2A1AA

Pkr kinase domain-eif2alpha complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
161
Chain Sequence
SHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
total genus 47
structure length 161
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a1aA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a1aA01
3CCMA 1ASYA 2HHHL 4X6AH 1PFSA 2HQLA 4IPGA 1WYDA 1QZHA 4L5QA 1HZAA 2N8NA 1L1OC 2YTXA 1Q8KA 3KF6B 2ASBA 2A19A 3JAMc 1BBWA 1U0LA 3NBHB 3M85A 4NXMQ 1Q12A 1UE7A 2QGQA 4LFCL 4IJHA 1EWIA 1PH5A 2MO1A 4R1JA 1Q81C 1HZBA 4IPCA 5C4JH 4O2DA 2E2JH 4Y52H 4JG2A 3W1BA 1LYLA 2VQFL 2FXQA 1EYGA 5GROA 4BXXH 1HH2P 1PYBA 3G6EA 1RIPA 1SE8A 4R4TA 1IBKL 1WCMG 2D0OA 4GN4B 3PUZA 1VQGA 2LXJA 2R7ZG 4WJ4A 3CCRA 1AE2A 1D8LA 3CQZH 4IPHA 4OONA 3GTOH 4YCVA 2RCNA 1IBLL 1PV4A 5IWAQ 5JEAJ 4IO9A 1JJ2A 1I94L 3GTMH 1G291 1YEZA 2LSSA 5FLMG 3I55A 2JA8G 2PQAA 4B3RL 1Q82C 3BU2A 2UUCQ 3F2DA 4HJAA 1HR0W 2HIVA 4A76A 4K0KL 2ALYB 3DM3A 2K4KA 4LF7L 5FJ8H 1VQIA 2BH2A 1PH8A 4LF6L 2N78A 3KF6A 5M3MG 1YHBA 3S17H 3PSIA 1MJCA 1K83H 2R7DA 1LM0A 4DV2L 4KHPQ 4GKKL 3AFQA 1EIFA 1CKNA 3UDIA 1VQMA 2A1AA 1TWFH 1X6OA 2Z6KC 5C4XG 4DV1Q 1C7YA 1A63A 4PZ7A 2HT1A 4AYBG 1JMCA 3L7ZC 3FP9A 1VQJA 1UE1A 3OYYA 5FLMH 2E5LL 3I4OA 2JA8H 4DR4Q 1I6HH 1J5EQ 4DV3L 1PH7A 3VDYA 4JI2L 1K8AC 2R92H 3W5OA 2VQEQ 5BR8L 3M7NA 2RHSB 4JOIA 1YZ7A 4JI0L 3MEFA 4LFAQ 4LF6Q 1FJGL 4BA2I 4K0KQ 1H95A 1IYJB 5GADC 4JI4Q 4KI0A 2XTIA 3ULLA 3T1HL 1PVOA 2IT1A 4DV4Q 4OO1I 1JJCB 4JV5L 3RR5A 2JK8A 1YHQA 1NTGA 2YTVA 1W2BA 5IYBG 3J81c 4UPAA 1I94Q 1I50H 2JA7H 3GTKH 1E24A 4JC0A 3CC4A 1M90C 4X62L 2CQOA 4KHZA 2K5HA 3TREA 5IWAL 2OTLA 2UUAQ 1JT8A 1OXVA 5IYBH 1N33Q 3PO3H 1K8GA 4IFDG 2WB1E 2VZAA 3CCLA 3J81i 3F1ZA 2NVTH 2Z0SA 3A74A 4C2MH 1YHAA 2BH8A 4UY8C 4AIMA 3CF5A 3J7ZC 3KYHC 4A4IA 2VNUD 1KD1C 1PH9A 1W3SA 3A5UA 5IYDG 3Q8DA 1EUJA 4OX9L 4GKJL 1A8VA 4DAMA 4YCUA 4A3EG 3ZJYC 3S1RH 4JI5L 4LFCQ 4BY7H 1Y1VH 2PI2A 4UP7A 4JOIC 4X66L 2VW9A 1IL2A 3L0OA 3D0FA 3CAMA 5E7NA 4HJ8A 3IRBA 5IE8A 2ATWA 1Z47A 1SROA 1TWGH 1I3QH 2QEXA 4A3DH 1L1OA 1VQ9A 4LF9L 3S16H 2N49A 1B70B 1C9OA 3K7UC 2OCEA 3CPWA 3J7A5 1CKMA 1XPRA 1GKHA 3KDFB 2K14A 2IX1A 4PZ8A 1YJWA 1OXSC 1NMFA 1TWCH 2NN6I 2CWAA 3RLOA 5AJ3Q 3HOYH 1SN8A 2JA7G 5IP7G 3U4ZA 4DR1L 1WCMH 1CKOA 4DR5L 1Y1VG 4XTCS 5JJLA 2UU9L 4GLAC 3H3VI 1SMXA 2KHJA 4JYAL 4YWMA 5BR8Q 4BBSG 2WB1G 3PIOA 4JI7L 1RL2A 5LMNL 5DLQE 2K50A 2HIXA 2WFWA 2ZM6L 2E8GA 3ULJA 3M9BA 4DNIA 2IY5B 3W1GA 3S1MH 4A3BH 4GN5A 3CC2A 1PH4A 2YTYA 1PA6A 4YHHL 1VQ5A 4OWTB 1J5EL 3F2BA 1X56A 4GS3A 1G51A 3STBD 1FL0A 2E5LQ 1KQSA 1QVGA 4DR1Q 1VQPA 3HOVH 2R92G 2WAQE 3NEMA 1AE3A 1IZ6A 2VL6A 2GVBA 3J80i 2NVXH 2YV5A 2V1CC 4AH6A 4DV0L 1VQ6A 4BBRH 4OXPA 1QZGA 3OTOQ 4IFDI 3AFPA 2UXDQ 3I4NH 4QQBX 1X3EA 1G6PA 3KDFA 4BY7G 3HOVG 2QA4A 4AYBE 3U58A 3H0GH 3EIVA 1N32L 2JA9A 4A3MH 1V9PA 2E2IH 1Q1EA 2CFMA 1XNRL 2UUBL 2B29A 2D0PA 2AHOB 1X3GA 4R4OA 4JI1Q 4QY7A 3M4QA 1EQRA 1VQHA 4QIWE 4TVAB 4GNXA 1MIUA 2ZTDA 4DR2L 1YI2A 2UUCL 4B3TQ 2Y0SE 4POGA 3GTQH 4JYAQ 4UP9A 3G48A 4OO1G 1CKNB 5FLXc 3CCQA 4PG3A 1SFOH 3I4MG 4QGUA 4NB3A 2HHHQ 1BVSA 4AQYL 2OTJA 2RHQB 5K36G 3H0GG 4FDBA 1O7IA 4DV7L 1YJNA 2EIFA 3PUVA 4NXML 2K5NA 4LF5Q 2R6GA 1EQQA 4BBRG 3HOZH 2RF4A 1N33L 1L0WA 1HR0L 1KHIA 3ULPA 1PH6A 1D7QA 5GQOA 3F8TA 2EQSA 1L2FA 5GAHC 3CXCA 3HKZE 1KC8C 1VS0A 1PH3A 4C3JH 2DGYA 3RNUA 1XNQQ 2UXBQ 3PUXA 1VQCA 4DV7Q 3A0JA 1TXYA 3HKZG 2PMZE 1V43A 4A3BG 1PH1A 3NENA 4B3MQ 3J80c 4A3CH 4DR7Q 4NXNQ 2KBNA 4GN3B 5C0XG 4JI3L 3EN2A 5C44H 1KAWA 1M1KC 4JBWA 3STBC 1YZ6A 4GNXB 1FGUA 1HZ9A 3UE1A 2OQ0A 5M5YH 4B3TL 1YNXA 2KCTA 4A3CG 2VQEL 1T9HA 1HNWL 1LTLA 5LMUL 4L5RC 4LWCA 3I4NG 1FVIA 4O0AA 3J81j 2AWOA 4R4CA 4TQUS 2Q2UA 1YBYA 3KFUA 1EOVA 1Y14B 3H3VH 3I4MH 4LFBQ 1YITA 4A3KG 5IY0A 4GKKQ 1S3OA 4R4QA 4LFBL 1BKBA 1J6QA 2Q2IA 4XIGS 1Z9FA 5H1SE 4POFA 1EFWA 2JA6G 5C0XJ 4DR6Q 2E2HH 4JV5Q 2A8VA 4DR2Q 3M3YH 4BBSH 4B3SL 1Y1WG 3S14H 1WJJA 4HIDA 1VQAA 3I56A 4P72A 3GTJH 3M4OH 1IXRA 5C0XI 2DUDA 3PCOB 2Q2TA 2BA0A 3F2CA 4HIMA 4JI0Q 1GD7A 4B3RQ 3CW2C 1L1OB 4JI2Q 3DLLA 1E1TA 1B7YB 2NZOA 3RLNA 1HNZQ 2UXDL 1JJGA 4P73A 3PGZA 2MQHA 4B3ML 5M3MH 2VUMH 1NMGA 3K8AA 1KRSA 3TS0A 4A3DG 2ZJQA 3K80C 4H02A 4A3LH 3OW2A 2LXKA 4B3SQ 1YIJA 2ID0A 1UE6A 5IT9c 1X55A 3KJOA 2NVYH 3HOXH 4LF9Q 4A3IG 2JEAI 1QVFA 3HOUH 4DV5L 1N34L 3S2HH 3NELA 3E9HA 4A3MG 1KRTA 2ZTEA 5EAYA 1SR3A 1I5FA 4DR5Q 3S1QH 4ME3A 4DK3C 1KL9A 2GN5A 3HOXG 1HNXL 1V1QA 1AH9A 3H15A 4A93G 1OXXK 1CUKA 3PUWA 4PZ6A 3UDXA 5IP9G 5M5WH 1GO3E 3GD7A 4PMWA 4X64Q 2AMCB 3CC7A 5LMNQ 1CSPA 5LMUQ 2EXDA 3T1YL 1PHJA 4IFDJ 4LUOA 5ELOA 2NZHA 1YVCA 3AQQA 5GAEC 1N36L 2KCMA 4P75A 4YWLA 1TWHH 1QUQB 2K5VA 4X66Q 1VQ4A 4GOPA 3PF5A 4LF8Q 3LGJA 3CMEA 4LNQA 1NBWA 3B6YA 3KJPA 2F3IA 2VQFQ 5M3FH 3T1YQ 3D31A 4IPDA 3GTLH 2IHFA 1OXUA 1HZCA 3CPFA 1VQFA 3PIPA 1N32Q 4EQ5A 4AQYQ 1EIYB 4JI6L 4LUVA 1XJVA 3UDFA 5JEAG 3E0EA 4X65L 2ES2A 3I2ZA 4YWKA 1OTCA 5HGQA 5C44G 2ZJPA 1VQEA 1GVPA 2GVAA 4A75A 1WFQA 5IYDH 4DUZL 3CCUA 4A3GG 2Q2HA 2MFIA 2UUBQ 2C35B 3K7AH 2UXCL 2JE6I 4LUZA 4YHHQ 4BY1H 4L5SA 2OQKA 2PI2E 4NPSA 5C3EG 4DV3Q 4JBMA 1ASZA 2VS1A 1U5KA 4ALPA 4DV0Q 3OTOL 3FKIG 1HNZL 2JA5H 1VCIA 1E22A 3KF8B 3U50C 1JB7A 1Q1BA 1UE5A 4JCVE 2ZJRA 4DV4L 4BY1G 1XMQL 1IBMQ 2OWOA 3RLFA 1VQ8A 4JI4L 2KHIA 2Z6KA 2XGTA 2CWPA 4DV1L 4A3JG 4RG1A 4A3GH 1XNRQ 1HNWQ 3GTGH 5LMNW 2B3GA 4MTNA 4GOPB 3S15H 4P71A 2NN6G 1OXTA 4BA1I 4A93H 3CCJA 2I0QA 1P16A 3M4PA 1VQDA 1B8AA 3K0XA 4HIOA 4GOPC 1YJ9A 4YCWA 5IP7H 1XMOL 2UU9Q 2K75A 3TQYA 3S1NH 2H5XA 1X9NA 4RMFA 4DKAC 2F4VQ 2L15A 3GTPH 2Y0SG 5JJKA 3FKIH 2JA5G 3RN2A 3BZKA 5M5XH 1TWAH 4DAYB 5M3FG 1X3FA 1XNQL 3AEVA 1Q7YC 4KHPL 1A62A 1UEBA 4YY3Q 1IBLQ 3HKSA 4DPGA 2F52A 3JC66 4DK6C 4X65Q 1K73C 4HIKA 5ELNA 4DR4L 3AYHB 3GDEA 3I7FA 1VQOA 3KLWA 4OWWB 3HOUG 1XTDA 3MXNB 4A3IH 4LF5L 2JQOA 3ICEA 2AKWB 3FHWA 1VQLA 2JJQA 2IHEA 2WP8J 3HFZB 2CCZA 3UE0A 2R7ZH 3PO2G 2UXBL 1E1OA 4KLKA 3L2PA 2MO0A 5IP9H 3JAMi 4LW1A 4C3HH 1C0AA 3CCSA 4JI6Q 3G4SA 4IJLA 4A3KH 4JI3Q 4NXNL 3K81C 1IBKQ 2YU9H 3WWVA 5AJ3L 3EBEA 2JA6H 3HOYG 3CD6A 4DV5Q 4HJ9A 1N34Q 3TS2A 4JI5Q 3PO3G 4QL5A 4JI1L 1Y1WH 3KOJA 1K3RA 4L5TA 4DR3L 4A3LG 1E7ZA 3HOWH 1S72A 1PYSB 2UUAL 4LF8L 4X64L 3G71A 2I5LX 1HR0Q 1HNXQ 3PO2H 4DR3Q 3BZCA 5IYCH 1N36Q 1KIXA 3GO5A 4A3FG 1Q86C 3S24A 2B63H 1K0RA 2AWNA 1DGSA 2PNHA 4GLXA 2N3SA 3RZDH 4EX5A 4A3EH 3ER0A 1WOCA 2R93G 4OX9Q 4DUYL 1BBUA 1X54A 5FJ8G 4Y7NH 1JE5A 4QJFA 3CCVA 1VQBA 2F4VL 3BJUA 1HJPA 1E3PA 2CKZB 4J15A 1X65A 4JI8Q 3SGIA 4X62Q 4DV6Q 2I5HA 1NE3A 1SRUA 2MNAA 1XMOQ 1N9WA 1S40A 1GM5A 4IOCA 4JBKA 3HOZG 3CMAA 1Q46A 1NY4A 2BA1A 3T1HQ 5C4XH 1QUQA 2IX0A 1N8RC 1LUZA 1KXLA 4JI7Q 4P74A 4HJ7A 4LFAL 1XMQQ 4DV2Q 1R9TH 2YYZA 1XPUA 5JJIA 4YY3L 5J3BA 3PV0A 4C3IH 4DR6L 2VUMG 2R93H 4LF4Q 3PF4A 3S2DH 4BXXG 3TEHB 1VQNA 2B63G 4R4IA 2UXCQ 3CCEA 1CSQA 1A0IA 2JEBI 1PH2A 3A5ZB 1NJIC 5HY6A 1WI5A 3ERSX 4UP8A 4DUZQ 2ZTCA 4A3JH 1VQ7A 4OWXB 4HJ5A 1QVCA 4MZ9A 1FJGQ 1MJEA 3UDGA 3HOWG 1P8LA 2KENA 1XPOA 3PUYA 4LF7Q 5GAGC 1UWVA 3RN5A 4DUYQ 5C3EH 2K52A 2I5MX 3CP0A 1IBML 2ZM6Q 4A3FH 3U4VA 4DR7L 2R7FA 2WAQG 4GLVB 2VY3A 3TRZA 2NVQH 1MKHA 4GNXC 4MNOA 3RZOH 4APVA 4WJ3M 4JI8L 1SLJA 4GKJQ 1VQKA 4DV6L 4LF4L 4JBJA 5IYCG 2D62A 3E9IA 4IOAA 2PQAB 1K9MC
chains in the Genus database with same CATH superfamily
1NKBA 4KHVA 2XY5A 3CCMA 5CR0A 4DSEA 3HOUB 3T5KA 1HUZA 5KFVA 1JWMD 1LACA 1T5XD 3HOXB 2IMWP 3BJYA 4CKCA 4OJ6A 2W9AA 2JEGA 4IS7A 2NRVA 1FR3A 2HOFA 3NBHB 5C0XH 5ALQA 4DFAA 2PFPA 2K5QA 3V96A 3M85A 1Q12A 2VUMB 2QGQA 4ECTA 5DG7A 1ASZA 2E2JH 2EYLA 2JH7A 5ALXA 2FINB 2ZUBA 3IN5A 1ZQZA 5CBAE 2W11A 2QKIC 5J0XA 2B2VC 1PK1A 1HH2P 1PYBA 3M4OB 2PFNA 4P0QB 3W2DA 1FFVA 9ICNA 4LK1C 1N62A 3QJYA 1SE8A 1IBKL 5AFWA 8ICMA 1DXSA 1Q3VA 1PLFA 2EYFA 3ALRA 3PUZA 4HTHA 3IG5A 2EJGC 1VQGA 7ICGA 3P1HA 4WJ4A 4QZIA 4F4YA 3GTOH 5ALNA 4K8IA 1BGXT 4OONA 2RCNA 1TIID 1WVLA 1PV4A 5IWAQ 4DFMA 2XGPA 5AM1A 3SZ2A 1KRPA 1G291 2A69C 1ZQHA 2W43A 2Q8IB 4KLSA 3MR2A 5F2DA 4HJAA 2HIVA 3ZDAA 3WK8A 5FO9B 4J9NA 3PVXA 4LF7L 5M3MG 3S17H 4CCHA 1B3AA 1GXDC 5C4XG 3DWAA 3UDIA 2A1AA 1TWFH 3QUBA 2IHNA 5KFMA 2BQRA 3CHBD 4KK7A 2JRZA 5EPLA 4AYBG 2HT1A 4DXFA 1UE1A 1I6HH 2E5LL 1Q3LA 3VCBA 1OUQA 3GP7A 1IKLA 1XWEA 4JI2L 1X32A 3W5OA 5BR8L 3M7NA 1BNZA 2A1JB 1ZQAA 7ICPA 8ICEA 4F4XA 2PI4A 3MEFA 4PMCA 4LFAQ 2E5SA 5KFYA 4LF6Q 1EYDA 1HUMA 4K0KQ 1ILPA 1B2TA 3K6OA 2IPKD 4ALPA 1L8LA 3S2HB 1K8MA 2IT1A 4OCZA 1VMCA 3SENA 4KITB 3OSNA 2M2LA 4JV5L 1BF4A 1W2BA 5L1MA 1K28A 3A54A 5IYBG 1A0PA 5M3MB 2JA7H 4QMGA 5J2KA 4FE3A 5JU5A 4MEYA 2VANA 4X62L 1PDQA 2ZXRA 2WF7A 2KHQA 4JWNA 2F0PA 1EY8A 2J4XA 5KFHA 5IYBH 1N33Q 3PO3H 2OEHA 3QU4A 9ICVA 2WB1E 1SV0C 3MTSA 2NV3A 2Z0SA 4UDUC 3MC1A 2NVTH 4R66A 3C5FA 2K1BA 4QNLA 3H0GB 1FNUA 3KKAC 3OHXC 3PO4A 1H9SB 1STAA 1CZGA 4NLGA 2F4IA 4A4IA 1Z00B 1Z4NA 3Q8LA 4EBCA 3NTUA 2ASLA 4F4KA 5IOCA 4RQ0A 4J9PA 5EWGA 3RJIA 1E2WA 1V1OA 3IKJA 5KT7A 3Q8DA 4DAPA 2L4NA 4GKJL 4A3EG 4YCUA 5HURA 3ZJYC 4LFCQ 4UP7A 5K36H 1F9PA 2DY7A 3HG9A 4IC9A 1BXTA 4BWGB 2VW9A 4F2SA 3L0OA 1IL2A 4MHEA 1Z1BA 2EANA 3H0MB 2KN7A 5E7NA 4ACOA 1SXEA 3PSFA 5IE8A 4PGXA 4K5XA 2OYYA 1XSNA 1I3QH 4CDGA 2HI0A 4JVZA 3SK4A 2E1FA 2Y0SC 2F0QA 9ICIA 3K7UC 3C46A 3S16H 2O6KA 4EGVA 1XS9D 3J7A5 2HOQA 7ICJA 1RM6C 2C2DA 3HOYH 2NN6I 2KEEA 2JA7G 3GV8B 3KHLA 3U4ZA 4XA5A 3F2UA 1BDOA 5G5GA 4M9NA 3M9MB 3QX7A 1KEJA 2C28A 4YWMA 5BR8Q 1X40A 2WAQB 4UHVA 2LBOA 3GV7B 4RUAA 4EZ6A 2HIXA 4GXKA 3NE5B 3OIPA 2DGZA 2NZ1D 1WTOA 1N48A 1PVQA 4UASA 2W8KA 3L9AX 1ZQWA 3SK8A 4DU9A 1LV9A 3CC2A 4DOBA 1XO1A 1B1ZA 1SYEA 5CV6A 1VQ5A 3VYRA 3IM1A 1XNSA 3F2BA 2Q8RE 4GS3A 1SJED 3T51B 4C3JG 1VJ5A 2Y0SF 1J5EL 2PQEA 1PRTB 3QXGA 3LWMA 5BPCA 4C8MA 1ZQYA 3IRUA 5KFTA 4ECWA 3NEMA 2MA1A 2RQXA 3S1RB 4M47A 1GUWA 5KFZA 2V1CC 3OTOQ 1SNDA 2E2IB 3L4PA 1EY4A 4RZRA 2F44A 9ICUA 1N32L 2DKXA 3EIVA 3VYUA 4UAVA 4U7CA 2JA9A 2WV6D 1L0XB 3L5KA 1ZQIA 3RH6A 3T79A 2K05A 4F71A 3BVGA 2UUBL 1XNRL 2NVXB 2D0PA 2AHOB 2ZIVB 3T3FA 3K4GA 2FMMA 3QNMA 7ICTA 4TVAB 4X3TA 4RQNA 3HOVB 2QEJC 4JYAQ 3PV8A 1YNJD 2EZVA 5AM3A 2WFAA 1PTOF 3H0LB 1HTPA 1STHA 1BVSA 5KG2A 1BNPA 1EQVA 2VJ5A 2E76C 2RHQB 4NLKA 2W3RA 3NWSA 1EEFD 3VYSA 4I27A 4Z6EA 4O5EA 5ALHA 2N55A 1N63A 2E8OA 2K5NA 3ONNA 1ZQQA 4LF5Q 4YXMA 3SQIA 1EQQA 4K6LA 2CRXA 1Z6HA 4BBRG 2IA6A 4EX7A 3URYA 4RQ5A 5ELDA 1F0MA 2DY8A 1HR0L 2A69D 3NP8A 3KTQA 1PH6A 4Y2RA 4RWSC 2ISOA 3HKZE 2UXBQ 2P66A 2KKVA 1TWCB 4DV7Q 1VQCA 4PJ0U 4F5NA 1TXYA 1D6EC 1NK7A 1P7DA 2F0VA 2K04A 5T14A 1LV5A 1U45A 1PH1A 1JQYD 4A3CH 4DR7Q 1K83B 1A3TA 2B2YC 4GN3B 5KG1A 5KG7A 1ZQMA 1UHUA 4M0AA 2IL8A 4OELB 5CV7A 4JI3L 1M1KC 1D1IA 4B9XA 4XT3B 5KAFU 4NY8A 1HZ9A 3FPUB 3H91A 4C8KA 2X6GA 1U9LA 1T9HA 2Y9UA 2C5CA 3BYYB 2D8CA 1BCPF 1B50A 4US9A 5LMUL 3Q24A 4M04A 1TS2A 4LWCA 4R4CA 1K8OA 4DL6A 4WFN3 3PW7A 3WU2U 1EOVA 2DJGC 2NBFA 1K1SA 4FBTA 4R8UA 2ISPA 2EYPA 1SKRA 2LYBA 2XNAC 4LFBL 1RD9D 2HBKA 1JR0D 5JVG3 2BCRA 1AQ6A 1JXLA 3BVZA 2HDOA 4EENA 2A8VA 2G08A 4HIDA 4UAUA 4CGZA 2FE9A 1LO5D 3M4OH 1IXRA 3NRZA 3PCOB 1N61A 1STYA 1ZQGA 1MHWC 1GD7A 2CH4A 5IIIA 4IQWA 8ICPA 1KKXA 2WB1B 3RLNA 2WINB 1D5MC 4ZRZA 2LHTA 1RQLA 1NK8A 3HWTA 2MQHA 1Y8NB 2EXZA 4B3ML 1I50B 1FNWA 3GTKB 3H94A 4B9MA 4A3DG 1LTBD 4F5RA 2ASJA 3K80C 4ED1A 3QOLA 4H02A 3OW2A 4LVSA 5DGBA 2LY7A 5C4HA 1GUNA 4A3IG 1A76A 1F2YA 2J6TA 3SMVA 9ICAA 2KICA 1KRTA 3E3XA 4KD3A 1SR3A 2LYHA 4C4RA 1KQQA 1WTRA 1KL9A 4Z6CA 1MA7A 1TR5A 3HOXG 1AH9A 2Z1CA 2R92B 1QSYA 1VMPA 1CUKA 3PUWA 3UDXA 2NVQB 3SYZA 2QARA 1ENCA 2QW7A 3VA5A 1RF2D 4UARA 4FFDA 2EE1A 3AQQA 1CEZA 5CR3A 1N36L 4PHDA 4RA8A 2H3QA 3N7PD 1A3UA 4G7ZC 2PO4A 1TWHH 3OMGA 5KT2A 3PX4A 2K5VA 5ELEA 4RQ7A 4RH6A 3ZDBA 2VA3A 4GXJA 1EY6A 2VQFQ 5KFXA 3T1YQ 5KG6A 2XICA 4F93B 3S2DB 3D31A 3H8JA 5KFLA 1QTMA 1PXUA 2XN9C 1N32Q 4AQYQ 1COKA 2F1JA 1XJVA 3LWEA 3QEBZ 4H13C 3IP4B 3CQZB 4HMJA 3UDFA 1IW7C 2ES2A 3I2ZA 4LJZC 2VXWA 4YWKA 2LMCB 1EU3A 3GIJA 5AI4A 4DL5A 5NUCA 4KTAA 4RHSA 3TI0A 1EFID 3KHRA 5ALKA 1VQEA 2WACA 4A75A 5IYDH 4DUZL 1SYDA 2C2EA 2YQEA 1IHZA 3DWQA 2UUBQ 5IIFA 3TAQA 1ZQSA 4YHHQ 2A68D 4L5SA 1ZYQA 3EQLC 5ALVA 2L9HA 3AU7A 5C3EG 4DV3Q 1ZD3A 2IHMA 2RCFA 5AK3A 2A6HD 5EKKA 3U50C 1UE5A 3EW9A 4IQZA 5J22A 3Q23A 1VQ8A 4JI4L 1SE3A 2Z6KA 1T4GA 1TAMA 4A3JG 1GHJA 2KOBA 5CB1A 3Q8QB 4RG1A 1XNRQ 1HNWQ 2FMSA 3GTGH 2JYOA 3KHHA 1TAQA 2NN6G 3PO2B 5D3IB 2Z4HA 2B6GA 3K0XA 5E1FA 1XMOL 1U49A 4Q8EA 2H5XA 3TZUA 3WK7A 5DQHA 2KCCA 3GTPH 3M9OB 1YNNC 2Y0SG 3FKIH 5A2QL 4I2BA 3LX0A 3BDCA 4DOCA 2B2WC 3LNNA 2XVSA 3BZKA 3I76A 3QU2A 1SWVA 5F3XB 1TWAH 4O3QA 3FYHA 1YNJC 2JA6B 4TURA 5D65A 2BDUA 4CF4A 4CGYB 3K1ZA 2ZIUB 5C3EB 4M9LA 1QILA 1IBLQ 3UMCA 4DGZA 3C28A 2YB1A 4X65Q 4FYDA 5ELNA 1WWUA 3O0FA 3EA6A 3RB0A 1YT3A 2EDUA 3PY8A 4EVOA 5KEEA 4A3JB 2KJ9A 3JPSA 5J39A 1XSPA 2AKWB 3FHWA 1WCLA 3A8IE 2K01A 5D46A 2IHEA 2MSNA 2R7ZH 1WD0A 3UM9A 5L37A 2UXBL 1E1OA 3TKAA 4KLKA 2KP7A 2MO0A 2B21A 2HHQA 4QZ8A 4C3HH 1O7LA 5KG0A 4JI6Q 3C2PA 4A3KH 2ZG6A 1SIJA 3J81E 3I4LA 3WWVA 1B22A 5AJ3L 4BWMA 2BCOA 4US8A 4X3SA 4DV5Q 4HJ9A 3CD6A 3TS2A 4DEZA 1NZPA 1XYIA 1PFNA 3O13A 2BGWA 1X3QA 3KOJA 4DR3L 1AZQA 4PGYA 4DNTB 4DQRA 1E7ZA 4CJ1B 1IYVA 3M6ZA 1F2MA 3TDQA 5KAIU 1VLBA 3G71A 5HNKA 4HN7A 4LF8L 1HNXQ 3HP3A 1TVXA 3PO2H 3CNHA 1ZQUA 3A7AB 1ESRA 4HEDA 5IYCH 4Q5VA 3S15B 3N28A 4XQ8A 2F8LA 3X3MA 5JPMC 2L5YA 3PR5B 3SV3A 1Q86C 4Y7NB 2Z7JA 4NLNA 2AWNA 2ZUDA 5AI9A 1ZQPA 2CW0D 2N3SA 3A8JE 4A3EH 4C3IG 4WJ3B 2PMZF 2W54A 1Y88A 3NBIA 3UXPA 4DSFA 1ZQKA 5F9NA 4QJFA 3UPQA 1ZXTA 3UQ0A 1XU4A 2YB4A 2HCCA 3IV6A 1LTID 3C2MA 1VQBA 2F4VL 3ITPA 3OSOA 2CKZB 3HT3A 1R4QB 4JI8Q 3SGIA 3BS7A 1AN8A 1NE3A 2Z8LA 2F0HA 5BN4A 1PMRA 4IOCA 4JBKA 5ALRA 3CMAA 1RODA 5CC4A 2AU0A 1BPZA 5HR6A 2PYKA 2BDOA 5KFQA 1KFDA 2TSSA 2RQ5A 1ZJNA 1QUQA 3RB3A 1LUZA 2RA4A 3Q8KA 1XMQQ 4MEXA 3DMUA 3PV0A 1ZQEA 3QO2A 1O7ZA 1X3PA 3FDTA 5KFAA 1OXJA 4ECYA 3OSPA 3PF4A 1PVRA 5A35A 3GTLB 3TEHB 2ENBA 5M3FB 2P35A 1VQNA 1PTOB 2B63G 3R93A 2UXCQ 1CSQA 1A0IA 4YQWA 3H4BA 5T1IA 1FIQA 3A5ZB 3V2TA 1WI5A 1JUDA 3MXGA 3C23A 4DUZQ 1JI7A 1ZQJA 5AI5A 2ASDA 4HJ5A 1VQ7A 1FJGQ 4YMNA 2F0SA 4DFKA 2RSNA 2KUMA 1TWHB 2KENA 3WKCA 4HSVA 4KN7C 3AMUA 1KLUD 5GAGC 2B2UA 2V4RA 4RPZA 4QIWC 5KT6A 4J9LA 1BPXA 3MXUA 4DUYQ 5C3EH 3N52A 5DBAA 2GH1A 5KL1B 4EBDA 2AUJD 4KJNA 3U4VA 4NM1A 3HKZC 4WJ3M 4GNXC 1UAPA 1NI3A 4DV6L 4JBJA 3GTPB 1S5CD 2EJMA 5CMDA 1EQTA 5CJ7A 1ICWA 2M0NA 3Q6SA 2AQ1B 4A93B 4C80A 3C2LA 2N8NA 4FVMA 2ASBA 3AB9A 1BBWA 4J03A 4I28A 2K5WA 5C0XG 2LS01 4IFDH 4KMUC 4RT3A 1EWIA 3NWTA 1Q81C 1DZ1A 4R8NA 3TBIB 4Y52H 2GLEA 1XXGA 5G3LF 2A73B 1BO0A 2FXQA 1KNEA 1SL0A 5GROA 1EYGA 4BXXH 3LWLA 2KQ3A 5J2BA 4HCEA 4NL9A 5EKIA 4F2RA 1HQRD 1Y8PB 4OIKA 4GN4B 2KTQA 5EGTA 1K5OA 4FF3A 1RZTA 2R7ZG 3PX6A 4IPHA 3RR8A 1SZHA 2PW7A 4HMIA 4ECRA 4YCVA 1IBLL 2JEJA 2F0FA 3AN1A 3KKAA 1QLNA 3MR6A 1LTSD 1YEZA 1X6JA 3A7LA 1B9NA 3FDSA 5KG5A 1Q82C 1QQ5A 3MC0B 2YN4A 3Q8MA 4RT2A 4DQQA 2F0UA 4K5WA 4KKUA 5DKWA 5ELBA 3KLRA 2XWBB 4QW9A 8ICJA 3HRDD 5AIAA 1PH8A 1EY0A 1S76D 2N78A 3KF6A 1YHBA 1NZBA 3SAHA 3NVWA 1K83H 2R7DA 2ZXPA 2R8HA 4O1NA 3MGVA 1LT3D 1CKNA 2KJ5A 4MF8A 2Z6KC 3JAME 1ECWA 1BCPD 3H6MA 3H8MA 2E1EA 4OO1H 3V05A 3FP9A 2E8MA 4Y2PA 1QNKA 3ZI4A 2K28A 3BS1A 2R8JA 5FLMH 4DXGA 4DS4A 4C4TA 7ICVA 2FLNA 3R3OA 4DV3L 1PH7A 3TFSA 2AQ2B 2WKDA 2Q0ZX 1WG8A 2RHSB 4JOIA 3UI2A 4JI0L 1H95A 2KECA 4JI4Q 2DF4B 4KI0A 2XTIA 1PVOA 1RYRA 4OO1I 8ICYA 2HQEA 5CWRA 4LZGA 2NUCA 5J0UA 2JK8A 3PW5A 4TQSA 4P2HA 3KBGA 2YTVA 4M1UB 5CV4A 1I94Q 3K1RB 1E24A 4HSPA 1Z19A 3IFTA 2F8KA 4NLCA 1M90C 2JMGA 4DFJA 2EJFC 1LABA 3ND8A 2ZJ5A 5IWAL 1H9JA 3LWUA 1DJRD 5C6AA 4I2CA 1T7PA 1OXVA 5CV5A 1V97A 4Y2YA 4QIWF 4XT1B 3J81i 2ZIWB 1E2ZA 5LL6X 5AI0A 5HGTA 2FJ2A 4A8EA 3ZD8A 2MUTA 5ALPA 2LPEA 1ZQ1C 3E58A 9ICQA 3CF5A 3J7ZC 4O5KA 1SKSA 1KDCA 3D2NA 4DQPA 1SEBD 3T56B 3I4NB 5KFCA 5HMLA 8ICNA 2VNUD 3A5UA 3DWPA 4YD2A 4ZLTF 1NJXA 3I4MB 3I70A 2E2DC 5CA7A 4OX9L 1A8VA 4DAMA 1DM0B 2NRWA 4BY7H 1AP0A 3JPQA 3GIMA 5C5JA 3RJJA 1S5DD 1EIGA 5J0TA 2UVUA 4KN4A 2BPCA 1F5SA 1RKNA 1U4MA 4A3BB 4J8QA 1SNMA 2RDJA 2ATWA 4NMZA 4N8FA 2KVCA 1L1OA 1MGSA 1O78A 4JK1C 1QQ6A 2WF8A 3MGIA 1C9OA 2DUYA 1GKHA 4O42A 2K14A 2IX1A 1G2TA 2HHSA 5AJ3Q 5KFOA 4YN4A 1SN8A 2KOLA 5IP7G 2L11A 4DR5L 5IGFA 4H0LC 4C7YA 1Q8IA 1ED1A 4XUSA 4ICAA 1ZQOA 2K33A 3MHBA 5ALMA 3TAPA 5CBEE 4BBSG 4NV0A 2RKSA 1C8CA 1QJOA 2F0OA 4BDPA 4F4WA 5LMNL 5DLQE 4U673 2K50A 4R64A 2K8AA 4DQSA 3DDHA 2ZM6L 4JWMA 2E8GA 4DA2A 3ULJA 3HW8A 3M9BA 1UT5A 2R8GA 1IL8A 2XWJB 3HKZB 3QWNA 4P0QA 3S1MH 9ICGA 3PW4A 4J9OA 4RNMA 3VR4A 2EZYA 3R2TA 4YHHL 1ESFA 2BCUA 4KN4C 5DBBA 2GWSA 2E5LQ 3CP8A 4MHVA 2BDNA 4Z9CB 1QVGA 1VQPA 3HOVH 1TE2A 2R92G 3ZYYX 1IZ6A 3JPNA 1TY2A 3MFHA 4TSSA 2R18A 3AFPA 2UXDQ 3TZDA 3I4NH 2KSOB 1NAPA 2W8LA 4PHPA 3KDFA 7ICKA 2NN6H 3NXWA 4RKBA 1KDHA 4A3MH 1V9PA 5AKLA 5DQGA 1Q1EA 4F5OA 2CFMA 1B4OA 3CRKC 1LT5D 2HDLA 4WJWA 4J9RA 3GQCA 1VQHA 4DR2L 2HBJA 2VA8A 2ZTDA 1DYQA 4UP9A 4PQXA 4OO1G 2HSZA 4KD4A 3I4MG 1V38A 2OHFA 4NB3A 2HHHQ 2MGSA 4RKLA 2Q8TA 4QZBA 4IUTA 3H0GG 2NO5A 5C0YA 4RPXA 3D6JA 4EBEA 2EIFA 4L8JA 5AI8A 4G3IA 1ZXIA 2R6GA 2K89A 4YR2A 2J0TD 1AEXA 3PR4A 1F9SA 4YFKA 5C3WA 1N33L 3RRHA 5EBDA 5I4DA 3ULPA 5I9PA 2JA8B 1D7QA 1LKYB 4Q44A 4Y2XA 1B3QA 2EQSA 2F0GA 3SR1A 1VS0A 4RQ8A 4MFAA 1UA1A 3CXCA 4PHEA 3RNUA 1KC8C 1W6KA 5ALZA 3AM9A 4ED7A 4JV2A 1S97A 9ICTA 3A0JA 3HKZG 2F0NA 4UB8U 2F2AB 1K3BC 1LTRD 4P2CB 3J80c 4B3MQ 3DEOA 4KMOB 1URJA 3IDWA 3OGUA 5AI6A 3DXJC 2A3VA 1XX8A 3OHBA 4JK1A 5J2GA 3UMGA 5HHHA 1IYUA 1HPCA 2BPGA 2OQ0A 1D8YA 2PNRC 2E8PA 3ZDEA 1YNXA 3BDLA 1WWVA 5BOLA 5M5YH 4A3CG 4TKOB 3KLSX 4ME5A 2IX3A 2ZXOA 4B9TA 2C2RA 2TMPA 3KBBA 3GFKB 1Z00A 1FVIA 2GOLA 2MU2A 1IM4A 3J81j 4ELTA 3MXNA 4TQUS 3GTMB 4QWDA 1STBA 3G6JB 3I4MH 4C1NI 3D4DA 1TT2A 4A3KG 1ZQLA 2D6FC 2CH4W 5IY0A 3GTOB 4XIGS 5H1SE 4IRCA 1Z9FA 3L3FX 4POFA 1D8BA 2UVVA 7ICFA 1L3UA 1NNXA 4B3SL 4PNYA 1K0SA 1IW7D 2RHFA 3H3VC 1KTKA 3VR3A 5C0XI 4RQ3A 5DG8A 4M2YA 4DFPA 3RB6A 1N5WA 4YCXA 2M9NA 3DLLA 3PX0A 4C8LA 5I6WA 2E2JB 5ALJA 1DONA 2EY5A 3I3CA 4RQMA 2G9DA 4RUCA 3PGZA 4OIJA 2J6SA 1NMGA 5IIKA 4F88A 4A3LH 2B2YA 3EFXD 5GTHU 2Y1JA 3HZXA 1UE6A 5IT9c 4UB2A 2NVYH 2XVTA 4I29A 2HHWA 2JEAI 4KLFA 3HOUH 1N34L 2XI9A 1SYFA 7ICQA 3NQIA 3S2HH 4ZOHC 1AW7A 2NTSA 2I46A 4DR5Q 4ME3A 4DK3C 1S9FA 8ICHA 3OWFA 2BCVA 3H15A 4QZHA 3D4WA 3TP5A 5M5WH 3RZOB 1GO3E 3GD7A 4QB4A 5LMNQ 1CSPA 5LMUQ 2EXDA 1BR9A 2DFLA 2KNJA 1L6NA 4LUOA 5ELOA 2LKVA 1DOLA 1EYAA 5ALYA 3TARA 4N9TA 4JV1A 2KCMA 4YWLA 4QZCA 3JPOA 2RP5A 5KNDA 1HCZA 3S17B 3G6XA 1FYCA 2W03A 1NNLA 3CMEA 2XC9A 2ICEC 5KFIA 4KKTA 3KJPA 3DUZA 5EBCA 5M3FH 2WTFA 5IGEA 4IPDA 1DXMA 1DK2A 2IHFA 1OXUA 5C5MA 5T1GA 1VQFA 3PIPA 3QR8A 3WK5A 3RB4A 3D2SA 3WKBA 1SNPA 4C7ZA 5G3LD 1JXEA 4K8JA 3KUPA 5E79U 5AKHA 1OTCA 4F92B 1QB5D 2HMXA 3NUQA 3M8RA 2RBMA 2RDIA 5DDYA 5ALWA 1WFQA 3FPPA 1QOHA 3K5OA 1JICA 3CCUA 4A3GG 2CPRA 2NTTA 4MTKA 4O5CA 2C35B 4BY1H 1GJXA 5AKZA 3BQ2A 2K03A 3N4MB 3M9NB 2K5DA 1D9DA 3OTOL 2JA5H 1VCIA 2JP1A 2QF7A 1KNAA 1JB7A 1Q1BA 4A3EB 2KJXA 1MC8A 4BY1G 2LM1A 1IBMQ 2KHIA 4DV1L 3K57A 2CWPA 4IUPA 3N6RA 3TQ1A 2B3GA 4MTNA 4GOPB 2CW0C 9ICBA 1O7YA 1EZ8A 4P71A 3S15H 5IGDA 3CCJA 3M4PA 3RRGA 1H9MA 1VQDA 1FO4A 4C8OA 2K8BB 5IP7H 2LFNA 1WTWA 2K75A 3HX0A 1RJTA 4RMFA 4DKAC 2L15A 1HIWA 1T3NA 4RQ2A 1Y1WB 2W9BB 1BPYA 4KY6A 3V7KA 5M5XH 4PH5A 5M3FG 1X3FA 1Q7YC 1ZYRC 3NUCA 2F03A 5KG4A 5CEHA 2BQ3A 1HFGA 3MWYW 5IT9L 2A6EC 4C3HB 3QU9A 1BOSA 4F7XA 3JC66 2IOHA 4Q8FA 3OW7A 2OEOA 4DK6C 4HIKA 5IIOA 4FZMA 1ZQBA 2KVSA 1A6SA 1CTMA 4KN7A 4USAA 4QJFB 3ETLA 3I1YA 3QZ7A 3TN2A 3GDXA 4F72A 4A3IB 3HFZB 2WP8J 2CCZA 4FXGC 3L2PA 5J2DA 3JAMi 4V190 1C0AA 3B9JA 2A5HA 4P4MA 1KFSA 5KYIA 4JI3Q 3K81C 3ISCA 1R9TB 2JA6H 2DWQA 1KLGD 1PFMA 3HOYG 1QNUA 3N7SC 4BX9C 2HVIA 2E75C 3MXPA 3ND9A 5JOBA 1Y1WH 3M7GA 4DNRB 4A3LG 4FS1A 4IUUA 4YG2A 2UUAL 5AKGA 4YY3Q 2I5LX 4ULLA 3TACB 2G07A 4YIJA 3QU7A 4DAYA 1LTTD 4EX6A 3KBXA 1N36Q 1S5LU 1KTQA 1GO3F 1A2UA 3GO5A 1UPHA 3S24A 3OPXA 1Z4OA 1EYCA 4GLXA 4OHJA 2FPMA 8ICRA 4Z6DA 5CYUA 2MJ8A 9ICJA 4JPBW 4KKSA 1Y8OB 5I6YA 5FJ8G 4DUYL 4OX9Q 4YVZA 5ELCA 2PXIA 1XSLA 4FF4A 1MN8A 4CDDC 1YNND 1KW4A 1KBUA 3J80L 2K4PA 2H4OA 3MZ5A 4JMUA 1I4HA 3CCVA 5IODA 1KLNA 4KLGA 4G4KA 2IBKA 4I2IA 3HOZG 3H4DA 2HCIA 1NY4A 2ZJAA 1FEZA 3NSWA 3M1YA 3UMBA 2I07B 3Q22A 3T1HQ 4EQPA 1J8IA 2BOSA 1N8RC 2EVBA 2WAQC 1CI3M 1NKEA 4JI7Q 2XO7A 9ICWA 2RDGA 1KXLA 4DV2Q 4QZFA 2KZMA 4EZ9A 2KIVA 1XPUA 5HMMA 5ALFA 3KFUF 1MSHA 2VUMG 2G5IB 4UAIA 1S8OA 1MSGA 4DLGA 3NTKA 3S2DH 1CHPD 5HR7A 4EELA 3ISDA 8ICXA 2VB3X 4MFCA 1JC7A 2KHVA 1ZJMA 1QWYA 5KIXA 9ICSA 5J2JA 5EE9A 2Y0SB 2FI1A 4A3JH 2EYOA 4RQ6A 4M9JA 1B44D 1KDBA 1O80A 5LHY1 3UDGA 2EAPA 4Y2VA 3U26A 1EU4A 4LF7Q 1RDPD 2W9MA 1VDVA 4UB6U 3OOCA 4BXOA 3RN5A 2EYJA 5JPNC 1TV9A 5L9XA 2PI5A 3HJEA 1F77A 3EVQA 4A3FH 4GLVB 3MFIA 3TRZA 3BQ1A 3RZOH 2DPJA 4C3HG 5DB9A 1VQKA 3AU2A 4KLIA 5KFFA 2D62A 3E9IA 4IOAA 3TADA 9ICRA 1V1PB 3S9WA 3S1QB 2JZBB 4QWEA 1A2TA 1ASYA 3NS1A 2HHHL 4X6AH 1PFSA 4GC6A 5FP0A 2HQLA 3P75A 4IPGA 2NVYB 1RYSA 1WYDA 3T5JA 4CDEC 1STEA 5G5HA 1HZAA 2JXJA 2MUYA 4L5QA 2IJ0A 4U68A 8ICCA 3KF6B 4B9NA 4A3GB 5DQIA 3RJFA 8ICQA 3BZDB 4QWBA 1MI2A 4IJHA 4R1JA 4HAEA 1JE4A 1HZBA 4IPCA 5C4JH 4O2DA 4CJ0B 4GNXA 2I9GA 4K5VA 3W1BA 4KLMA 1LYLA 4XYOA 2VQFL 5KG3A 3K0YA 1W6JA 1SL1A 1PVPA 2ZIUA 2B0CA 4JV0A 3G6EA 2UVRA 1RIPA 4I2HA 4R4TA 3SHLA 3SAGA 8ICWA 2E2HB 2G09A 1SYCA 5ELFA 1NOMA 4YR0A 2LXJA 3DEPA 2Z6BA 2IOFA 1AE2A 3CQZH 4RGMA 1EL0A 3C2KA 1X6IA 2YMLA 5JEAJ 1JJ2A 1I94L 4DSJA 3KLSA 5L1IA 1NK9A 1CZWA 3I55A 2JA8G 1HA5A 3R8BA 3ICXA 1ZQCA 1ET6A 2JEIA 3QE9Y 3TP7A 1RTOA 4NLBA 2WF6A 5J1ZA 4NLZA 2NO4A 5ALUA 4OO1J 1I4XA 4ZK9B 1PZKD 2ALYB 1KSPA 3DM3A 4KLDA 3K5NA 4GNXB 2BH2A 5EWEA 2EDGA 1KN5A 4LF6L 1SV0A 3QOJA 4O3SA 3T4AC 4RQ4A 1MJCA 4GKKL 3PIO3 1EIFA 1X6OA 3MABA 5KFPA 4TQRA 4ED8A 1C7YA 4DLEA 1Q3UA 4PZ7A 4P0PB 5J2CA 4C3JB 1ZYRD 3L7ZC 1VQJA 2EH9A 3D8GA 3OYYA 2XRSD 4I2AA 2JA8H 4DR4Q 2MRLA 1VF7A 2EPBA 3ERQA 3F53A 1N60A 1SE2A 3TMEA 1K8AC 4IQTA 2VQEQ 4B9WA 2F0TA 3RAQA 4EYIB 5C5LA 2BKEA 1YZ7A 5JTIA 3PW0A 5KL8B 1FJGL 1CT1D 4IQVA 3NRWA 2HBLA 1IYJB 3HKZF 4K4GA 5GADC 1E2VA 5KFSA 1S0NA 4PPXA 1JJCB 2F3VA 4B08A 3IL8A 3H8WA 3RR5A 2UVWA 1PTOC 5J2IA 3J81c 3OJUA 9ICHA 1I50H 2K60A 4UPAA 3CYMA 7ICNA 3SXHA 4JC0A 3CC4A 4KHZA 2OTLA 1ZQRA 5KFEA 5J0SA 1NJZA 3BS5A 1N5XA 3RF9A 4OL7A 1JT8A 2QKQA 1NK6A 4ZYSA 4MF2A 4IFDG 4K14A 3C29A 2VZAA 3HS0C 1QG7A 3CCLA 3F1ZA 3NASA 4XQJA 3A74A 2LI6A 1G6ZA 2YMQA 1YHAA 5CP2A 2F1MA 4UY8C 4AIMA 2FMQA 3OWEB 4IRDA 1RXWA 3Q0AA 1KD1C 1PH9A 3ORYA 4ECZA 4K4IA 4IQUA 3RTVA 1W3SA 4L63B 5IYDG 1QCBD 4PMBA 4JI5L 1ENAA 2PI2A 2CN1A 3QG1A 3GZFA 4DF8A 4X66L 3Q8RB 2BR0A 2HHUA 4ECVA 1SJHD 3D0FA 4DL4A 1II3A 3P20A 3CAMA 4HJ8A 1U4PA 3QIAA 2KCNA 4CF3A 1TKWB 1Z47A 2NRXA 3SEIA 1BCPC 1SROA 1TWGH 1VQ9A 1CI4A 1RXVA 2N49A 1B70B 2OCEA 1CKMA 3KDFB 2Z9HA 2K6AA 4PZ8A 1YJWA 1TWCH 2CWAA 5ALGA 3WK6A 4G7HC 2NYZD 5C3XA 1WCMH 4DR1L 4K4HA 4XTCS 2AGOA 2PW5A 4GLAC 4F8MA 1IG6A 2UU9L 5KFRA 3H3VI 4X3UA 1OO9B 2BPFA 1BCPB 1ICFB 4ZCKA 1JOQA 3PIOA 2AQ0A 2PZUA 5L1JA 1RL2A 2KZ3A 2W9CB 1MQ3A 5BN3A 3MDAA 4LAAA 2WFWA 3CRXA 4HYKA 3G7LA 3E0JA 5AM4A 2IY5B 3W1GA 5KNCA 1JROA 1SBBB 2B2VA 3KOOA 4GN5A 1PA6A 2XY7A 2E3TA 2QB0A 4OWTB 2MP1A 1SWWA 3LYSA 1G51A 7ICLA 3STBD 3V72A 7ICIA 1KQSA 2P6UA 3MA2B 2WAQE 4BY7B 1S0VA 1X9XA 4I2GA 1FNVA 1HRJA 1AE3A 4IZ8A 2VL6A 2GVBA 1LKYA 5KT4A 2F0EA 4DCCA 2YV5A 4DV0L 4BBRH 2NVXH 3P7JA 4OXPA 1QZGA 1HFNA 4A3MB 4QQBX 1HEKA 1X3EA 1G6PA 3U9OA 1LT4D 3RJGA 3U58A 3H0GH 4UB3A 1NK0A 3Q8SB 2E2IH 4DF4A 2YMPA 1X42A 3TANA 3TP8A 1C20A 4R4OA 2YMMA 3MDCA 4QY7A 4JI1Q 1EQRA 1JOKA 4QIWE 3G6VA 4M9HA 5EOZA 7ICSA 1MIUA 2H1EA 2QCPX 2K32A 2Y0SE 1TY0A 3TADC 3NQTA 2HVHA 4POGA 1CKNB 8ICVA 4OJ5A 4ID6A 3CCQA 1SFOH 2OTJA 3LVVA 3S1MB 3NTIA 1TS5A 4J6HA 2MHVA 4FDBA 4FP5D 1O7IA 1I4GA 4DV7L 5KFWA 1X9MA 4NXML 1EIHA 1SMYD 2E74C 4ELUA 1TS4A 2FPKA 2RF4A 4AP9A 4HCSA 5AM5A 3PW2A 2N1RA 4PL1A 1M6YA 3C1ZA 1I6HB 5GQOA 1WCMB 2ATLA 1L2FA 1ZETA 3F8TA 4OJOA 4DN4M 1TQOA 2G06A 3HOYB 3FRPB 2H3IA 1D2BA 1S5BD 4UQGA 3C1YA 1ML0D 2F76X 2FFKB 3SDZA 5J0PA 3M7DA 3GV5B 5C44H 4NXNQ 3VR2A 1KAWA 2R8KA 4CKEA 3S16B 1JWSD 1I4QA 3BQ0A 1QSSA 1AROP 1YZ6A 4M6WA 1FGUA 1T94A 4B3TL 2WAQF 4P4OA 1UUPA 2MUTB 4ED6A 1X66A 4DL3A 1N2XA 1LTLA 4CKBA 2A74C 4L5RC 3THVA 4O0AA 2AWOA 3D4RA 2AQ4A 1YBYA 3KFUA 1SNQA 4QZEA 1AZPA 4QCLA 2JSOA 1GUGA 1YITA 4LFBQ 4ZQ3A 1ZQFA 3B0XA 1BKBA 1J6QA 2Q2IA 1SL2A 2F0MA 4RAUC 1EFWA 2JA6G 3D6WA 3S14H 1Y1WG 3T5LA 3SVMA 5KT3A 1WJJA 4BBSH 3GU3A 1VQAA 2NVTB 3I56A 4P72A 2O5JC 2DUDA 2OXPA 2Q2TA 3F2CA 4JI0Q 4TRDA 3CW2C 1L1OB 1E1TA 5JJZA 4KLUA 2NZOA 3D3RA 1GUOA 1HNZQ 4FXDA 1S4ZA 5C4JB 4RQ1A 2WB1C 3BG3A 1DCZA 1L5UA 3IAYA 5M3MH 2VUMH 3MFGA 3TS0A 1S0OA 3DV9A 2KEDA 2VB2X 4QZDA 3I72A 4NW2A 4J1MA 3G6YA 2DJFC 1X55A 3KJOA 3J7AF 3AU6A 1QVFA 5IIJA 5DB8A 4KLHA 3NELA 3E9HA 4RCOA 2CVRA 4XRHA 5EAYA 3RJHA 5J2EA 3S1QH 2XCAA 1A77A 3S6JA 2F3NA 1QE6A 4CF5A 4F8RA 4WORA 1WYGA 2ZIXB 4P4PA 4A93G 4X64Q 4GXIA 3CC7A 4F87A 2AMCB 1PHJA 4IFDJ 3T1YL 1MBYA 4OJLA 5EE0A 1ENFA 1TWFB 2RLTA 4PZOA 5AM0A 5DB6A 1TK0A 4P75A 3EUB2 5DG9A 4NM2A 1VQ6A 2D2CC 3A56A 2EY6A 3AMZA 4GOPA 4UB1A 4RNNA 1NBWA 1UCVA 3DHQA 3B6YA 1DRGA 2KSOA 2YX8A 2F3IA 5J0QA 5DM63 4RNOA 3GTLH 2HOIA 2F0KA 5ALSA 4KX3A 1NJYA 1HZCA 1STNA 2W9BA 2J7ZA 8ICUA 4BUGA 2CQAA 3CPFA 4C3IB 3K5LA 4EQ5A 5DB7A 1EIYB 1L3SA 5DM73 4JI6L 2Z4IA 2AJQA 1SYGA 3QZ8A 2K4IA 1Z3EB 4CE6A 5J2FA 1STGA 3RJEA 2O2LD 4LMQD 2M00A 2ZJPA 1GVPA 2GVAA 1WCNA 2DPIA 3I90A 5ALOA 5AKEA 3A0BU 1IKMA 2Y1IA 2MFIA 5FLXL 2IW3A 4DQIA 5J29A 3V6JA 2JE6I 4KLQA 1C4QA 4ILWA 1M8AA 3V6KA 2PI2E 4Y2QA 3FC4A 4JBMA 4BWJA 4ODGA 3E0FA 2VS1A 1HNZL 1HXYD 4DV0Q 1BBXC 3NVVA 1S10A 2BCQA 1E22A 4ZUIA 1JX4A 4JCVE 4DV4L 4IR1A 4EEYA 1NK5A 2G5HB 2R8IA 3A0HU 4A3GH 3PNCA 4K2KA 1GUSA 3WOEA 3BDOA 1OXTA 2GA4B 4A93H 4V0BA 3NBHA 1P16A 3NPPA 5I2YA 4KMUA 4DAVA 5J8YA 2I6XA 3OTQA 2V4QA 1N56A 4YCWA 3BYTB 3WOFA 4HIOA 2UU9Q 2I1QA 2F4VQ 1J97A 3JPTA 5J2HA 5JJKA 4O9MA 2JA5G 4F5PA 3RN2A 4B9UA 4QUFA 2F1HA 1SXDA 4BJQA 4L6TB 4DAYB 4O3RA 4RGOS 2EYHA 5EJWA 4KHPL 3LVWA 4A3KB 4A3DB 3RBDA 2W7OA 4DPGA 4YP3A 1S77D 4MIUA 1F2LA 2K8CB 5HP4A 5DLFA 4J9MA 4DR4L 3KLWA 3HOUG 1XTDA 2R7ZB 1PZJD 3MXNB 2WB1F 3Q8PB 2PFOA 3L3OC 5CORA 4A3IH 1DGJA 2JJQA 3PO2G 2HHTA 2BE5C 3UE0A 3NVYA 5AKKA 2X6LA 8ICLA 1FGBD 3KF8A 1Z1VA 3VYTA 4LW1A 2LYAA 5TSSA 1Q90A 3M8SA 2OT2A 1MSWD 4IJLA 4NXNL 3F5AA 4ELVA 1IBKQ 3EBEA 4FZNA 1N34Q 5EE3A 4YMOA 2V4DA 4S3SA 4JI5Q 1JN3A 4GIBA 5C4XB 1SV4A 3PO3G 4JI1L 1U4LA 4L5TA 2C9OA 4O0IA 3I73A 1J2MA 1FFUA 2PZTA 9ICCA 4CBVA 1LB2B 5DDMA 3JAML 3HOWH 2JR5A 2PFQA 1F9QA 1PFBA 5EPKA 3H09A 4O3NA 4DR3Q 1B9MA 2AQ3B 3SI8A 4C4SA 5L1KA 4UB4A 4GFJA 4A3FG 1O03A 4XXEA 2B63H 2F3WA 3PMNA 2F1IA 1K0RA 2KVMA 4I7ZC 1DGSA 4XQNA 3H0RB 1CRXA 3RZDH 3RZDB 1K1QA 4CDCC 4EX5A 3ER0A 4X5VA 4PGQA 3K5MA 3U9SA 4Y7NH 1L7NA 3RBEA 1PUZA 3J81L 5BN5A 5M9OA 1R4PB 2SNMA 3BJUA 1HJPA 7ICUA 2EZZA 3C5GA 1E3PA 1XMOQ 2Y9TA 3A8KE 1GM5A 2MNAA 1SE4A 4UW9A 3HOWB 3VR6A 1Q46A 2MAXA 1V1PA 1SZPA 5AKIA 2SNSA 2D3DA 2FJ6A 4UAWA 2XY6A 3E6ZX 2A6ED 3NTHA 4ED3A 1HUOA 4LFAL 2YU9B 2YYZA 1DD2A 4QZAA 5JJIA 4OEMB 5J3BA 1LTAD 3OIQA 4C3IH 4DR6L 1WTPA 4FO6A 4LF4Q 2J6UA 2SOBA 4KHPQ 5GTIU 5DGAA 5CRXA 5IT9E 4BXXG 1FD7D 1JMSA 1HTLD 3H7IA 2JEBI 1PH2A 1NJIC 1NUCA 1ZOLA 5HY6A 1JB3A 3ERSX 4IN3A 5DEHA 1L7PA 5B5EU 1QVCA 1ZQXA 3DEEA 3C21A 1U47A 1P8LA 3TFRA 3KK7A 3UXNA 5EKLA 4G57A 1ZD4A 2H3ZA 2KE7A 3NGDA 3OPOA 2K52A 7ICHA 2I5MX 2JN4A 1IBML 1VF5C 1LVHA 1SAPA 2WAQG 4H44C 1TWAB 1WTHA 5M5XB 2NVQH 4FZLA 5K4LA 1MKHA 4ABNA 1MD2D 5AKJA 1NK4A 7ICMA 4GKJQ 1TFRA 4ED0A 1GOZA 5IYCG 3T53B 4UB5A 4B9LA 2D5DA 1G91A 5J8YC 1F2ZA 5IGGA 1HUNA 1K9MC 4Y2SA 5JAVA 4HR7B 3S1NB 2KEYA 4YXJA 1H38A 1U48A 5EPJA 4CJ2C 4IUVA 4PHAA 2EOTA 8ICFA 5AHXA 2B2WA 2P5ZX 4KJOA 1QZHA 3ZD9A 1L1OC 2YTXA 1Q8KA 1XTCD 3SK6A 2ZXHA 2A19A 4O3MA 3JAMc 1U0LA 3MAQA 5AK6A 4NXMQ 2YY6A 5ALTA 1TK8A 1UE7A 3BVMA 1HQMC 4K6DA 5IILA 3EJIA 4LFCL 4ED2A 4E6IA 1PH5A 2MO1A 2AUKA 7ICEA 1D5ZC 5JVH3 1EY9A 3CRLC 4P0PA 2N88A 4RGNA 8ICOA 4JUZA 3V7LA 2ESEA 1Z7TA 4JG2A 4BY1B 3K7AB 1BPBA 2L1BA 1Y69U 3OJSA 3QUCA 1G8ZD 1PRTD 1SXTA 4OD0A 4Z6FA 3S14B 4NDXA 3H8SA 3T5HA 1WCMG 3D2QA 2F77X 2D0OA 5A2QE 4DL7A 2EY2A 4I7AA 3CCRA 1UT8A 1D8LA 2QB1A 3QU5A 2EAMA 3PSTA 4NL9C 3AQFA 1CA5A 4IALA 3HP6A 3ETRA 4IO9A 4FS2A 4R65A 3GTMH 1JWUD 2LSSA 2KV2A 2WIIB 2K7VA 5FLMG 2BQUA 2PQAA 5CV9A 4B3RL 3BU2A 2UUCQ 3F2DA 3I91A 3SE0A 2W3SA 4KLJA 1NR2A 1HR0W 3H40A 4Y2UA 4A76A 4K0KL 9ICMA 2K4KA 2ZJ8A 5KNIA 1VQIA 2PMZC 3EPIA 3T13A 5FJ8H 4WRDA 3UE1A 4NP5A 2HD3A 3PSIA 1CQVA 2PMZB 5C44B 4JB3A 4KTQA 4AYBF 1LM0A 1TS3A 8ICZA 2DNEA 3AFQA 5KNBA 4DV2L 3M4YA 1VQMA 2FPLA 4DV1Q 1L3TA 4J9KA 1A63A 5BOMA 2L12A 2FMCA 3LK9A 1JMCA 2VA2A 2XIDA 3WKEA 1I4PA 2FDRA 9ICLA 3I4OA 4UATA 5K5PA 2RRDA 1PK1B 3QUTA 2XGQA 5M5WB 1J5EQ 2R92H 3VDYA 4G9BA 2C22A 5D49A 4F5QA 3HEJA 3FM9A 3HOZB 4EYHB 4BA2I 3FVQA 2AH5A 4DFDA 2OM6A 1BUVT 3ULLA 3T1HL 1T3QA 4DV4Q 2BE5D 3AUOA 3BDPA 2G5DA 4X3KA 1JALA 4I2JA 1NTGA 5FK9C 2FLLA 5KRUA 1YHQA 5AIBA 3GTKH 3MGHA 3BQ7A 2KZZA 2KMDA 2CHBD 2HDMA 3GIIA 4B9VA 4KLEA 1CK1A 2CQOA 2K5HA 3TREA 3GV3A 1SFOB 1TVAA 1T8EA 2UUAQ 1WTQA 1NR4A 2XRQD 5KT5A 5DLGA 2L5TA 1K8GA 3RH5A 4DSKA 3GTJB 1SGGA 5CGKA 3KZIU 4ECQA 4DO9A 2QILA 4QWCA 4RU9A 1NSNS 4BBSB 4ECSA 2QDBA 3M3YB 3SR6A 5JRTA 1I4RA 2BH8A 1F9RA 2F0IA 4C2MH 3LDAA 2BDPA 3KYHC 2ZXIA 1EWHA 1SNCA 3ISBA 3GIKA 1EUJA 4PV1C 5AKXA 2AXTU 3S1RH 2IOFK 2NRZA 2VJ4A 1Y1VH 4JW0A 3VA7A 1H9KA 2A1JA 1XO0A 4JOIC 2QB0B 3V7JA 1UNSA 4F91B 1PYWD 1DOKA 5TISU 4BXOB 1D1KA 5M5YB 3X3NA 3IRBA 1S5ED 5I9OA 1ZQNA 4MFFA 1SSOA 3MR5A 8ICBA 2QEXA 1RHPA 4LF9L 4A3DH 1CHQD 3CPWA 4EEKA 1XPRA 3B0YA 5KTQA 5C4ZA 2W04A 4YMMA 2JZBA 1OXSC 4FBUA 1NMFA 3RLOA 2RVLA 1OW5A 2ES6A 4I2DA 5EE1A 1CKOA 1RQNA 1Y1VG 5JJLA 3SD7A 3EROA 1SMYC 3WK4A 1SMXA 2KHJA 3UXOA 5KYLA 4JYAL 2WF5A 2F0WA 2WB1G 2PCFB 4M9GA 4FF2A 3JPPA 2NRTA 4JI7L 1L3VA 1H9SA 3MEHA 4QF4A 5H2FU 2FLPA 3F5EA 2ALZA 3C3LA 5AKYA 1ZQDA 1E0BA 1TWGB 3I28A 2QARB 4DNIA 1A6XA 1B4FA 4DS5A 2WKCA 1TU2B 4A3BH 1PH4A 2YTYA 5ALIA 4DOAA 4N9PA 5J2AA 5TZVA 5KFDA 1X56A 2PZWA 1FL0A 5ISRA 3AL0B 2HW3A 1EZ6A 3GTQB 4DR1Q 1I6VC 1IIPA 4DSIA 1RTNA 3VR5A 2P6RA 3J80i 7ICOA 4AH6A 4KY5A 4IFDI 4ECUA 4BY7G 3HOVG 2QA4A 4AYBE 2K4EA 2PPBC 4C2MB 3RH4A 4YD1A 4KLTA 4BBRB 1SB3C 1EY7A 3R2IA 2B29A 4ZAIA 4AYBC 1X3GA 4Q0FA 1EEID 3ZDDA 3M4QA 1L0YB 2HCFA 4M6WB 2R61A 2DL0A 2H3VA 4FO2A 1M4VA 1YI2A 2EQYA 3SV4A 2UUCL 4B3TQ 3GTQH 2E8NA 3G48A 4IUNA 1J9OA 5FLXc 4PG3A 1UQVA 4QGUA 4ZKCB 2LMRA 4UBBA 2CXYA 2HHVA 8ICAA 2AGQA 2DN8A 5LL6S 4AQYL 2JA7B 2O4XA 1ONLA 5K36G 1NJWA 5J0YA 1KDAA 1PRTC 3N7RC 5J0WA 1JCKB 4EQNA 1YJNA 5AICA 2VIXA 3QYPA 3VC8A 4J9QA 3PUVA 3CKIB 4QUCA 2YTUA 2HBMA 4KLLA 1D9FA 1ZQTA 3T16A 3HOZH 3QEAZ 1L0WA 4QWAA 1KHIA 4C56C 2W55A 3PO5A 3WDNA 5GAHC 1PH3A 1XNQQ 5ALDA 1WUDA 4C3JH 2DGYA 3E5SA 1EWCA 2RDHA 3K58A 3PUXA 1QH9A 4XQQA 2VKQA 3RFAA 2PMZE 1V43A 5D3DA 1DOMA 2OXOA 2JGAA 1VDZA 4A3BG 3NENA 3BS5B 2G9HD 5FO7B 2KBNA 3EN2A 1I3QB 2ZIVA 3RD4A 4JBWA 3STBC 1SYBA 4F50A 2L0CA 4QZGA 2KCTA 1ZRMA 2EZXA 4RPYA 4KLOA 1KAAA 2VQEL 1HNWL 1WTVA 2F0JA 4U6PA 1ZQVA 4O3OA 2EYMA 1RPLA 4QZ9A 3FAHA 3I4NG 4GZYC 1Y1VB 4N8X1 5B66U 2Q2UA 2ZIXA 4K2LA 2ODGA 3JPRA 1Y14B 3H3VH 4R63A 1RYUA 3V6HA 1CM9A 3K59A 4GKKQ 1SKWA 1S3OA 3OMCA 8ICGA 3E2EA 4R4QA 4DR6Q 1AFPA 3RJKA 5C0XJ 1G2SA 2E2HH 4JV5Q 3M3YH 4DR2Q 1JIHA 5DNFA 1TKDA 3HILA 5COYA 4ECXA 3I8ZA 3UQ2A 3GTJH 1A15A 1B43A 2KFNA 5DAUA 3EZ5A 3HRZC 2BA0A 4HIMA 3PO3B 4B3RQ 5D14A 4JI2Q 4RCNA 1B7YB 1SNOA 3IG8A 2XCPA 2UXDL 3ONAB 1JJGA 1DK3A 2WHEA 4NXZA 4P73A 2A68C 3J7YW 4R9WA 2F0DA 3J7AV 3K8AA 1KRSA 5F9LA 2ZJQA 2G0AA 3CU7A 3HGBA 9ICFA 2OF1A 2A6HC 2LXKA 4QW8A 2ID0A 3J80E 2EAOA 4DSLA 1YIJA 3HOXH 4B3SQ 1T5EA 1ZEQX 1CFMA 2H3FA 4LF9Q 4DV5L 1LTGD 2JH1A 1X9WA 2KK0A 2ZT9C 4A3MG 2ZTEA 1I5FA 2X69A 2Q4TA 1DOQA 4QIWB 1ZKOA 4DF7A 2JHDA 2DKZA 2W9CA 1V1QA 2B2UC 2GN5A 5IGBA 1HNXL 1OXXK 4PZ6A 4DK0A 5IP9G 4PMWA 5FO8B 2QLTA 4R8UB 2W7PA 2GO7A 3A55A 4I65A 1MQ2A 4A3FB 4O3PA 8ICIA 1NCVA 2NZHA 1YVCA 5KFNA 1RCVD 5GAEC 4MN3A 1C48A 2D9UA 2PKEA 1L7OA 1ZD5A 3GTGB 1QUQB 1BQQT 2XIWA 3NHHA 1JORA 1JRPA 4IURA 4X66Q 2NWGA 3PF5A 1VQ4A 1COOA 5E3FA 4LF8Q 3LGJA 1CA6A 2F0LA 4LNQA 4OJPA 5AK5A 2HHXA 5CV8A 4Y2TA 5KFJA 3KZXA 2B2TA 1L8OA 3MFYA 4LZDA 3EPGA 3W3AA 4TUPA 3SK5A 5KFKA 2R93B 2BCSA 4LUVA 2RSOA 1B53A 2WF9A 5JEAG 3E0EA 4X65L 4DWIA 1EOTA 2ICIA 1ET9A 3NK9A 1IV8A 3AQEA 5E4XA 1S0MA 5HGQA 5C44G 4C8NA 2KD1A 4G7OC 1PRTF 2Q2HA 2XSCA 4CDFC 1TK5A 2KJ8A 2AGPA 3K7AH 5CHGA 4IUQA 4LUZA 2UXCL 2OQKA 4NPSA 5L1LA 4KX5A 1O08A 3KHGA 1D5XC 4FNFA 1U5KA 4Q43A 1LLRD 1PK3A 3FKIG 4RFBA 5DBCA 4FXKC 3KF8B 2ZJRA 4CNQA 5AM2A 3PIP3 2FHTA 2OWOA 1XMQL 1PZID 3RLFA 2XGTA 3PQIA 4AYBB 1ZRNA 1KABA 5J0OA 5LMNW 1H9RA 1QQ7A 2LKYA 4PZNA 4BA1I 1U4RA 4HAIA 5ALLA 4GOPC 2I0QA 1YJ9A 1B8AA 3GQBA 3S1NH 2B2TC 3ED5A 4ZH4A 3TQYA 1EXNA 5JEAH 1F44A 1X9NA 1NKCA 4GC7A 1S5FD 1GUTA 4TUQA 2O5IC 1J2NA 2DQNB 4FF1A 1XC9A 1X9SA 2JEFA 4IR9A 4NKLA 3AEVA 1XNQL 1A62A 4DL2A 7ICRA 3KD3A 1PZNA 1UEBA 2DBYA 3QUQA 2QDLA 5FKAC 4XYQA 3HKSA 1WTXA 2F52A 4UBCA 4B6JA 1K73C 5D4BA 2K4HA 3AYHB 3GDEA 3I7FA 1VQOA 8ICKA 4UAYA 4OWWB 4C1NK 2SEBD 3MR3A 2ZUCA 3MVVA 4LF5L 5HHIA 2JQOA 3ICEA 2FMPA 3WK9A 3NVZA 2R3ZA 1VQLA 4Y2JA 1PTOH 4J9SA 3C1EA 1LT6D 3OHAA 2BZFA 1PTOD 5FLXE 5IP9H 2KKPA 2EY1A 3QB3A 5IGCA 3CCSA 4Q45A 2NB0A 2M9VA 3G4SA 4DK1A 3WKDA 2YU9H 3D6CA 1QCKA 3RMHA 3SEBA 4C0ZA 3N97B 3IFDA 4KY7A 1ZD2P 3PMFA 4QL5A 1K3RA 4RHRA 3ZDCA 4BGDA 1PYSB 4OGQC 1S72A 4X64L 4F4ZA 1QSLA 5EQ0A 1HR0Q 2KHSA 4ZUJA 4CHTB 3EWAA 9ICEA 3RUZA 3BZCA 5I2XA 1KIXA 1HA6A 4F3OA 3M6KA 9ICKA 3EYZA 2KA7A 3MBYA 2PNHA 1UEAB 1B0XA 3BQTA 3C1FA 4KV6A 5ALEA 1EY5A 1SDFA 1X2IA 1WOCA 2JXMB 2R93G 5KFUA 1RDFA 1BBUA 1X54A 3FMCA 5A0LA 5KGUA 2B63B 2JA5B 3WKAA 4YR3A 4CRXA 9ICXA 1CQFA 3R9KA 1JE5A 4RGTA 3TP6A 2B8GA 4IL6U 4BS9A 4M8AA 4J15A 4NJ8A 4X62Q 4DV6Q 1X65A 2SDFA 1RG6A 2I5HA 1SRUA 1S40A 1N9WA 3FEWX 1U4BA 1BPEA 2KFZA 4XDXA 8ICTA 1HHVA 2NYVA 3PZPA 3RAXA 2BA1A 1WD1A 1KFTA 1ILQA 1V8QA 2HUGA 4ZKBB 4PL2A 5C4XH 1JOOA 2JV3A 2IX0A 4P74A 4HJ7A 8ICSA 1R9TH 1TAUA 5J0RA 2ZIWA 2B8FA 5IIMA 4E0DA 2RDFA 4YY3L 2R93H 4IRKA 2B39A 5FOBB 4NWIA 4H7BA 2LM4A 4R4IA 3RR7A 2L55A 2IWHA 3CCEA 4TUSA 5KFGA 3DM1A 1BNOA 5AK4A 1A3VA 5E4WC 4UP8A 4B9SA 1XWLA 2ZTCA 3GV6A 3PMLA 1U9RA 2OH2A 4OWXB 4LJXA 4MZ9A 9ICPA 1MJEA 3IHQB 3HOWG 1XPOA 3PUYA 3K75D 1UWVA 2KG5A 5KFBA 2KIWA 5EWFA 9ICOA 2DNCA 3CP0A 2ZM6Q 4DR7L 2R7FA 3HPOA 3GILA 3SAFA 4I2FA 2VY3A 1GHKA 4UAZA 4MNOA 5JUMA 4APVA 5IINA 4R8IA 4JI8L 1V85A 1SLJA 3TSSA 4EQOA 1BPDA 1UA0A 3FKIB 4LF4L 3PSPA 2BHNA 1L7MA 2PQAB 2V9WA 4I2EA 2MPMA
chains in the Genus database with same CATH topology
3CCMA 1ASYA 2HHHL 4X6AH 1PFSA 2HQLA 4IPGA 1WYDA 1QZHA 4L5QA 1HZAA 2N8NA 1L1OC 2YTXA 1Q8KA 3KF6B 2ASBA 2A19A 3JAMc 1BBWA 1U0LA 3NBHB 3M85A 4NXMQ 1Q12A 1UE7A 2QGQA 4LFCL 4IJHA 1EWIA 1PH5A 2MO1A 4R1JA 1Q81C 1HZBA 4IPCA 5C4JH 4O2DA 2E2JH 4Y52H 4JG2A 3W1BA 1LYLA 2VQFL 2FXQA 1EYGA 5GROA 4BXXH 1HH2P 1PYBA 3G6EA 1RIPA 1SE8A 4R4TA 1IBKL 1WCMG 2D0OA 4GN4B 3PUZA 1VQGA 2LXJA 2R7ZG 4WJ4A 3CCRA 1AE2A 1D8LA 3CQZH 4IPHA 4OONA 3GTOH 4YCVA 2RCNA 1IBLL 1PV4A 5IWAQ 5JEAJ 4IO9A 1JJ2A 1I94L 3GTMH 1G291 1YEZA 2LSSA 5FLMG 3I55A 2JA8G 2PQAA 4B3RL 1Q82C 3BU2A 2UUCQ 3F2DA 4HJAA 1HR0W 2HIVA 4A76A 4K0KL 2ALYB 3DM3A 2K4KA 4LF7L 5FJ8H 1VQIA 2BH2A 1PH8A 4LF6L 2N78A 3KF6A 5M3MG 1YHBA 3S17H 3PSIA 1MJCA 1K83H 2R7DA 1LM0A 4DV2L 4KHPQ 4GKKL 3AFQA 1EIFA 1CKNA 3UDIA 1VQMA 2A1AA 1TWFH 1X6OA 2Z6KC 5C4XG 4DV1Q 1C7YA 1A63A 4PZ7A 2HT1A 4AYBG 1JMCA 3L7ZC 3FP9A 1VQJA 1UE1A 3OYYA 5FLMH 2E5LL 3I4OA 2JA8H 4DR4Q 1I6HH 1J5EQ 4DV3L 1PH7A 3VDYA 4JI2L 1K8AC 2R92H 3W5OA 2VQEQ 5BR8L 3M7NA 2RHSB 4JOIA 1YZ7A 4JI0L 3MEFA 4LFAQ 4LF6Q 1FJGL 4BA2I 4K0KQ 1H95A 1IYJB 5GADC 4JI4Q 4KI0A 2XTIA 3ULLA 3T1HL 1PVOA 2IT1A 4DV4Q 4OO1I 1JJCB 4JV5L 3RR5A 2JK8A 1YHQA 1NTGA 2YTVA 1W2BA 5IYBG 3J81c 4UPAA 1I94Q 1I50H 2JA7H 3GTKH 1E24A 4JC0A 3CC4A 1M90C 4X62L 2CQOA 4KHZA 2K5HA 3TREA 5IWAL 2OTLA 2UUAQ 1JT8A 1OXVA 5IYBH 1N33Q 3PO3H 1K8GA 4IFDG 2WB1E 2VZAA 3CCLA 3J81i 3F1ZA 2NVTH 2Z0SA 3A74A 4C2MH 1YHAA 2BH8A 4UY8C 4AIMA 3CF5A 3J7ZC 3KYHC 4A4IA 2VNUD 1KD1C 1PH9A 1W3SA 3A5UA 5IYDG 3Q8DA 1EUJA 4OX9L 4GKJL 1A8VA 4DAMA 4YCUA 4A3EG 3ZJYC 3S1RH 4JI5L 4LFCQ 4BY7H 1Y1VH 2PI2A 4UP7A 4JOIC 4X66L 2VW9A 1IL2A 3L0OA 3D0FA 3CAMA 5E7NA 4HJ8A 3IRBA 5IE8A 2ATWA 1Z47A 1SROA 1TWGH 1I3QH 2QEXA 4A3DH 1L1OA 1VQ9A 4LF9L 3S16H 2N49A 1B70B 1C9OA 3K7UC 2OCEA 3CPWA 3J7A5 1CKMA 1XPRA 1GKHA 3KDFB 2K14A 2IX1A 4PZ8A 1YJWA 1OXSC 1NMFA 1TWCH 2NN6I 2CWAA 3RLOA 5AJ3Q 3HOYH 1SN8A 2JA7G 5IP7G 3U4ZA 4DR1L 1WCMH 1CKOA 4DR5L 1Y1VG 4XTCS 5JJLA 2UU9L 4GLAC 3H3VI 1SMXA 2KHJA 4JYAL 4YWMA 5BR8Q 4BBSG 2WB1G 3PIOA 4JI7L 1RL2A 5LMNL 5DLQE 2K50A 2HIXA 2WFWA 2ZM6L 2E8GA 3ULJA 3M9BA 4DNIA 2IY5B 3W1GA 3S1MH 4A3BH 4GN5A 3CC2A 1PH4A 2YTYA 1PA6A 4YHHL 1VQ5A 4OWTB 1J5EL 3F2BA 1X56A 4GS3A 1G51A 3STBD 1FL0A 2E5LQ 1KQSA 1QVGA 4DR1Q 1VQPA 3HOVH 2R92G 2WAQE 3NEMA 1AE3A 1IZ6A 2VL6A 2GVBA 3J80i 2NVXH 2YV5A 2V1CC 4AH6A 4DV0L 1VQ6A 4BBRH 4OXPA 1QZGA 3OTOQ 4IFDI 3AFPA 2UXDQ 3I4NH 4QQBX 1X3EA 1G6PA 3KDFA 4BY7G 3HOVG 2QA4A 4AYBE 3U58A 3H0GH 3EIVA 1N32L 2JA9A 4A3MH 1V9PA 2E2IH 1Q1EA 2CFMA 1XNRL 2UUBL 2B29A 2D0PA 2AHOB 1X3GA 4R4OA 4JI1Q 4QY7A 3M4QA 1EQRA 1VQHA 4QIWE 4TVAB 4GNXA 1MIUA 2ZTDA 4DR2L 1YI2A 2UUCL 4B3TQ 2Y0SE 4POGA 3GTQH 4JYAQ 4UP9A 3G48A 4OO1G 1CKNB 5FLXc 3CCQA 4PG3A 1SFOH 3I4MG 4QGUA 4NB3A 2HHHQ 1BVSA 4AQYL 2OTJA 2RHQB 5K36G 3H0GG 4FDBA 1O7IA 4DV7L 1YJNA 2EIFA 3PUVA 4NXML 2K5NA 4LF5Q 2R6GA 1EQQA 4BBRG 3HOZH 2RF4A 1N33L 1L0WA 1HR0L 1KHIA 3ULPA 1PH6A 1D7QA 5GQOA 3F8TA 2EQSA 1L2FA 5GAHC 3CXCA 3HKZE 1KC8C 1VS0A 1PH3A 4C3JH 2DGYA 3RNUA 1XNQQ 2UXBQ 3PUXA 1VQCA 4DV7Q 3A0JA 1TXYA 3HKZG 2PMZE 1V43A 4A3BG 1PH1A 3NENA 4B3MQ 3J80c 4A3CH 4DR7Q 4NXNQ 2KBNA 4GN3B 5C0XG 4JI3L 3EN2A 5C44H 1KAWA 1M1KC 4JBWA 3STBC 1YZ6A 4GNXB 1FGUA 1HZ9A 3UE1A 2OQ0A 5M5YH 4B3TL 1YNXA 2KCTA 4A3CG 2VQEL 1T9HA 1HNWL 1LTLA 5LMUL 4L5RC 4LWCA 3I4NG 1FVIA 4O0AA 3J81j 2AWOA 4R4CA 4TQUS 2Q2UA 1YBYA 3KFUA 1EOVA 1Y14B 3H3VH 3I4MH 4LFBQ 1YITA 4A3KG 5IY0A 4GKKQ 1S3OA 4R4QA 4LFBL 1BKBA 1J6QA 2Q2IA 4XIGS 1Z9FA 5H1SE 4POFA 1EFWA 2JA6G 5C0XJ 4DR6Q 2E2HH 4JV5Q 2A8VA 4DR2Q 3M3YH 4BBSH 4B3SL 1Y1WG 3S14H 1WJJA 4HIDA 1VQAA 3I56A 4P72A 3GTJH 3M4OH 1IXRA 5C0XI 2DUDA 3PCOB 2Q2TA 2BA0A 3F2CA 4HIMA 4JI0Q 1GD7A 4B3RQ 3CW2C 1L1OB 4JI2Q 3DLLA 1E1TA 1B7YB 2NZOA 3RLNA 1HNZQ 2UXDL 1JJGA 4P73A 3PGZA 2MQHA 4B3ML 5M3MH 2VUMH 1NMGA 3K8AA 1KRSA 3TS0A 4A3DG 2ZJQA 3K80C 4H02A 4A3LH 3OW2A 2LXKA 4B3SQ 1YIJA 2ID0A 1UE6A 5IT9c 1X55A 3KJOA 2NVYH 3HOXH 4LF9Q 4A3IG 2JEAI 1QVFA 3HOUH 4DV5L 1N34L 3S2HH 3NELA 3E9HA 4A3MG 1KRTA 2ZTEA 5EAYA 1SR3A 1I5FA 4DR5Q 3S1QH 4ME3A 4DK3C 1KL9A 2GN5A 3HOXG 1HNXL 1V1QA 1AH9A 3H15A 4A93G 1OXXK 1CUKA 3PUWA 4PZ6A 3UDXA 5IP9G 5M5WH 1GO3E 3GD7A 4PMWA 4X64Q 2AMCB 3CC7A 5LMNQ 1CSPA 5LMUQ 2EXDA 3T1YL 1PHJA 4IFDJ 4LUOA 5ELOA 2NZHA 1YVCA 3AQQA 5GAEC 1N36L 2KCMA 4P75A 4YWLA 1TWHH 1QUQB 2K5VA 4X66Q 1VQ4A 4GOPA 3PF5A 4LF8Q 3LGJA 3CMEA 4LNQA 1NBWA 3B6YA 3KJPA 2F3IA 2VQFQ 5M3FH 3T1YQ 3D31A 4IPDA 3GTLH 2IHFA 1OXUA 1HZCA 3CPFA 1VQFA 3PIPA 1N32Q 4EQ5A 4AQYQ 1EIYB 4JI6L 4LUVA 1XJVA 3UDFA 5JEAG 3E0EA 4X65L 2ES2A 3I2ZA 4YWKA 1OTCA 5HGQA 5C44G 2ZJPA 1VQEA 1GVPA 2GVAA 4A75A 1WFQA 5IYDH 4DUZL 3CCUA 4A3GG 2Q2HA 2MFIA 2UUBQ 2C35B 3K7AH 2UXCL 2JE6I 4LUZA 4YHHQ 4BY1H 4L5SA 2OQKA 2PI2E 4NPSA 5C3EG 4DV3Q 4JBMA 1ASZA 2VS1A 1U5KA 4ALPA 4DV0Q 3OTOL 3FKIG 1HNZL 2JA5H 1VCIA 1E22A 3KF8B 3U50C 1JB7A 1Q1BA 1UE5A 4JCVE 2ZJRA 4DV4L 4BY1G 1XMQL 1IBMQ 2OWOA 3RLFA 1VQ8A 4JI4L 2KHIA 2Z6KA 2XGTA 2CWPA 4DV1L 4A3JG 4RG1A 4A3GH 1XNRQ 1HNWQ 3GTGH 5LMNW 2B3GA 4MTNA 4GOPB 3S15H 4P71A 2NN6G 1OXTA 4BA1I 4A93H 3CCJA 2I0QA 1P16A 3M4PA 1VQDA 1B8AA 3K0XA 4HIOA 4GOPC 1YJ9A 4YCWA 5IP7H 1XMOL 2UU9Q 2K75A 3TQYA 3S1NH 2H5XA 1X9NA 4RMFA 4DKAC 2F4VQ 2L15A 3GTPH 2Y0SG 5JJKA 3FKIH 2JA5G 3RN2A 3BZKA 5M5XH 1TWAH 4DAYB 5M3FG 1X3FA 1XNQL 3AEVA 1Q7YC 4KHPL 1A62A 1UEBA 4YY3Q 1IBLQ 3HKSA 4DPGA 2F52A 3JC66 4DK6C 4X65Q 1K73C 4HIKA 5ELNA 4DR4L 3AYHB 3GDEA 3I7FA 1VQOA 3KLWA 4OWWB 3HOUG 1XTDA 3MXNB 4A3IH 4LF5L 2JQOA 3ICEA 2AKWB 3FHWA 1VQLA 2JJQA 2IHEA 2WP8J 3HFZB 2CCZA 3UE0A 2R7ZH 3PO2G 2UXBL 1E1OA 4KLKA 3L2PA 2MO0A 5IP9H 3JAMi 4LW1A 4C3HH 1C0AA 3CCSA 4JI6Q 3G4SA 4IJLA 4A3KH 4JI3Q 4NXNL 3K81C 1IBKQ 2YU9H 3WWVA 5AJ3L 3EBEA 2JA6H 3HOYG 3CD6A 4DV5Q 4HJ9A 1N34Q 3TS2A 4JI5Q 3PO3G 4QL5A 4JI1L 1Y1WH 3KOJA 1K3RA 4L5TA 4DR3L 4A3LG 1E7ZA 3HOWH 1S72A 1PYSB 2UUAL 4LF8L 4X64L 3G71A 2I5LX 1HR0Q 1HNXQ 3PO2H 4DR3Q 3BZCA 5IYCH 1N36Q 1KIXA 3GO5A 4A3FG 1Q86C 3S24A 2B63H 1K0RA 2AWNA 1DGSA 2PNHA 4GLXA 2N3SA 3RZDH 4EX5A 4A3EH 3ER0A 1WOCA 2R93G 4OX9Q 4DUYL 1BBUA 1X54A 5FJ8G 4Y7NH 1JE5A 4QJFA 3CCVA 1VQBA 2F4VL 3BJUA 1HJPA 1E3PA 2CKZB 4J15A 1X65A 4JI8Q 3SGIA 4X62Q 4DV6Q 2I5HA 1NE3A 1SRUA 2MNAA 1XMOQ 1N9WA 1S40A 1GM5A 4IOCA 4JBKA 3HOZG 3CMAA 1Q46A 1NY4A