 1Z1BA 2LYHA 9ICUA 2Q2HA 2XRSD 1Q86C 1B0XA 1YNND 1ZQCA 3D31A 1BNZA 4F4KA 4H7BA 5G3LF 2WHEA 2XSCA 2Z8LA 2NVQB 3F1ZA 4Y2SA 4ZUJA 4Y2YA 4CNQA 4UASA 1SNMA 3MR2A 1ZJNA 4A3KG 5AM3A 1QVFA 3UDGA 3ER0A 3I91A 4IFDH 1WWUA 1RDPD 2HBKA 2PI5A 4OO1G 5DB7A 2D6FC 1N33L 1F0MA 2Q0ZX 1KKXA 4HJ9A 3BDLA 2UXDL 5KFAA 5KT3A 1I4PA 4DQSA 3HEJA 4YCUA 2R92G 4TRDA 1IZ6A 1BVSA 2NVYH 1QH9A 3EQLC 4OWXB 3VYRA 4BBSG 1K3RA 1VQAA 3ZYYX 4I27A 4NKLA 2UXCQ 2QB0B 2CKZB 5G5HA 3F5AA 2KCNA 4CJ2C 2OQ0A 4UB8U 4GKJQ 2GH1A 5EOZA 3I72A 3N6RA 3ZDBA 4DN4M 4JCVE 2E75C 4YHHQ 1XMQQ 5ALFA 3JPSA 1L2FA 4DV0Q 2YMQA 4M8AA 5JOBA 4B9SA 3KLSX 3WKDA 3SENA 2NVTB 1Q3LA 1QZHA 5KFVA 1VMCA 2M2LA 3C1EA 3RJIA 3MC1A 5AM4A 5IIIA 4YMMA 3E9IA 4XYOA 3M7NA 2F1HA 4PJ0U 2NWGA 4G7HC 2QDLA 4JI5L 2ZIUB 3TS2A 4J9LA 1ZYQA 2DGZA 1U4MA 2JMGA 3A54A 2AXTU 4YVZA 1PUZA 3RB0A 1VMPA 4XRHA 7ICIA 4P4PA 1EWIA 4UBCA 2WAQF 3PY8A 2OM6A 5ELNA 3NUQA 4F5RA 4X62L 1DXMA 4JI7L 4DR5Q 1N34Q 1K9MC 5L37A 1QLNA 5IINA 1Z4OA 4YMOA 3OSPA 1HQRD 2NRTA 4EYIB 2OXPA 2R18A 1I3QH 1KEJA 2RHQB 4DK3C 3DM3A 1SSOA 4AP9A 2C2DA 1X3GA 2XGTA 4IN3A 1L8LA 1HA5A 5IGCA 5IP7G 8ICCA 5C44B 2YB4A 5AJ3Q 5FLXE 2W9CA 1SKRA 3I4MH 1ZD4A 4I2DA 1L7PA 3PV0A 5IYDH 3N28A 2ZIXA 5KFYA 3M3YH 2VJ5A 3V6KA 4KY7A 1A2UA 3JAMc 1VQLA 5GAGC 2EYJA 2PZUA 3SK8A 5CV6A 3NASA 4KHPL 4UAZA 4M47A 1WI5A 1YEZA 2EE1A 1VQ9A 3E0FA 1W6JA 3D0FA 1KDAA 4ECUA 2I0QA 2DQNB 4CDCC 2KEYA 4QWBA 2F3NA 3SK6A 1H9MA 4HIKA 3F8TA 1MJEA 4NMZA 4DSEA 5I9PA 4BWGB 5C4JB 4DV2Q 4O0AA 4NWIA 2ZXOA 4C56C 1VQJA 2HW3A 5KG6A 8ICZA 1TS3A 3CMEA 1QJOA 1N36L 3PX0A 4B9XA 2Y9TA 2YU9B 3QO2A 1YITA 3HOZG 3N7SC 4GN5A 3FC4A 5KFOA 5KFDA 3GD7A 1U5KA 8ICYA 2E8GA 4HEDA 2UVRA 1I94Q 1HNZQ 5KT2A 5DEHA 3W1GA 2W3RA 3OYYA 4A3KH 1PFNA 1X6JA 2BDPA 2K4HA 4C4RA 5IGFA 3IRUA 2EY2A 1VQBA 3LWUA 4IUTA 4F7XA 4PMCA 1LV5A 2B2UC 1FNVA 4OX9Q 5FO9B 1G291 2WF9A 4RQ4A 4HMJA 3HOXG 2N8NA 4KLLA 4JG2A 3R9KA 1SJED 3OTOL 1XWLA 1NR2A 2JQOA 1TWGB 4BY7G 3O0FA 2HCCA 4GXKA 5J2BA 1EY6A 3CF5A 4A93G 3UDXA 4DV6Q 1TWFH 3T4AC 3QUBA 4C3IG 2EDUA 3C1YA 1JJCB 3URYA 1VQ5A 2QF7A 4C3HG 3OJUA 4JOIC 2WB1B 4YXMA 2W04A 1VJ5A 3NVWA 4K6DA 2JZBB 4R4QA 2QKIC 4RA8A 3AFPA 5J2IA 3RJJA 2JH1A 4Y7NB 2DPIA 2HD3A 1Q7YC 4HSVA 2EY6A 1L6NA 1E3PA 2VY3A 4CCHA 3QB3A 3IM1A 2JEJA 1YVCA 1PK1A 2K32A 3G7LA 2P35A 2A6EC 1JX4A 1V1OA 1EZ8A 4ZLTF 4PHAA 1PH4A 4X5VA 4DPGA 2KUMA 4L63B 2K33A 2MP1A 1C0AA 3S1RH 3T5KA 2F1JA 4NLCA 4RNMA 4XTCS 3TDQA 4APVA 2KVCA 1M8AA 2YV5A 4K14A 4L6TB 4NM1A 5EAYA 3HOVB 1BPBA 9ICLA 3QU7A 3HPOA 5E4XA 5A2QL 1YJNA 3RB3A 2R7ZH 1Q3UA 4JUZA 4P72A 2XY5A 3PIP3 2DL0A 3K5MA 4RUAA 1X55A 4QZIA 1G51A 4DL7A 1LTGD 2YMLA 5IP7H 4LF5L 4IUUA 4L5SA 1LB2B 1UQVA 3KF8A 3M4PA 1P8LA 2KZZA 1EY9A 1CK1A 2PNRC 2HIVA 1HUOA 5IT9L 1K28A 3I3CA 1LTRD 3K0XA 2J6SA 3VYSA 2A1JB 4DSKA 1SXEA 3G6VA 2HVHA 8ICNA 5M5XB 1L1OA 3ND9A 1T94A 5C3EB 3LGJA 4KITB 1GO3F 2Z0SA 4DR2L 1WCNA 2W55A 5ALDA 5CEHA 1ZQOA 1PRTD 1VCIA 1JWSD 2DY7A 3NEMA 3TSSA 3KZXA 4K0KL 1N62A 3KF6B 5J8YA 4X64L 1S0MA 4GOPA 4A3EH 5KFZA 4OL7A 3CP8A 2G9HD 1JQYD 2L15A 4CDFC 2L12A 4IALA 3X3NA 1S5LU 2N55A 5JPNC 1GM5A 1CQFA 2NZOA 2G08A 2HCFA 3M4YA 5I2YA 4UARA 2NVQH 3IHQB 5EE3A 3DM1A 4KN4C 5DG9A 3RD4A 5M5WH 1WTOA 1UEAB 1BPYA 2RQ5A 3ZD8A 4YR0A 3FHWA 2E5LQ 2FLPA 2SNMA 5LMNW 3UMGA 5C4XG 1S10A 1O7LA 1OXJA 3DDHA 1BBXC 3FM9A 2W8KA 4GLXA 1PTOD 1MIUA 2R7DA 3OW2A 3WOFA 4KLGA 2JA5B 1ZQZA 1GUOA 2G07A 3H40A 1SE4A 3PW7A 4ZCKA 1P16A 4EVOA 1N60A 1XO1A 2VUMG 2ATLA 1SYGA 1BUVT 3R2TA 3WKCA 1QVCA 5DNFA 1QCBD 1XTDA 3HOXH 3AQFA 1IBMQ 5LMUQ 4YWKA 1DK3A 2HHUA 3OSOA 5AKEA 4AYBC 1L0YB 4ALPA 4R4TA 3UE1A 3B6YA 3C2MA 1T4GA 1LTTD 3HGBA 4C3HH 4J6HA 3C2PA 1BBWA 2K5VA 1KRSA 3AFQA 4NLNA 4UAWA 1KTQA 5BOMA 2PCFB 4F72A 5A0LA 3RN5A 1FJGL 4YY3L 2BA0A 4CKBA 1HNXQ 1EFWA 1HZAA 1MN8A 2IT1A 1IL2A 1HCZA 1WUDA 3Q8RB 3JPTA 2F8KA 5KNBA 4PG3A 1VQGA 3M4OB 5FP0A 4ED2A 2BOSA 1Y1WG 2L5YA 2WAQG 4I2AA 4UB2A 1YIJA 4FFDA 3K5LA 5ALOA 2ZXIA 1IG6A 4IQWA 4CKEA 2VW9A 3UM9A 1EQVA 5FLMG 4JI0Q 3K1RB 3UXNA 1F2LA 1PTOF 4K8JA 4I2FA 2FMQA 1XPOA 2KIWA 1VQPA 1LABA 4RQNA 5C44H 4ECRA 1N48A 1ZXTA 1X66A 1T3QA 4HN7A 4DQPA 1NK4A 3QZ8A 3KYHC 1QUQA 4H02A 2MUTA 2PFOA 4DS5A 3KOJA 4YG2A 3J81i 2A19A 2QDBA 1TKWB 2TSSA 3L7ZC 1L3SA 2RF4A 4LF4Q 1X6IA 3HOUG 4V190 4ELTA 4YR3A 1YNXA 4C0ZA 4RPYA 2EZXA 7ICHA 3A7LA 1ZQFA 3T1YQ 5FO8B 1A0IA 2H4OA 4ZOHC 1F77A 1L0XB 1HPCA 5L1JA 4IUPA 3V05A 3V96A 1LKYB 3KHGA 5HHHA 1ZQVA 5IIKA 3PSTA 4DFDA 3BQ0A 4CGZA 1LTID 5C4JH 2LI6A 4FE3A 4GC7A 3U4ZA 1NJXA 3I4LA 1KAWA 4PQXA 2MU2A 2HQEA 3JAMi 2CQOA 4ED3A 4RUCA 1TS5A 4FXKC 2VA8A 4UB1A 2HBJA 4GXJA 4CDGA 1OXXK 2W9BA 3NQTA 2YU9H 3I8ZA 1JIHA 4Q8FA 1S77D 4JPBW 3RN2A 4HIDA 3EA6A 5CP2A 4QB4A 5CV5A 3H0GG 5IIFA 3T13A 1WD0A 1PH3A 1O7IA 1UNSA 1PDQA 1KFDA 2A69D 1IBKQ 4LWCA 2BCRA 4M9JA 3H3VH 3RJKA 3GP7A 3NQIA 5I6YA 5EBCA 4Y2TA 4C3JG 4FO6A 4BXXH 2MJ8A 4UW9A 5ALIA 4RGTA 3B0YA 3J81L 1CTMA 3T3FA 3TP6A 1JB7A 1YHAA 2KK0A 2N78A 5C3WA 1EL0A 2RP5A 1SKWA 1MSGA 5KFRA 2EPBA 2VB2X 3TP7A 3K7AB 3ZDAA 2BGWA 1MD2D 4PGYA 2F0GA 4B3SQ 1CRXA 2QKQA 2ZJRA 2ISPA 2MSNA 1G8ZD 1AE3A 4U68A 5B5EU 4I2BA 1ASYA 1KQQA 3EBEA 3VR5A 5JAVA 3RJHA 4QWAA 1TK0A 5J29A 3BJUA 1RQNA 2K89A 3C5FA 5KG4A 3MHBA 5K5PA 5LL6X 3OIQA 4DSIA 1LUZA 4Z6DA 4J9SA 1NZPA 5IIOA 5M5YB 2PZTA 4F91B 1A0PA 5J0WA 2MRLA 2KG5A 3NTKA 3JAML 3TKAA 2OF1A 1B4FA 1WWVA 3V6HA 2C35B 4PZ8A 1AROP 3GIJA 2LXJA 4IJHA 3ULJA 7ICQA 5AJ3L 2C9OA 1KC8C 2KHQA 4EQOA 2EAMA 4RNNA 2BR0A 4NP5A 3HOVH 4KI0A 2F3VA 4RQ2A 1KRTA 2MA1A 1FD7D 5FLMH 1SDFA 3ALRA 4AQYQ 2CN1A 4EEKA 3PR5B 2DNEA 2RLTA 3TQ1A 2SNSA 4Q5VA 4RPZA 2CVRA 5GTIU 5ALEA 1TQOA 3DEEA 5J0QA 2XI9A 1SNQA 1ZYRC 2GOLA 5CMDA 3Q23A 1EQQA 1Y1VG 3C1ZA 1JALA 4DV4Q 3W2DA 1TAQA 3R93A 1SV0A 3Q24A 3T56B 4CE6A 2L4NA 3NGDA 3E0EA 1KW4A 4DV2L 3S1MB 4DOAA 1CI4A 1IHZA 2RDGA 4QWCA 2ASDA 5DGAA 2KOLA 1EIHA 1VQ4A 5M5XH 1PHJA 3HOUH 2B29A 2B2VC 5C3EH 3CHBD 5KFNA 1S5FD 4M6WA 4X3SA 4X66Q 3FDTA 1D2BA 1FGBD 3PMFA 1A76A 1JR0D 3CRKC 1V43A 1RHPA 3D2QA 3PMNA 1HZ9A 3VDYA 3FPPA 4FP5D 1EWCA 4J8QA 4NLKA 2J7ZA 3AL0B 1HNZL 4A3DG 4QZDA 5M3FG 1X9XA 1K5OA 9ICXA 3K80C 3K4GA 1NK6A 1L1OC 1JORA 1ZD2P 1EIFA 1F2MA 2ZJPA 5J0OA 3CPWA 2XGQA 3SZ2A 2KOBA 8ICWA 1YZ7A 4QZ9A 5J8YC 2N49A 1D5ZC 5KFBA 4GOPC 2JEIA 3PNCA 4P4MA 3PGZA 4A3CH 5K36G 4F71A 5DGBA 4J15A 4B6JA 2M9VA 3H0GH 3TFSA 4B9MA 5ISRA 4DV6L 1CHPD 2HHSA 3PCOB 4KLOA 1ENAA 3RLFA 2V1CC 2JA5H 4JI4Q 3K5NA 4LF7Q 2UUCQ 4KTAA 2WIIB 4UQGA 1ZQWA 3TMEA 3OHXC 2KZ3A 4HAEA 4K4HA 1IBLQ 3I4NG 1LT6D 4C3JH 1CI3M 2KZMA 1L7MA 5ALWA 2F1MA 1RG6A 4OD0A 4TSSA 1L5UA 2ES2A 1K1SA 4HIMA 2JGAA 1OW5A 3HKZC 5JJLA 2BQ3A 5J2JA 3QXGA 2F0UA 1BQQT 4KX3A 4MFCA 1B22A 1N32Q 5JTIA 4JV0A 3IAYA 1PV4A 4J9OA 1AE2A 2CHBD 3HOYB 1TWAB 3NP8A 5DBAA 1ZQBA 5KG5A 4KLEA 5HR7A 4O42A 1H9KA 5AKHA 5F9LA 1NMFA 4DKAC 5DM73 1J8IA 4CBVA 1KDCA 9ICCA 1LT4D 4ACOA 2Z6KA 3GTMB 1UCVA 5IGEA 1Z00A 4C80A 8ICLA 4DAYA 3M4OH 4XQ8A 1J2MA 3GDEA 3H0MB 1JJ2A 3DXJC 5JRTA 2ZJQA 5E7NA 5AKGA 5AK3A 3V7LA 1S5CD 1PH9A 4DCCA 1Y8NB 1L7NA 2I1QA 1Q46A 3TZDA 5JUMA 5K4LA 4B9TA 4UAYA 2ICEC 5C0XI 3S1QB 4IOAA 3CRLC 3SEBA 4DR4Q 2IY5B 4O3SA 3F2UA 4YMNA 1PFBA 2HBLA 5BR8Q 3NVVA 4OEMB 2HHHQ 4JBMA 1SYCA 4XYQA 2RHFA 2W54A 1XSNA 4B3TL 1QVGA 1NCVA 2ZXPA 3PIPA 1M6YA 5EGTA 1CT1D 1Y1VH 2PFPA 4A3JG 1LVHA 4X65Q 4WORA 1SNPA 3OOCA 1LLRD 3J80E 4ZQ3A 4Q45A 2W7OA 2VB3X 1Q81C 4IFDG 5FJ8H 4YCXA 3PO2B 2C28A 1GUGA 3VR4A 2ZJAA 4JB3A 1VQKA 1UAPA 2KN7A 3IL8A 3OSNA 3QUCA 4JYAQ 9ICGA 3C29A 4IUVA 1M1KC 3A0HU 5CV9A 1TWCB 3OMCA 4UAIA 2Y1IA 3L9AX 4JVZA 4KHZA 2DBYA 1NK0A 3RMHA 4QJFB 4QL5A 2AUKA 1MQ3A 4JBJA 2LKYA 5L1KA 3HP3A 3CD6A 2R3ZA 4K2KA 3VR3A 1TS2A 1CFMA 2E8MA 1Y69U 3GTGH 3AYHB 2HHWA 3NBHA 4IS7A 1N8RC 8ICPA 3WU2U 1HR0Q 4TQUS 2OEOA 3GV8B 5F3XB 1Q12A 3J81j 4LFAQ 4JI1L 1ZQPA 5K36H 4YD1A 2O5IC 1NE3A 1SB3C 4GNXA 1VS0A 4F3OA 5LMUL 3T1HQ 2RHSB 5BPCA 4US9A 2IX3A 1RYUA 3SR1A 2EJFC 2WFAA 4O3MA 4DFPA 4ZRZA 2VZAA 4CDEC 4LNQA 4RQ0A 3M4QA 3EWAA 1SYEA 4FF4A 2JA7B 1RQLA 1PXUA 1ZQAA 1LM0A 5JEAG 5DKWA 1OO9B 3K7AH 2HDOA 3H8MA 2CWAA 4G4KA 4UB4A 3LWEA 1NJWA 3PX4A 1NMGA 3S9WA 4ILWA 4NB3A 1B2TA 1Z4NA 2F0WA 2HT1A 4P0QA 1BCPC 4IPCA 2OCEA 3HOWB 1II3A 2I5LX 5DDMA 4IQVA 1EU4A 4EENA 1O7YA 4LZDA 1YT3A 2NV3A 1STEA 5M5YH 3I4MG 3IFTA 2FPMA 5KFFA 9ICOA 1MKHA 5IYDG 1K8MA 2K5WA 4ZKBB 4RQMA 2ODGA 3D8GA 1EYDA 1QILA 4WFN3 4DK6C 2I5HA 4ELVA 5CGKA 2UUBL 3P7JA 4NW2A 3K58A 2R93B 3QWNA 3TREA 3KHRA 4PGQA 4IRKA 7ICKA 3KLWA 4DSLA 4ED7A 2ZTEA 4JI6Q 2PMZE 4ABNA 2PMZB 4O2DA 1A15A 3EZ5A 2F03A 3DEOA 2EQYA 2KTQA 3T1YL 4LFBL 3AM9A 3SEIA 1BNPA 3SQIA 4TUPA 4O1NA 1S0NA 5KFPA 1SLJA 2IHEA 2YTVA 4QWEA 4V0BA 2VQEQ 2F52A 3ONNA 1T5EA 1S4ZA 2YMPA 2E5SA 2BPFA 2GLEA 1PMRA 4AH6A 3BU2A 2HHXA 4A3MB 3H94A 1OUQA 1B8AA 3S1MH 4QCLA 1UT8A 1DK2A 1SE3A 2ATWA 4AYBE 3SR6A 4AYBB 5CC4A 2XIDA 4A3JH 4DGZA 3BYYB 4KLJA 4A3LH 4M04A 1EQRA 3BVZA 2LMRA 1KNAA 4Y2UA 8ICHA 8ICXA 2AU0A 1CM9A 2A74C 4M9NA 3WK9A 7ICSA 2K6AA 1QWYA 4NDXA 4HJ5A 2XO7A 3MXNB 5CORA 1SYBA 3RTVA 1B1ZA 4DXGA 1NJZA 1JROA 2YMMA 1IBKL 3CCJA 3W3AA 2EZYA 3RRHA 5HMMA 5ALTA 3U26A 2KE7A 3ISBA 4A8EA 2WB1F 2FLLA 8ICUA 1C20A 2K52A 4XQNA 4MEYA 2VQFQ 5BN5A 3AB9A 5EQ0A 3HJEA 4R64A 4QZHA 5GQOA 5JJKA 1NR4A 4IPHA 4MTNA 1ZQRA 3AQEA 1S0VA 3RR7A 5GADC 1EWHA 2UUAQ 2Q2IA 3BZDB 3IV6A 4BA2I 3GTQH 3H0RB 1KD1C 1DM0B 2ZUBA 1DRGA 1HXYD 4LF6L 1O08A 4DFMA 2F0MA 2K01A 3DHQA 1IYJB 1FL0A 1S5ED 1BOSA 4PGXA 5KGUA 4EYHB 2O6KA 5AK6A 1S5DD 2WF7A 3PX6A 2OEHA 1NUCA 1DOQA 1ICWA 1LTLA 3J81c 2ZIVB 3MAQA 2M0NA 5J39A 5JEAH 2A6HD 4R63A 2W9CB 3ICEA 1STBA 4OJLA 4DSJA 4NPSA 1WCMG 4RFBA 2CH4W 1U45A 2R7ZG 3HOYH 3CCQA 4EX6A 1TWAH 2K50A 2ZIXB 1OXTA 1X9NA 4USAA 2Y0SG 2HBMA 2A5HA 2R6GA 3NHHA 1VQ6A 1IKMA 2AQ2B 2JA9A 2HUGA 3PO3G 3HG9A 1ILQA 4YCVA 2EAPA 2HSZA 4EBEA 5AIAA 3ND8A 1RL2A 3JPPA 4R65A 1ZQQA 4TURA 2KEDA 1C7YA 3SAFA 4KHVA 4NXZA 9ICEA 3CCRA 1E1OA 4PZNA 1GUNA 2BDNA 3RR5A 4IFDI 2NO4A 4GKKQ 5ALPA 4OONA 3L3FX 2Z6KC 4P71A 2W3SA 1Z6HA 3E0JA 3S1QH 2WACA 2PFQA 1ENFA 3EVQA 1R9TB 2MO0A 4BBRB 4HYKA 4A3EG 5EPJA 2DJFC 3NSWA 1PH6A 1J5EQ 2BPGA 4LF8Q 3NRZA 2EVBA 2FFKB 3TRZA 4PZ6A 4CGYB 5L9XA 5J3BA 4LZGA 1HUZA 4DR6Q 5CRXA 3Q8SB 1K8AC 1KQSA 2VS1A 5LMNL 2AWNA 5C3XA 1EYCA 3WKAA 4BY1B 4L5RC 1KXLA 4C8KA 2ID0A 2NYZD 5I9OA 2B2YA 3RJFA 3Q0AA 3I7FA 3DUZA 8ICRA 4DFKA 2EOTA 3MFGA 4YIJA 2VXWA 2ZXRA 4P74A 3GIMA 1AW7A 1STGA 2B8FA 4RQ3A 5KEEA 4JV5Q 3S1NB 1ZQEA 2E8OA 9ICBA 1C8CA 4NXNQ 1G6ZA 4FS1A 8ICJA 2MFIA 3IKJA 4C1NK 3UDFA 1ZQJA 3KHHA 1QQ6A 1QG7A 4DR1Q 1ZQTA 1VQ7A 3KFUA 3NPPA 1TR5A 4O5KA 1Y14B 4FZMA 4RT2A 2PI2A 3SXHA 4QZAA 5T1IA 3B0XA 1B44D 2K5NA 3OTQA 4LF9Q 8ICGA 3H15A 3RZOB 4Y52H 2OTLA 2A68C 4EX7A 4IURA 3PUVA 2PPBC 2M00A 5J0TA 4MZ9A 1FVIA 2DUYA 5J2HA 1M90C 4JI4L 1DGJA 2UUCL 2DKXA 3M9NB 4BGDA 1I4QA 2Q8TA 4DR3Q 1PK1B 3ZD9A 3K5OA 1BR9A 1PFSA 1VQDA 5ALUA 4ECQA 4LF7L 2AJQA 4RG1A 3LWMA 2X69A 2ZM6Q 5EKLA 5C4XB 1IXRA 2LBOA 3KZIU 2LYBA 3ERQA 3PMLA 2H3QA 3TI0A 2Q8RE 3JPNA 2E2DC 4IO9A 4LFCQ 4DSFA 1QSLA 1NTGA 2IMWP 5J0SA 4UB3A 1BGXT 1BPEA 1I50B 4UP7A 1GJXA 2H3ZA 3BS5B 3TAPA 1YNJD 2OQKA 1VQ8A 3CC7A 3DMUA 4GIBA 5D4BA 1CSPA 4LUZA 4A3BB 1FGUA 4XQJA 4DR7L 1MSWD 2PKEA 1RJTA 2JA6B 1TAMA 4M9HA 2D2CC 2XY6A 4X6AH 2HOQA 1WTXA 1HTPA 1UE7A 1BCPD 3KF8B 1J97A 2NRWA 5I6WA 2KNJA 3KBBA 1RYRA 5C44G 4QW9A 2DY8A 3HOWH 1D9DA 2ASBA 2RDFA 1LT5D 5HR6A 1WCMH 2ENBA 1K1QA 5FKAC 2IX1A 1DOKA 5TZVA 1SYFA 4RHSA 1N5XA 2KCMA 4A3IB 4C7YA 1GUSA 1L1OB 1EUJA 4N8FA 1PVPA 4HJ7A 4A3FB 1RIPA 1X3PA 1EIYB 4PPXA 3PO3H 4DR4L 2W7PA 2KHIA 5D49A 5KYLA 2FDRA 4I2JA 2HHHL 1G91A 2F77X 4GOPB 4NLBA 3IFDA 1QQ7A 7ICMA 5KFHA 4ED1A 3H8SA 2WAQE 1OXVA 1SGGA 4K8IA
chains in the Genus database with same CATH topology
1VQMA 2MQHA 1JB7A 1B7YB 4LW1A 4LF5Q 4OO1I 3A74A 4JI8L 1YHAA 4X65L 2QEXA 2N78A 2KBNA 3GTLH 4DNIA 2YTXA 1Z9FA 4JBWA 4B3SQ 3U4VA 3CP0A 2ZJRA 4R4OA 3KDFA 1AE3A 3HOWG 2JEBI 4DV3Q 4UPAA 5JEAJ 4JYAL 2WP8J 1ASYA 3G4SA 4A3MH 3HKZE 4GNXB 3U58A 3BJUA 3S16H 3UDIA 1Q1BA 4A4IA 2R93H 1LUZA 1EYGA 2LSSA 2VNUD 5IT9c 3ZJYC 4IJLA 1K73C 4UY8C 1OXUA 4QIWE 3GTMH 1HZBA 4A75A 3BZKA 3I2ZA 4AQYL 2R93G 2D0PA 2C35B 4PZ8A 4IJHA 2LXJA 3CCVA 3ULJA 1JMCA 3CAMA 5GROA 1SN8A 3PUXA 5AJ3L 1KC8C 4BXXG 1CKNA 4R4CA 3S17H 3HOVH 3PF4A 3MEFA 4LFAL 4DV4L 4KI0A 4A3DH 5M3FH 2UXBQ 1KRTA 4LF8L 1XNQQ 3I55A 3T1HL 5FLMH 4AQYQ 1GVPA 1A8VA 3KF6A 2WB1G 1TWHH 3CMAA 1XMOQ 1KL9A 3CC2A 1SFOH 3L2PA 2JEAI 2NVTH 1EQQA 1Y1VG 4X66L 2F3IA 2CWPA 4A3MG 1X3EA 4DV4Q 1JJGA 1E1TA 3K81C 4YWLA 4AYBG 4PZ7A 4DUYL 1VQCA 3E0EA 4DV1L 4DV2L 1VQ4A 5M5XH 1PHJA 2PI2E 3K7UC 3HOUH 3PO2H 2B29A 2MO1A 2AKWB 3HFZB 5C3EH 3F2CA 3PUWA 4DUZL 4X66Q 3FP9A 4UP8A 1V43A 2D0OA 3GTJH 4NXMQ 3I4NH 3STBD 4DV7Q 1HZ9A 4DUYQ 3VDYA 4JI6L 4JI3Q 3HOVG 3G6EA 1TWCH 4L5TA 4DV1Q 1HNZL 4A3DG 5M3FG 3S2DH 1QUQB 3K80C 1NY4A 5C0XJ 3KJOA 1L1OC 1SE8A 1N9WA 3GTPH 5IWAQ 3S24A 1EIFA 3J7ZC 2ZJPA 1VQFA 1W2BA 2UU9L 3TS0A 3CPWA 2K14A 1X3FA 4B3RL 4JI6Q 1YZ7A 2N49A 4GOPC 3PGZA 1HNWL 3Q8DA 2BH2A 4A3CH 1IBLL 5K36G 3S2HH 1E7ZA 4JI2Q 3CCUA 4J15A 2QA4A 1UE6A 3H0GH 2E2HH 4GLAC 4DV6L 4B3MQ 2HQLA 3PO2G 3CCEA 1XNRL 3PCOB 1DGSA 1L0WA 3EN2A 2V1CC 3RLFA 5C3EG 2JA5H 3HKSA 4JI4Q 4B3RQ 1N32L 4LF7Q 2UUCQ 2R92H 3A0JA 1HNWQ 5JJIA 3I4NG 1IBLQ 4BBSH 4C3JH 2JA7H 3K8AA 4GN3B 4RMFA 3GTKH 1YHBA 4GN4B 1PH7A 2ES2A 1KHIA 1T9HA 5HY6A 2Q2UA 2FXQA 4HIMA 4GNXC 4OWWB 5JJLA 3AEVA 1U0LA 2PQAA 2WB1E 1AH9A 1PH1A 1EOVA 3EBEA 2Q2HA 1Q86C 4BY1H 1N32Q 1PV4A 1AE2A 3D31A 3TEHB 4WJ4A 3RNUA 1NMFA 4A3CG 3F1ZA 4DKAC 4A76A 1SRUA 4A3KG 2UXCL 2Z6KA 3M9BA 3GO5A 1QVFA 3UDGA 3ER0A 3S1NH 4GKJL 3CC4A 2YTYA 3M4OH 4OO1G 3GDEA 5H1SE 1YI2A 1N33L 1VQHA 4HJ9A 2JA5G 4QY7A 1JJ2A 1WOCA 5BR8L 4YHHL 3L0OA 1XMQL 2ZJQA 4DV0L 4YCUA 2R92G 5E7NA 1IZ6A 1PH5A 1BVSA 2NVYH 4OWXB 4BBSG 1K3RA 1VQAA 2B3GA 4BBRG 1PH9A 4EQ5A 1Q46A 2UXCQ 4BA1I 2CKZB 3RZOH 4QGUA 2OQ0A 5GAEC 4GKJQ 5C0XI 4IOAA 2KENA 1TWGH 4DR4Q 2IY5B 3CCLA 1SROA 1N33Q 4JCVE 1HR0W 5BR8Q 4YHHQ 1XMQQ 2HHHQ 4DV0Q 1L2FA 3PSIA 4BY1G 4JBMA 4K0KL 4IPGA 3DLLA 1K0RA 4B3TL 1VQNA 1QVGA 2K75A 3PIPA 1QZHA 1Y1VH 1OXSC 4JC0A 4JI8Q 4X65Q 4Y7NH 4A3JG 3E9IA 3M7NA 1BBUA 1CKNB 4JI5L 3TS2A 4DR5L 1Q81C 5FJ8H 1N34L 4IFDG 1I50H 3U50C 3J80c 1WJJA 1VQKA 4C2MH 3G48A 4B3TQ 3A5ZB 4A3BH 4JYAQ 1EWIA 3PUZA 3STBC 2AMCB 2JA6H 1GD7A 1M1KC 4DAMA 4IOCA 1HR0L 5ELNA 4X62L 4JI7L 4KHZA 4DR5Q 1N34Q 1K9MC 2A8VA 3PF5A 1CKOA 4QL5A 2RHQB 1I3QH 4DK3C 4JBJA 3DM3A 1X3GA 2XGTA 3CD6A 4A3IH 4GKKL 5IP7G 3HOZH 3GTGH 3AYHB 5AJ3Q 4A3FH 1N8RC 1HR0Q 3I4MH 4TQUS 1CUKA 3J81j 1Q12A 2BH8A 3PV0A 4LFAQ 4JI1L 5FLXc 2MNAA 5IYDH 1A63A 3M3YH 1NE3A 4GNXA 1VS0A 3JAMc 3T1HQ 5LMUL 5GAGC 1YJWA 1S40A 5FJ8G 1J5EL 2RHSB 4KHPL 1S72A 1WI5A 1YEZA 1V9PA 2VZAA 1VQ9A 4LNQA 3D0FA 2NVXH 4A3BG 3M4QA 2JA6G 2HIXA 2I0QA 4DV5L 1WFQA 1LM0A 4P75A 4JI1Q 5JEAG 4HIKA 3K7AH 3F8TA 3F2DA 1MJEA 2CWAA 2AHOB 1PYSB 1SMXA 4DV2Q 1I94L 4BY7H 3TQYA 1ASZA 4KHPQ 4O0AA 2OTJA 1NMGA 4A93H 1X54A 1KIXA 1VQJA 4NB3A 4C3IH 2HT1A 4MNOA 3CMEA 4IPCA 2OCEA 1N36L 4A3IG 4DUZQ 2N3SA 1YITA 2I5LX 3SGIA 4DR1L 2ALYB 1E24A 3HOZG 4GN5A 4A3FG 3I4MG 1JT8A 5M5YH 4OX9L 3GD7A 1U5KA 2E8GA 1I94Q 1HNZQ 3W1GA 1MKHA 5IYDG 1LYLA 2B63H 3OYYA 4A3KH 4YCWA 4DK6C 2RCNA 2I5HA 1CKMA 1VQBA 2UUBL 2F4VL 2NN6G 2UU9Q 1UE1A 3TREA 2PQAB 3KLWA 4OX9Q 2VQEL 1H95A 1G291 1OTCA 2ZM6L 1C9OA 2ZTEA 4GLVB 3I56A 1R9TH 3HOXG 3JC66 2N8NA 4JG2A 4BBRH 4IFDI 2PMZE 3OTOL 2JQOA 4BY7G 4O2DA 3CF5A 3E9HA 4A93G 3UDXA 4DV6Q 2DUDA 1TWFH 3T1YL 2UUBQ 4LFBL 3RLOA 3RZDH 1XNRQ 1JJCB 1MJCA 3KJPA 1VQ5A 2JA8H 2YTVA 1SLJA 2I5MX 2IHEA 4JOIC 2VQEQ 3HKZG 2F52A 4R4QA 4DAYB 3AFPA 4HJAA 4AH6A 3BU2A 1J6QA 3S1MH 5IE8A 1B8AA 1GKHA 1Q7YC 4AYBE 2ATWA 4R4IA 4A3GH 5IP9G 1E3PA 2VY3A 4A3JH 2B63G 1X6OA 1YVCA 4LFBQ 2GN5A 2NZHA 1PA6A 1PH2A 4A3LH 5IYBG 1EQRA 1NBWA 3AQQA 5C0XG 1PH4A 4IFDJ 4WJ3M 2VQFL 3WWVA 1D7QA 1GO3E 4DPGA 1S3OA 1C0AA 4EX5A 3S1RH 4HJ5A 3MXNB 3KDFB 2JE6I 4XTCS 4KLKA 4APVA 2YV5A 5EAYA 2DGYA 2UUAL 3G71A 1A62A 3ULLA 1IBKL 3CCJA 5IY0A 1YJNA 2R7ZH 4POGA 3S15H 2K52A 4P72A 1UEBA 2JA8G 2VQFQ 2UXDQ 5DLQE 1X55A 1G51A 5IP7H 5GQOA 5JJKA 2LXKA 2A1AA 4LUVA 4L5SA 4LF5L 3M4PA 4IPHA 4MTNA 1P8LA 5C4XH 5GADC 2UUAQ 2ZTDA 2Q2IA 1Z47A 2HIVA 3M85A 4ME3A 4BA2I 3GTQH 4A3GG 3K0XA 1KD1C 4HIOA 1I6HH 4LF6L 4JV5L 2ZTCA 4DV3L 4A3LG 2UXDL 1L1OA 1G6PA 2IX0A 1IYJB 3LGJA 1FL0A 2Z0SA 4DR2L 4LUOA 3NEMA 1VCIA 5IYCG 2XTIA 2E5LL 1I5FA 1LTLA 2EIFA 2JJQA 3KF6B 4X64L 3J81c 4GOPA 4A3EH 2VUMH 3NBHB 2D62A 4LF6Q 3ICEA 4JI5Q 2L15A 1V1QA 1WCMG 4NPSA 3NENA 2R7ZG 3HOYH 3CCQA 1TWAH 2K50A 4TVAB 1GM5A 2NZOA 1OXTA 2GVBA 3ERSX 3W1BA 4DR2Q 1X9NA 2NVQH 4QQBX 5M5WH 2Y0SG 2R6GA 1VQ6A 1VQIA 3FHWA 3I4OA 2E5LQ 2JA9A 4K0KQ 4X64Q 3PO3G 4P73A 4YCVA 3NELA 5LMNW 2UXBL 5C4XG 1XNQL 4X62Q 4JI7Q 1RL2A 1Q1EA 3S14H 1IBML 1XMOL 4FDBA 4HJ8A 4GLXA 1C7YA 1D8LA 3CCRA 1E1OA 1SR3A 1MIUA 2R7DA 3RR5A 3OW2A 1YJ9A 1Y1WH 1YBYA 4DR6L 4JOIA 4GKKQ 4OONA 3EIVA 2Z6KC 4P71A 1P16A 3H3VI 3S1QH 5ELOA 2VUMG 2MO0A 4A3EG 3GTOH 3UE0A 1K83H 2JK8A 1IBMQ 2EQSA 1QVCA 3HOXH 3F2BA 1HNXL 1XTDA 1PH6A 1J5EQ 4LF8Q 5LMUQ 4YWKA 3TRZA 4PZ6A 1K8GA 3HOYG 5J3BA 1QZGA 4ALPA 4DR6Q 1K8AC 2KCTA 4R4TA 1HZCA 1TXYA 2VS1A 1KQSA 4NXNL 3UE1A 3B6YA 2AWNA 4OWTB 4QJFA 5LMNL 1VQEA 4NXML 4DV7L 4C3HH 4L5RC 4Y52H 3CXCA 1KXLA 1BBWA 2ID0A 2K5VA 1KRSA 3AFQA 4JI3L 3RN5A 3I7FA 4DV5Q 1FJGL 1W3SA 4YY3L 2BA0A 3IRBA 1HNXQ 3W5OA 1EFWA 1HZAA 4JI0L 2IT1A 2VL6A 4PMWA 1IL2A 4P74A 5IWAL 5IP9H 1CSQA 4LF9L 4JV5Q 4YWMA 4NXNQ 5LMNQ 4PG3A 1VQGA 2MFIA 3UDFA 1Y1WG 1PH8A 1N36Q 5IYBH 3CQZH 2WAQG 3A5UA 4DR1Q 1YIJA 4DR3L 1BKBA 1B70B 1XPRA 1FJGQ 2AWOA 4YY3Q 1VQ7A 2VW9A 3KFUA 4JI2L 1Y14B 2PNHA 5FLMG 4JI0Q 2PI2A 1Q82C 4XIGS 2E2IH 2K5NA 4L5QA 1XPOA 3FKIH 3H15A 1VQPA 4B3ML 2OTLA 4LF4L 4LF9Q 2R7FA 1Q8KA 5C44H 5M3MH 3PUVA 4MZ9A 1M90C 3J80i 1FVIA 4LFCL 1HJPA 4JI4L 4LF7L 2UUCL 4OXPA 2Y0SE 2KHJA 1UE5A 4GS3A 3KYHC 4DR3Q 2F4VQ 1PYBA 1PFSA 1QUQA 1VQDA 2YYZA 4H02A 2K4KA 4RG1A 3CCMA 1XJVA 3KOJA 3J81i 2ZM6Q 3J7A5 2A19A 1IXRA 1UWVA 3L7ZC 4UP9A 2RF4A 4LF4Q 3HOUG