2A1AA

Pkr kinase domain-eif2alpha complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
161
Chain Sequence
SHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
total genus 47
structure length 161
sequence length 173
ec nomenclature
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 2a1aA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2a1aA01
1QVCA 2GVAA 2IHEA 4JBWA 1MKHA 1P8LA 1SMXA 2UXBL 1SE8A 4IO9A 2R7ZH 5GAEC 1X65A 1HZ9A 1WCMG 2A1AA 3CMAA 4H02A 1AE2A 4A3IG 1E22A 1VQNA 3RR5A 2K50A 4HIOA 3PUVA 1MIUA 2ZM6L 2HIVA 1BKBA 4A3JH 4OWTB 1H95A 2JA9A 3I2ZA 4IJLA 4DV7L 2PNHA 3OTOL 4JI6L 4FDBA 1HNWQ 4R4QA 5GQOA 5FJ8H 3CC2A 1AE3A 1PH4A 3L7ZC 1VQGA 2KCTA 4JG2A 4UP7A 3D31A 1HJPA 2CFMA 1HH2P 4LF9Q 3I4NH 3PUZA 3K80C 2K75A 1SFOH 4JI4L 4LF8Q 4AQYQ 4BY7G 1V1QA 3J80i 4Y7NH 4IOCA 1VQCA 1EFWA 4DUZL 2B63H 2JA7H 1UEBA 4R4TA 5FLMH 1GM5A 1NMGA 3AYHB 3PO3G 4P72A 1EQRA 1QZHA 1IL2A 2NVTH 3S16H 2UXDQ 5J3BA 1YI2A 1YBYA 1I94L 3S1MH 1G6PA 1X3EA 4NB3A 2R7ZG 4GKKL 1O7IA 1VS0A 1OXSC 3STBD 5LMUL 2KBNA 2ZM6Q 4K0KQ 4DR1L 1ASYA 4DV7Q 4JI6Q 3IRBA 2RHQB 3UDGA 1N9WA 1K0RA 1A0IA 4A3JG 2B3GA 4YWMA 3PUYA 2HHHQ 4QL5A 4A3GH 4BBRG 3KDFB 3RNUA 5FJ8G 2BH8A 2WAQE 3W1BA 4DV1L 3I4NG 2CKZB 2MO1A 5H1SE 1PHJA 2C35B 4DUZQ 4GKJL 1Y1WH 2B63G 4DUYL 2UUAL 5C0XJ 2JA7G 2IT1A 4EQ5A 5FLMG 4A3KH 4X65Q 1I94Q 2KCMA 2QEXA 2PQAA 4GKKQ 2BA1A 2K5VA 1VQBA 5LMUQ 4XTCS 4IPHA 4DR1Q 1QVGA 1JT8A 3SGIA 2B29A 5IP7H 1J5EL 4X62Q 1JB7A 2YTVA 3L0OA 4B3ML 2AWOA 3EN2A 3K7AH 3TREA 1XPOA 1PH9A 4QIWE 3CQZH 3M7NA 4HJ5A 3J7A5 4A3GG 4A75A 1C0AA 4GN5A 1E1TA 2E5LL 1KXLA 4DUYQ 5M5WH 2UUAQ 2N3SA 1X55A 3CMEA 4KI0A 4R4IA 1Y1WG 2JEBI 3J7ZC 1Z9FA 3CD6A 4YWLA 4UP8A 1HNZL 4YWKA 3B6YA 3HKSA 3KJOA 4A3KG 4BA2I 1UE7A 1IXRA 3HOVH 2D0OA 5E7NA 1V9PA 3PV0A 2FXQA 1PYBA 1PH7A 1YITA 4J15A 4GNXA 1YJWA 1VQDA 5IP7G 3GDEA 2RHSB 3WWVA 4B3RL 3CCVA 1LTLA 2RF4A 3PIPA 3GTJH 2L15A 3PIOA 3F2BA 3U4VA 4APVA 2ZTCA 1OTCA 2E5LQ 1RL2A 1BVSA 3GTMH 4LFAL 4GOPB 3KYHC 4GN3B 2JA5H 3MXNB 4JOIA 4AYBE 2NN6G 3K0XA 4IPDA 1NTGA 3BZCA 3G4SA 1HNZQ 4OX9L 4DR7Q 3TEHB 1A63A 3CCSA 1WI5A 3UDXA 1YJNA 4DR6L 1GD7A 4JYAL 4L5QA 4P74A 4POGA 4LUZA 3H3VI 1JJ2A 3K8AA 3HOVG 2Q2TA 2Z6KA 3RLNA 1VQAA 4LF5L 4PMWA 2D0PA 4TVAB 4B3RQ 3PUXA 3D0FA 1K8AC 2I5LX 3U50C 4OWXB 2ASBA 2V1CC 1Q1BA 2K52A 5C0XG 3W1GA 3BZKA 2Q2HA 2VL6A 3E0EA 4LFAQ 4DAMA 2Q2UA 3HFZB 1PFSA 1SROA 5ELNA 5C4XH 4POFA 1Q81C 2NVYH 4JI7Q 4OX9Q 4R1JA 2JA5G 4RG1A 3TRZA 2XGTA 4DR6Q 4JYAQ 4O2DA 5M3MH 4GNXC 1TWHH 4HJAA 1X54A 4B3SQ 5GAHC 1VQ7A 1XNQL 2NZHA 2YU9H 5IE8A 1XJVA 1YHAA 4UY8C 2VNUD 3H0GG 1M1KC 2MO0A 4AYBG 4DV4L 5GADC 4HIKA 1IBML 5LMNW 2OWOA 1BBWA 3I7FA 4IPGA 1IZ6A 1Q86C 3H15A 2HIXA 3M9BA 1VQHA 1LUZA 3A5UA 2ATWA 3J80c 3CCUA 4IFDJ 3NBHB 4A3EH 4JOIC 3CCQA 1PH2A 1SRUA 2JA8H 3CPFA 3GTLH 1KRTA 3BU2A 1EUJA 1MJEA 5C44G 1HZBA 1HNXL 5C4XG 2Z0SA 1X3GA 4HJ7A 3KJPA 4ME3A 2ZJPA 1KHIA 4R4OA 1N34L 4MNOA 2K4KA 3W5OA 3S1QH 1D7QA 2AKWB 2YYZA 4GOPC 3EIVA 1G291 1Q12A 2OTLA 1XNQQ 2LXKA 4DR3L 1I6HH 2VS1A 5M3MG 1KIXA 1UE1A 2AWNA 1RIPA 5LMNL 4DV4Q 2R7FA 1W2BA 4DV2L 4A3BH 1IBMQ 4O0AA 3PF5A 5C4JH 1AH9A 5IYBH 1VCIA 5ELOA 3OTOQ 3S15H 1J6QA 5IYCH 4IJHA 2VQEL 1L1OB 2GVBA 3NENA 1QUQB 4DK6C 1Q46A 2PQAB 3JAMi 4A3MH 3J81i 1KD1C 1K83H 4A3EG 1ASZA 4JI0L 4JI4Q 1PH3A 2JA8G 2CWPA 2UUBL 3S14H 3I55A 1XTDA 3KOJA 3PO2H 2N8NA 3S2HH 5GAGC 4C2MH 3GTGH 2CWAA 1N33L 1X56A 4A3LH 2UU9L 1N32L 2UXCL 4DR3Q 1KQSA 3RZDH 1L1OA 2JJQA 4QGUA 1PH8A 4JBJA 4LNQA 3JC66 1QUQA 5LMNQ 1NY4A 3MEFA 3OW2A 3U4ZA 4BXXH 4A3FH 4A3BG 4JI3L 4C3IH 3E9HA 1HR0W 2VQEQ 4HIDA 3S2DH 4JV5L 2RCNA 1TWCH 1K3RA 2Y0SG 4JCVE 3M4OH 2DGYA 2OTJA 2UXBQ 1TWAH 4DV1Q 1IBKL 4JI0Q 4X6AH 1KAWA 1VQ5A 2UUBQ 3AQQA 1CUKA 1HZAA 1YVCA 1X6OA 4A3MG 4OO1G 1VQMA 4GKJQ 1X9NA 1VQEA 1P16A 3TQYA 5FLXc 2ES2A 1N33Q 1EYGA 1N32Q 1VQJA 1FGUA 3ULLA 4GNXB 3PO2G 2UXCQ 1CSQA 4B3TL 2ID0A 4AIMA 1Q7YC 1XNRL 4A3LG 1PV4A 3J81j 3RN2A 1A8VA 4GLXA 1PA6A 4KLKA 2LSSA 4IFDG 1T9HA 4JI5L 5AJ3L 1HR0L 3CAMA 1J5EQ 4BXXG 4JI2L 4A3FG 4JV5Q 4HIMA 1PH1A 2UUCL 4PG3A 4B3MQ 1V43A 1OXVA 2F4VL 3G48A 4TQUS 2HQLA 4DR5L 1VQ4A 1K73C 1IBKQ 1Y1VH 1S40A 3ULJA 2E2IH 1M90C 5M5XH 1N36L 5EAYA 5JEAJ 1L1OC 3CCEA 4YY3L 2IX1A 2BH2A 2VUMH 3LGJA 5IP9H 1JJGA 3M3YH 3AFQA 3PGZA 1XPRA 4B3TQ 4A93H 5JJLA 1XNRQ 2PMZE 3F2CA 4C3HH 1WOCA 1VQFA 2IHFA 4GLVB 1XMQL 1K8GA 4OONA 1EQQA 2AMCB 3OYYA 2NN6I 5AJ3Q 2E8GA 2N78A 4GS3A 1HR0Q 1JJCB 3HOWH 4JI2Q 1UE6A 3A74A 1G51A 2UUCQ 2K5HA 2EIFA 2BA0A 3S1RH 2F4VQ 5HGQA 1EIFA 2KHJA 4DV3L 4DR5Q 2VW9A 4NXML 2VY3A 2WB1G 4JI8L 5BR8L 4DV6L 1N8RC 4LFCL 1N36Q 3DLLA 3BJUA 1Y1VG 1MJCA 4YY3Q 3I4OA 3VDYA 1QZGA 4DR4L 1CKMA 5C0XI 4HJ8A 1YEZA 2D62A 2R6GA 1B70B 3CCMA 1VQ6A 5IP9G 2VUMG 3S1NH 3GD7A 4WJ4A 2PI2E 3FKIH 4QY7A 2ZJRA 1XMQQ 4A93G 4LW1A 4C3JH 1XPUA 2JK8A 4L5TA 4IOAA 1VQ8A 1YHBA 3UDFA 2CQOA 4UP9A 4LFBL 4JBMA 3HOWG 2OCEA 4LF5Q 1EWIA 1KRSA 5IT9c 2R92H 3CF5A 3PSIA 4RMFA 4NXMQ 1PVOA 5BR8Q 4NPSA 1HNWL 4LFCQ 4LF4L 3DM3A 1YHQA 1C9OA 4P75A 1PH5A 4HJ9A 2ALYB 3A5ZB 2OQ0A 1DGSA 3HOXH 4KHPL 3HKZG 4JC0A 1QVFA 3HOYH 4DV5L 1UWVA 2Z6KC 4A3CH 3FKIG 1TWFH 2UXDL 3HOZH 4OWWB 4PZ7A 5JJKA 2YTXA 3M4PA 1S72A 4LFBQ 3A0JA 3RN5A 1KC8C 1FL0A 1TXYA 1Z47A 3M4QA 3NELA 2Y0SE 4MZ9A 1SN8A 4K0KL 5JEAG 1C7YA 4A3DH 4PZ6A 3PUWA 4UPAA 1SLJA 4BBRH 2QGQA 3JAMc 3J81c 4LF4Q 2R92G 2R93H 1L2FA 2JE6I 2HHHL 3CW2C 1EOVA 1OXXK 5M3FH 2NZOA 2EXDA 4DV0L 2K5NA 3F1ZA 3G71A 3F2DA 2KENA 4KHPQ 3FP9A 1E24A 1JE5A 4DV5Q 1HNXQ 1A62A 3CCRA 3HOXG 1N34Q 1E7ZA 3HOYG 2GN5A 3GTQH 4YHHL 4EX5A 1GO3E 5IWAL 4YCUA 4BBSH 4X65L 5IY0A 3GTKH 4GLAC 4A3CG 2MNAA 5JJIA 1GKHA 3UE0A 2E2JH 1LYLA 3HOZG 1KL9A 1I5FA 4DV2Q 2JQOA 3CC4A 2WP8J 2OQKA 1XMOL 4DKAC 2VQFL 3TS2A 3ICEA 3TS0A 1Q82C 3KF8B 1I50H 3S24A 1NBWA 4X62L 1FVIA 2Q2IA 4A3DG 5C3EH 2WFWA 4DAYB 5IYBG 3PF4A 2IY5B 3AFPA 1YZ6A 2R93G 1OXUA 4DV0Q 2I5MX 4P71A 3UDIA 5IYCG 5M3FG 3ERSX 2R7DA 2JA6H 2VZAA 2I5HA 3M85A 4DR2L 3F8TA 1D8LA 4YHHQ 1CKNB 5IWAQ 2UU9Q 1Q8KA 1K9MC 1OXTA 4LF7L 3GTOH 3KDFA 4OO1I 1B7YB 3CCJA 1CSPA 1VQIA 4LWCA 4BBSG 3CP0A 1XMOQ 2H5XA 2VQFQ 1Q1EA 2WB1E 4NXNL 3ULPA 1UE5A 1Y14B 4JI3Q 2F3IA 4P73A 1WFQA 2HT1A 3S17H 1I3QH 4QJFA 3RLOA 1W3SA 1CKNA 4IFDI 3FHWA 3I56A 3ER0A 3Q8DA 4DK3C 1YIJA 4ALPA 2A19A 5C3EG 4L5RC 4LF6L 5K36G 4KHZA 1LM0A 4DR2Q 3E9IA 4Y52H 3I4MH 1E1OA 4YCVA 2JA6G 1L0WA 1BBUA 3ZJYC 4LF7Q 3H3VH 3RZOH 2WAQG 2QA4A 4QQBX 1B8AA 2A8VA 4XIGS 2NVQH 3STBC 4DR7L 1GVPA 4WJ3M 2NVXH 2F52A 2CCZA 3GTPH 2JEAI 2LXJA 4NXNQ 3K7UC 3CC7A 2IX0A 4JI5Q 1HZCA 4X64L 4A76A 1IBLL 4X66L 1R9TH 3CCLA 3HOUH 5IYDH 4BA1I 3U58A 3KLWA 4LUOA 1VQLA 3T1YL 1PH6A 4BY1H 4LF6Q 4MTNA 3KFUA 5GROA 2N49A 4OXPA 3HKZE 1PYSB 5DLQE 2MFIA 2YV5A 3KF6B 1VQPA 1NE3A 1NMFA 1U5KA 4GN4B 1FJGL 4L5SA 3I4MG 3T1HL 4IPCA 4JI7L 1SR3A 3AEVA 3EBEA 3G6EA 4JI1L 1EIYB 3CPWA 1WCMH 2AHOB 1WJJA 2MQHA 4DNIA 1TWGH 1YJ9A 4B3SL 3H0GH 2DUDA 2I0QA 1S3OA 3KF6A 4X64Q 2XTIA 4X66Q 4LUVA 2PI2A 4A3IH 1IBLQ 1VQOA 4GOPA 4A4IA 4AH6A 3T1YQ 3HOUG 4PZ8A 3K81C 4YCWA 4R4CA 5HY6A 4DV3Q 2ZJQA 1YNXA 5M5YH 5IYDG 3RLFA 1JMCA 4JI8Q 4JBKA 1NJIC 4BY1G 4DV6Q 2EQSA 2KHIA 1IYJB 1WYDA 1YZ7A 1U0LA 2K14A 3NEMA 2YTYA 3PCOB 3CXCA 2E2HH 4DR4Q 1E3PA 4LF9L 4BY7H 5C44H 1X3FA 3GO5A 1VQ9A 1FJGQ 1CKOA 3L2PA 3T1HQ 2ZTDA 3UE1A 4DPGA 4AQYL 4LF8L 4JI1Q 3PO3H 2ZTEA 1VQKA
chains in the Genus database with same CATH superfamily
2CQAA 3PW0A 2YMPA 4I2IA 1P8LA 4ZK9B 3KD3A 1HZ9A 1X65A 3DMUA 4P2CB 4CDDC 1B53A 2E74C 1VQNA 3A0BU 3U26A 2EYHA 1I4RA 1MIUA 1TKWB 3RTVA 2HIVA 3PO2B 4FS2A 1BNOA 1H95A 1KFSA 9ICCA 1L7PA 2W55A 4IJLA 4WORA 3S2HB 3ZDEA 4R4QA 4I2JA 5GQOA 3CC2A 1AE3A 1PH4A 1WTPA 4UP7A 2C9OA 4OL7A 3PUZA 4I29A 2KHQA 3N97B 2H4OA 4AQYQ 4OGQC 4LF8Q 4YVZA 4A3FB 4IOCA 2G5HB 1B3AA 4ILWA 1AP0A 4K2LA 5IINA 5HNKA 1NMGA 2LM1A 4ED0A 5D14A 4DF4A 4F2RA 4QWCA 5FLXE 1TY2A 3MR2A 1G6PA 1YBYA 4CKBA 1TVXA 2LKVA 1TWAB 3H09A 1B22A 3CQZB 2ZXHA 5AI8A 4I7AA 5LMUL 2W03A 2RQXA 1VMPA 5AK6A 4YXJA 3QU7A 3S9WA 1SZHA 2A6EC 1NJYA 2RVLA 1N9WA 1A0IA 3UXPA 2QARA 1M4VA 4IUNA 4ZAIA 1B9NA 1JC7A 2E8MA 2FMPA 3KDFB 4DSFA 5M9OA 2WAQE 5KT4A 2C28A 3W1BA 4B08A 4RPYA 2F0SA 1WG8A 1DRGA 3KK7A 2I1QA 1CZGA 3AB9A 2KFZA 3C5GA 1TQOA 2R8HA 1DOQA 2UVRA 3I91A 4MEXA 7ICSA 2NWGA 5D65A 2RCFA 2BA1A 1VQBA 2ASDA 1UA1A 4XTCS 2E2IB 4DEZA 3MFHA 5M5XB 4DR1Q 3AQFA 1JT8A 4FZNA 1XXGA 1HUZA 2B29A 3NRZA 3D4RA 3M3YB 3WU2U 3C2MA 4A93B 3TREA 4RPXA 3Q8MA 3MEHA 4J9PA 1Y88A 4QIWE 3M7NA 2N88A 5FP0A 3MDAA 1C0AA 2H3ZA 4NJ8A 2DL0A 1BPXA 4M9NA 3ZDCA 3PMNA 4DUYQ 1AZPA 2UUAQ 3KUPA 3CMEA 1F77A 1A3UA 3S1RB 3MBYA 1UT8A 2PPBC 3CD6A 1HTPA 4UP8A 4DFJA 3B6YA 5IGBA 1HNZL 2QDLA 3MGIA 4HAIA 1X66A 1JROA 3GIJA 5BPCA 2NYZD 1GUSA 5D4BA 1C20A 2KJ9A 4R66A 2MJ8A 4J15A 5J29A 3JPPA 1VQDA 1D5MC 3WWVA 1WTOA 1EY8A 3S1NB 9ICAA 3SAGA 3PIPA 3Q0AA 2MRLA 5IT9E 3PIOA 1NKEA 3NQTA 3M6ZA 4UBBA 4RHSA 3I4LA 1TWHB 3P7JA 5EWFA 2HSZA 4ED7A 1DJRD 3GTMH 5JVG3 3MR3A 1SNCA 3RJFA 2EPBA 3GV7B 5EWGA 4JOIA 4AYBE 2OM6A 3BZCA 3P75A 3TEHB 3QZ7A 2AU0A 3KOOA 4NLCA 4DL5A 3CCSA 2Y0SF 3EYZA 5AM4A 3UDXA 2FI1A 1GD7A 2WB1C 1ENAA 4LUZA 4MHVA 2B39A 2Z6KA 5KFZA 1A2UA 2NRVA 2PKEA 3RLNA 3IG8A 3IL8A 4P4PA 2ASBA 4DL2A 2G9HD 2PXIA 4IQTA 1SGGA 4LJXA 4UHVA 3TZDA 5AK4A 5CA7A 3JAME 3OWFA 2A6ED 2Q2HA 2VL6A 4PPXA 4LFAQ 4DAMA 2EY1A 5E1FA 2Q2UA 5KFQA 2RKSA 1PTOC 4ICAA 1KABA 2KJ8A 2UVWA 1NJWA 4ZOHC 2XGTA 4JWMA 1RG6A 4DR6Q 4B3SQ 4EEYA 1I4XA 1ONLA 2KECA 5M3FB 4ECUA 1A6SA 4KITB 9ICPA 1XJVA 1BNPA 1YHAA 5CBAE 5KG5A 2MO0A 1M1KC 3SXHA 4IPGA 1STNA 2WAQF 4IN3A 3DWAA 2XIWA 4IUVA 5L1JA 1NK4A 4TUQA 3KHGA 3A5UA 3ISCA 2N55A 4N8X1 3GTQB 2PQEA 5AM5A 4F5QA 3IKJA 4JOIC 4A3EH 3RB6A 3CPFA 3MTSA 3QU4A 9ICUA 1ZJMA 1MHWC 3HGBA 1EUJA 2E2JB 3C1ZA 1NNLA 2GH1A 1HZBA 2Z4IA 1PZID 1NI3A 2R18A 3KJPA 1JMSA 4EBDA 3NQIA 1N34L 2VXWA 2K4KA 4MNOA 4OJPA 1G291 1Q12A 2OTLA 1XNQQ 2LXKA 4IC9A 3NBHA 1ZQFA 2PZUA 5LMNL 5KG4A 1NK6A 1W2BA 1KTKA 2JA6B 4C8NA 1AROP 2FPMA 3MC0B 5C4JH 1AH9A 3FDSA 1UHUA 4FBUA 2WAQB 1C8CA 4KLTA 1LB2B 5KFVA 3ICXA 5CR0A 1EY5A 2IW3A 5A2QL 2VQEL 3UM9A 3PW4A 3NENA 9ICSA 5IWAQ 2XIDA 1O03A 4DK6C 5ALEA 3BQ2A 3MXUA 4JW0A 2XY6A 4A3EG 2LY7A 4KKTA 3RUZA 3S14H 1PXUA 2CH4W 2RBMA 3KOJA 3NWTA 7ICKA 3OSOA 4IZ8A 2EZVA 3QIAA 4C2MH 4Y2VA 4UAZA 1U49A 1N32L 3SI8A 3OPOA 2UU9L 1L1OA 2JJQA 4QGUA 1OUQA 4NV0A 4OJOA 2OXOA 2V9WA 1SKRA 1FNWA 1BPEA 2P5ZX 3DWPA 1LV9A 1HFNA 5HURA 3TP8A 2F8LA 4NY8A 1R4PB 3I4MB 4PQXA 3EROA 2K1BA 3HKZF 1HR0W 5IIOA 8ICEA 2EYJA 3PO5A 4JV5L 5K36H 2NVQB 2X69A 3BDCA 2F77X 4KD4A 2DGYA 4X6AH 4DV1Q 4Y2TA 4IQZA 1IBKL 1VQ5A 2UUBQ 4UAWA 4RQ1A 1I4HA 1MQ2A 1X6OA 1LT5D 3KF8A 4FFDA 2O5JC 1MD2D 1VJ5A 2ZIVB 1B43A 4ACOA 1O80A 5JPMC 1N33Q 2FJ2A 1CSQA 4XT3B 4B3TL 4F92B 3PO4A 4M47A 3VR2A 1LABA 1PTOD 1PV4A 3OTQA 3WK8A 3J81j 3W2DA 5KFBA 1PA6A 2LSSA 4FNFA 4JI5L 2LFNA 2QCPX 1J5EQ 5KNCA 3UQ2A 4FS1A 2PZTA 3HKZB 2E76C 1PH1A 3QG1A 1KEJA 4CF4A 4B3MQ 2ZUCA 3TBIB 3MGVA 4X3SA 2KFNA 4DR5L 2PFQA 1Y1VH 1WD1A 3ULJA 4LZGA 2YTUA 1M90C 4RH6A 2DUYA 5IIJA 3QU9A 2F1IA 5L1KA 1L1OC 2K60A 1U4MA 3LX0A 2ZIWB 4ELUA 3NTIA 3LGJA 2BH2A 4DWIA 4B9WA 3RJEA 1VDVA 3AFQA 3PGZA 5CV8A 1JOKA 4R65A 3KHLA 2BCUA 1BUVT 2PMZE 3GU3A 5TZVA 2IMWP 1KNAA 1VQFA 4F4ZA 4GLVB 3QEBZ 1EQQA 1K8GA 5AJ3Q 2HHVA 3HOWH 1N2XA 4UB2A 5C5JA 2PFOA 1UE6A 2L1BA 4ULLA 4JI2Q 1DXSA 3PX6A 1D1IA 2CW0C 1EY0A 1WTRA 3FPPA 4BDPA 4U6PA 1STBA 5J2IA 3NGDA 2GOLA 1ZD4A 5BR8L 2HD3A 2IL8A 4PZOA 5CR3A 2AQ3B 3VA5A 1N8RC 4LFCL 1Z3EB 1LO5D 4EBEA 3BJUA 1Y1VG 2E5SA 3VDYA 4DR4L 1V1OA 1CKMA 3V05A 5C0XI 5ALSA 2F0QA 4HJ8A 1B70B 3CCMA 1RXWA 2WV6D 1VQ6A 3MFYA 4WJ4A 1XMQQ 2QKIC 1RDFA 4C3JH 3GIIA 4KKUA 2PZWA 5AI9A 4YMOA 2JH7A 5J22A 3L3FX 8ICGA 3UMBA 4DQPA 4LFBL 3HOWG 1DGJA 2MSNA 4V190 2OCEA 2HBMA 1TAUA 9ICQA 1KRSA 1UUPA 3PSIA 4NXMQ 2PW7A 4RNOA 1EIGA 4YD2A 2IHNA 4ECTA 1ZYQA 2D8CA 4YR3A 4IR9A 1C9OA 4F4WA 8ICMA 4HJ9A 1PH5A 3A0HU 3FMCA 4OIJA 4ZKBB 4BXOA 3A55A 1CHQD 2OF1A 5AI6A 3A8JE 4I65A 3HOXH 4KHPL 3BDOA 3HOYH 2W11A 4DV5L 1SV0A 1PFNA 1UWVA 1UA0A 5HMLA 4XT1B 1TAQA 3BQ7A 3Q8QB 2SNMA 4C3JG 4Y2QA 3SHLA 2YTXA 2F44A 3RJIA 3KBGA 3A0JA 4PNYA 3RN5A 4ZRZA 3N7SC 4KLJA 3NTUA 3NVVA 1SN8A 1JIHA 3J7YW 2KQ3A 4PZ6A 3V6HA 4BBRH 1TKDA 2W54A 1LKYB 4I2DA 4KN7A 2F0OA 2KA7A 1EQVA 3EVQA 2NZOA 3M9MB 4UB5A 2JYOA 4DV0L 2EAOA 5EE1A 1S0MA 3F2DA 2Y1IA 1S9FA 4KLEA 3A8KE 5HR6A 5F9LA 4FYDA 5ALVA 1B3QA 4RU9A 3HOXG 5EQ0A 1E7ZA 3HOYG 4YHHL 2RP5A 5KL8B 1GO3E 1K28A 1I4PA 1JR0D 3GILA 1BNZA 9ICRA 5IY0A 5JJIA 4I2CA 4GLAC 3UE0A 2H3FA 4QZCA 4DV2Q 1I5FA 2HHTA 2JQOA 2WP8J 4MFFA 3TS2A 5EPJA 3TS0A 5AM2A 4MF2A 1STYA 2DPJA 5JVH3 3T4AC 2QEJC 1EFID 2WFWA 4RKBA 5LL6S 3V7JA 2CW0D 1ENFA 3UDIA 5IYCG 1SV0C 3ERSX 4FE3A 2XCAA 4UAYA 5ISRA 2DKZA 2KN7A 1A0PA 2RRDA 4GFJA 4BUGA 2EOTA 3SK8A 3NUCA 1WTHA 4RKLA 3RAXA 1K3BC 4PV1C 1WVLA 4RCOA 1ZYRC 5KNBA 1D8YA 3KDFA 3I76A 4BWGB 5A0LA 1F9SA 1XMOQ 4KN7C 4KN4A 1TK5A 5EPKA 2VQFQ 1LTAD 1CA5A 4NXNL 3MC1A 3GTMB 3HJEA 3TADC 3RLOA 1A76A 1ZJNA 1CKNA 2DJGC 3FHWA 7ICPA 4IFDI 4HN7A 1Z1BA 5CJ7A 4DK3C 4NLGA 4CJ0B 1LM0A 4O3QA 2W9MA 2SNSA 1JX4A 4F8RA 4NLBA 1SYBA 1S8OA 2PMZB 5DM73 4F5RA 2F03A 3HP6A 3TZUA 1BBUA 2EVBA 3RH4A 3H3VH 3RZOH 9ICLA 4V0BA 3STBC 4QUCA 4M8AA 3GTPH 3K7UC 4E6IA 4Q8EA 5KT2A 1Q90A 4X64L 4A76A 3HOUH 3E6ZX 2N1RA 1Z00A 1ESRA 1QE6A 3TFRA 3NP8A 4YN4A 4USAA 3RR8A 2Q0ZX 2IX3A 4LF6Q 5IGGA 1EU4A 2W9AA 4ZUIA 1KLNA 3H0LB 1TR5A 2MFIA 3M6KA 3Q8RB 5AKEA 3KF6B 3TSSA 1G91A 5KFGA 3TI0A 1VF5C 3SYZA 1XX8A 4QZ9A 3UMCA 1Q3VA 2BPFA 1FR3A 1Y8OB 4KN4C 1ILPA 4DL3A 3G6EA 3AL0B 3CPWA 1XSNA 1WCMH 3ONNA 1WJJA 1YJ9A 1TWGH 4OJ5A 4B3SL 3H0GH 4YR2A 4KJOA 1S3OA 4A3IH 4A3EB 1L0YB 1EYCA 5G3LD 5J0YA 2NO4A 3OPXA 2WF7A 5IODA 5KFSA 4TUPA 1QJOA 4X3TA 5FO9B 1SFOB 4C4RA 3HOUG 2ZIXB 2W43A 1FD7D 4R4CA 4DV3Q 3PVXA 1X3QA 3RLFA 2F0FA 2A69C 2EQSA 1IYJB 7ICNA 3QXGA 1YZ7A 5DB8A 2A6HC 4QZDA 2K14A 4EYIB 2YTYA 3NEMA 3T56B 2ZJ8A 1UPHA 1TT2A 1X3FA 5C44H 2JGAA 3J80L 1WD0A 3S1MB 2F0WA 2W9BB 3AN1A 3MDCA 3RRHA 2FLPA 8ICZA 2BKEA 1BCPC 1D5ZC 2ZTDA 4PMBA 5C4JB 3L2PA 4JI1Q 2M00A 3PO3H 9ICKA 4HSPA 1L8OA 1QVCA 4JBWA 5KFFA 1WTXA 2R7ZH 5GAEC 1WCMG 3BDPA 1AE2A 3IFDA 4IUQA 3CRKC 3N52A 4A3IG 4EEKA 1E22A 1EL0A 3FPUB 3S14B 5AI4A 5EE3A 1ZQCA 2BCSA 3RJHA 3PUVA 8ICFA 3JPQA 4QWBA 2ZM6L 2JA9A 3I2ZA 4DV7L 4JI6L 4C2MB 1ILQA 4FDBA 4KLUA 3FC4A 2KCTA 4QZIA 1L8LA 4RQ4A 4JWNA 3DEPA 1HH2P 4H13C 5T1IA 3I4NH 2BQ3A 3K80C 2K75A 4K14A 5KFDA 1U4PA 3QOJA 1NJZA 2XO7A 4DUZL 1UEBA 4R4TA 1GM5A 3MR6A 4XQQA 2EZXA 5DB7A 2F0VA 5CWRA 2B6GA 3PO3G 4YP3A 4ED1A 1QZHA 1IL2A 3K7AB 2NVTH 3S16H 5J3BA 1YI2A 4ZUJA 3V7LA 1I94L 1X3EA 2R7ZG 4GKKL 1VS0A 5FOBB 3STBD 8ICXA 2O5IC 1PUZA 2MPMA 3BZDB 4DXGA 2EE1A 2L12A 5EWEA 1ZQSA 4Z6FA 4YWMA 2NUCA 2HHHQ 4QL5A 5E3FA 3RNUA 1RYSA 2BH8A 2W3RA 3MFGA 1KLGD 4DV1L 3I4NG 5ELDA 2MO1A 5H1SE 1PHJA 3PY8A 3RH6A 2MGSA 3OIQA 3T5KA 1URJA 2NO5A 1ICFB 2KSOB 4B9NA 2RSNA 5EKKA 2Z8LA 2LMCB 4LMQD 4EQ5A 2QEXA 5KFJA 4YD1A 1Y1VB 2K5VA 4ECRA 2Y0SC 5KFLA 3JPSA 1M8AA 4IPHA 4UDUC 3SK6A 1EZ6A 1JB7A 1J5EL 4X62Q 1S5BD 4RGMA 1QQ5A 2UVUA 4NM1A 4B3ML 2AWOA 1L3SA 2KD1A 2AQ4A 5IGCA 3A56A 4DU9A 4KD3A 1S76D 4HJ5A 2V4RA 1S0OA 1PRTF 3J7A5 2EXZA 1ML0D 3A8IE 1VF7A 4QCLA 3HOWB 1E1TA 2C2DA 2A69D 2KUMA 1JALA 3TANA 1S5FD 1XNSA 2WHEA 2A6HD 3T53B 2KJXA 3C2KA 2DWQA 2D5DA 3CRLC 4R4IA 2JEBI 3J7ZC 1BCPD 1JICA 2V4QA 4YWLA 4ECSA 2SDFA 4RGOS 4YWKA 3KJOA 2HHXA 4BA2I 4PHPA 3HOVH 2ZXRA 1HUOA 4YQWA 1V9PA 1SBBB 2FXQA 3PV0A 3LVWA 5CEHA 4CKCA 2ASLA 1RD9D 4RAUC 3PSPA 2DN8A 4B3RL 3CCVA 1LTLA 4DFKA 3GTJH 2L15A 2WTFA 4C3JB 5BN3A 1CQFA 3K0YA 4EELA 1COOA 4CE6A 1S10A 2E5LQ 1L6NA 1G2TA 4QW9A 3VR5A 4UB1A 4K4HA 7ICGA 1DYQA 2F3WA 1EY7A 4F3OA 3E2EA 5C4HA 1FYCA 3H4DA 2FPKA 3WK9A 1RZTA 3ED5A 3N7PD 3D3RA 1NTGA 4DR7Q 5KFPA 3EUB2 5AKKA 3AU2A 4RFBA 2A5HA 3ZI4A 4OX9L 3I70A 4AP9A 1WI5A 5AM1A 1T5XD 1N5XA 5HR7A 4B9LA 1DOKA 3H6MA 3K8AA 3HOVG 4M6WB 1VQAA 1QB5D 2D0PA 2XSCA 4TVAB 3HOXB 3PUXA 3HOYB 2FE9A 4CRXA 2I5LX 4OWXB 5E4WC 4ECQA 3N4MB 4BX9C 2HDMA 2V1CC 2WINB 3S1QB 5ALUA 3SD7A 5I6YA 3BZKA 2W9CB 3E0EA 4US9A 1A3TA 1KQQA 4DSLA 2PNRC 1PFSA 2Q8TA 1V38A 1A77A 2K5DA 3MXGA 3M8SA 5C4XH 2C22A 2CVRA 3H94A 1S0NA 2F76X 3K5OA 2K01A 4JI7Q 1NOMA 3QE9Y 3TRZA 5DEHA 4JYAQ 2FPLA 1X54A 3KLRA 5ELFA 4YR0A 3GV3A 2GO7A 2FLNA 5IE8A 2VNUD 4A3MB 4PGQA 1JI7A 1K83B 4AYBG 2F3VA 1NK5A 5FKAC 3I7FA 2Z1CA 5LMNW 3UXOA 1D9DA 1Q8IA 3EWAA 1K5OA 2HIXA 3M9BA 4C4SA 3GV5B 2DJFC 4I2HA 1VQHA 3P20A 3HKZC 4HYKA 3J81L 5KFCA 4B9SA 4BS9A 5KFRA 3CCUA 3VYRA 3IG5A 2KEDA 3TMEA 3GTLH 2KJ5A 4QZHA 1KRTA 1PYWD 7ICQA 3QX7A 4FF1A 3V7KA 1MJEA 4G9BA 2DNCA 4I2AA 3V6JA 3RH5A 5C4XG 4I27A 4DAVA 4ME3A 3NVYA 1KHIA 2O4XA 2K89A 2AKWB 1KNEA 2DPIA 4GOPC 2HBJA 1BPBA 1MI2A 1RCVD 4F4YA 2TSSA 1FFUA 4DR3L 1I6HH 2AQ2B 1KIXA 1UE1A 1SL1A 4DV4Q 1X2IA 4DV2L 2F1MA 1IBMQ 4YCXA 3GFKB 2IHMA 3PF5A 2RSOA 4KK7A 5BN4A 4KLMA 2I07B 1QCBD 5COYA 8ICJA 1VCIA 5ELOA 1I4GA 1ZQOA 2FLLA 2F0UA 2GVBA 4HR7B 5ALPA 3C2LA 1CK1A 1MA7A 4GXIA 3KBXA 1JUDA 2KZZA 2EJMA 2UXBL 1ASZA 4O5CA 2HI0A 2O6KA 2CWPA 2OH2A 3I55A 2HCFA 3Q8PB 1LKYA 3TP5A 3GTGH 3WK7A 2UXCL 1IIPA 3RZDH 1BDOA 1QUQA 2OYYA 1NY4A 3MEFA 3WKEA 4PGXA 8ICVA 4BXXH 1SNQA 1KN5A 1UNSA 1EWHA 7ICVA 3PW7A 5B66U 5ALDA 3E9HA 1QSYA 3S2DH 1JQYD 2L11A 3RZOB 3HZXA 4XRHA 3KHHA 3SENA 1V85A 3M4OH 4JI0Q 3C23A 3G7LA 1SNMA 3GTPB 3I73A 3HG9A 3AQQA 1CUKA 1YVCA 4GKJQ 2VB2X 3HOUB 2E8NA 4K5XA 3TQYA 2ES2A 3ZDBA 4MFAA 1VQJA 1JXLA 3AQEA 3NXWA 2JV3A 7ICUA 1EOTA 1HTLD 3ULLA 4GNXB 2ID0A 3QUCA 3MWYW 1XNRL 4GLXA 4FF2A 4DFAA 1ZETA 3ETLA 5CYUA 3K58A 3DXJC 3C29A 1NNXA 4K8IA 1ZRMA 4P0PA 4BXXG 4HIMA 4FO6A 1PLFA 1X9XA 3DWQA 4PG3A 9ICXA 5KFUA 2F4VL 3ZDAA 3G48A 4F2SA 4E0DA 1A6XA 1S40A 1WWVA 1TS3A 2P6UA 3QOLA 5CGKA 1N36L 3WOFA 4MEYA 4BWMA 1FNVA 3CCEA 4A3IB 4CDCC 4TQRA 4YY3L 2F0DA 7ICMA 1WTVA 4WFN3 2H3IA 2F4IA 3F53A 5J0SA 3F2CA 1QNUA 1H38A 4XQJA 2EANA 4ECXA 4HMIA 1PTOH 4Q43A 1T7PA 5KYLA 2FMMA 2NN6I 2E8GA 4GS3A 1CI4A 1HR0Q 5IIMA 1JJCB 4Z6DA 3A74A 3SK4A 1G51A 1NK0A 4Q8FA 5KRUA 4G7HC 4X5VA 2UUCQ 2K5HA 2E2DC 4DV3L 2KHJA 4K6DA 3R2TA 2VW9A 1T4GA 3PO3B 2WB1G 2BHNA 3NWSA 4O0IA 1N62A 4B6JA 1UQVA 2KCCA 2R7ZB 3BQTA 3QJYA 5K5PA 3G6XA 2PI4A 2JHDA 1IKMA 1UT5A 1BBXC 3NTKA 1RF2D 2D62A 2R6GA 1NCVA 2MUTB 2KIVA 4Y2UA 1S5ED 3NS1A 2QB0B 4L6TB 4LW1A 1XPUA 2JK8A 4NLZA 1EZ8A 3I4NB 4IOAA 1GHKA 1YHBA 2G07A 3UDFA 4F71A 4M04A 3D8GA 2P6RA 4O3MA 4LF5Q 1LLRD 5ALXA 4Q45A 2A1JB 1V1PA 3SDZA 3CF5A 2MUYA 2R92H 4R8UB 1PVOA 9ICGA 4YMMA 4NPSA 3BS5B 5AKYA 2KCNA 3DM3A 4RQ5A 3S16B 3ETRA 3K57A 2G09A 3HP3A 5AKLA 1O7LA 3QR8A 2LMRA 2ALYB 4J9KA 5DKWA 1QQ7A 4GC7A 2OQ0A 4FZMA 1DGSA 2ZIXA 1ZQKA 1SAPA 4G7ZC 1QVFA 4M2YA 4R8IA 3C3LA 4Y2XA 2RHFA 1EEFD 2Z6KC 4RNNA 1TWFH 3HOZH 5ALJA 2O2LD 5FO8B 4OWWB 5ALNA 2W9BA 2LM4A 1TXYA 1KC8C 1Z47A 3RB4A 1SYDA 4QIWF 2B8GA 4QWAA 1C7YA 1EY9A 3FM9A 3HEJA 3C2PA 2NRXA 1B4OA 1NUCA 1SLJA 3PUWA 2QGQA 2R92G 4LF4Q 2HUGA 1L2FA 2F0HA 4KKSA 4TUSA 2HHHL 4FF3A 5KG0A 2C2EA 4O3SA 1EOVA 5AKHA 5ALZA 1GHJA 1LT6D 1SL0A 3NK9A 2AUKA 2NTSA 1LT3D 3CRXA 1RQNA 5KFMA 4N8FA 3OHBA 3ALRA 3MABA 2FMSA 2KENA 3G71A 2E1EA 1E24A 4G4KA 1BQQT 3DUZA 3SR6A 4DFPA 4ED6A 4ED3A 2IA6A 3S17B 4XYOA 1IL8A 4DFMA 2LYAA 4H44C 5IWAL 4BBSH 3GTKH 3I8ZA 3B0XA 2F1JA 4N9PA 1ENCA 3VYUA 4M9HA 2MNAA 3HOZG 1LYLA 5T1GA 1KL9A 3BYYB 1D6EC 3FDTA 3A7AB 3CC4A 2OQKA 3H4BA 1EYDA 4DOAA 4N9TA 4ECVA 4QIWB 1I50H 5KFKA 2K5WA 1O08A 2CRXA 3U9SA 1AN8A 4CKEA 4X62L 2Q2IA 1RPLA 5C3EH 4NWIA 3S6JA 5KEEA 4U673 4UB6U 5AI5A 4OD0A 2VA3A 3TACB 3TARA 1NZBA 2R7DA 4AYBF 2VJ4A 1O7YA 2I5HA 3M85A 4DR2L 3HILA 1OO9B 4YXMA 1HQMC 2PW5A 5C3WA 1BPZA 5KFYA 4DAYA 4LF7L 3H0MB 4B9XA 3GTOH 1TAMA 4OO1I 4DNTB 4O3PA 5KFEA 2F0LA 1VLBA 3GTJB 4BBSG 2KOLA 3KZIU 1QSSA 2H5XA 4Y2JA 4K4IA 2WB1E 1Y14B 3KLSX 2HT1A 2KSOA 4PMCA 1I3QH 1W3SA 3T5JA 1XTCD 4MTKA 5LL6X 3JPTA 7ICFA 3Q8DA 1YIJA 4L5RC 5C3EG 2FFKB 5K36G 1XYIA 2NRZA 4GIBA 2PO4A 3WDNA 2WF8A 4Y52H 4AYBB 1E1OA 3C5FA 4RZRA 3OSNA 1AZQA 1ZQDA 5AKJA 1U4LA 2EY2A 3LWEA 5J39A 4O5EA 3N7RC 1TU2B 7ICRA 4PH5A 5CMDA 1CTMA 1DXMA 4JK1A 4DR7L 1GVPA 2NVXH 2CCZA 2W8LA 2LXJA 9ICWA 5CP2A 3CC7A 4RUAA 1HZCA 1RDPD 1IBLL 4DOBA 1RTNA 1R9TH 4IALA 5C4XB 5EBCA 4QZAA 2UVVA 5IYDH 4JPBW 4MHEA 1SSOA 3T1YL 1PH6A 4BY1H 2EAPA 1O7ZA 1TV9A 2XC9A 5DLQE 9ICIA 2YV5A 2X6LA 1VQPA 4CNQA 1UCVA 3IP4B 1GUOA 2F0NA 3UI2A 4JV1A 1NE3A 1QILA 4L5SA 1AFPA 2KHVA 4IPCA 1PK1A 4JI7L 3ZD9A 2ES6A 4IR1A 1EYAA 3OIPA 1ZQVA 2MQHA 4C4TA 5NUCA 5DGAA 2I9GA 2DUDA 4DA2A 2I0QA 4X66Q 4LUVA 2PI2A 3GTLB 3NRWA 3ISBA 3MR5A 3I28A 4BJQA 4A4IA 4QB4A 4AH6A 4KLHA 2K6AA 3K81C 4PZ8A 1ZQHA 4DO9A 9ICVA 4YCWA 5IYDG 4RGTA 3OHAA 1NK8A 1DCZA 4JBKA 1NJIC 4BY1G 4DV6Q 5EOZA 3PX0A 4FP5D 1WYDA 3PCOB 1JWMD 2P35A 4EX7A 2BPCA 3OSPA 1I6HB 4BY7H 3U9OA 3GO5A 4ELTA 1VQ9A 1FJGQ 4KV6A 1KDAA 2YMLA 2WKDA 5DB9A 3PQIA 4KY5A 4AQYL 3T1HQ 2DNEA 3H7IA 2D2CC 5L1IA 4LF8L 1XU4A 3ZD8A 2ZTEA 3D6JA 5IGFA 4HCEA 1VQKA 2E75C 2F3NA 2GVAA 3K1RB 1SE8A 3CMAA 1H9SB 1N60A 2W9CA 4H02A 3WOEA 2YX8A 3NUQA 2XCPA 3FEWX 1STEA 5I9PA 3MGHA 4FO2A 2B2TA 2IOHA 3RR5A 4HIOA 1BKBA 2GWSA 3GV6A 2HHWA 3GTGB 1QTMA 2EYPA 3UMGA 5FJ8H 3L7ZC 1H9KA 4Z6CA 9ICOA 5KGUA 4LF9Q 1HJPA 3A7LA 3M1YA 5I4DA 2X6GA 3MAQA 4BY7G 5F3XB 1PRTC 3PMLA 3G6VA 1V1QA 3JPNA 2YN4A 3J80i 3ORYA 1VQCA 2JA7H 2BOSA 5J2AA 2EZZA 5KT6A 3AYHB 5CB1A 3S2DB 4F87A 3SAHA 3QUBA 1EQRA 2UXDQ 3J7AV 4RQ0A 2K5QA 3M4OB 2IOFA 1K0SA 2M9NA 3NTHA 2QW7A 2HOIA 1O7IA 1OXSC 1ZQTA 2BDNA 4HTHA 2KP7A 3SAFA 3NSWA 4K0KQ 4DR1L 1ASYA 3D4WA 1B2TA 3IRBA 4CGZA 4GXJA 2BE5C 2RHQB 4ABNA 3ITPA 1K0RA 4A3GH 2I6XA 2R61A 4BBRG 5FJ8G 1L3VA 5ELCA 3THVA 2CKZB 2ICIA 1SKWA 2G5DA 2C35B 4NKLA 2PMZF 4GKJL 1RHPA 5I2XA 1HCZA 2ZT9C 2Z7JA 4DUYL 2UUAL 4QJFB 5C0XJ 2JA7G 5FLXL 4RNMA 5D46A 2WB1B 4A3KH 2ZJ5A 2BDOA 4X65Q 1UAPA 3PIP3 3KFUF 2LKYA 2KCMA 3PIO3 1H9MA 4OEMB 4BGDA 1LTSD 1YNNC 5LMUQ 3WK6A 2DQNB 3IHQB 4F91B 1SB3C 2K33A 1CT1D 3GDXA 2WIIB 1QVGA 3SGIA 2R8JA 3KZXA 4J9SA 4B9TA 5IP7H 2RQ5A 3RMHA 2YTVA 3L0OA 5BOLA 5DG7A 4FVMA 1ZQQA 2XWJB 1XPOA 3JPOA 3CQZH 2F0KA 3WKDA 4A3GG 4J9RA 3T3FA 3HWTA 4C8KA 3MXPA 2MU2A 4Q5VA 8ICWA 2N3SA 5DG8A 4ZYSA 5J2JA 1RYRA 2J6UA 2CPRA 4RQ3A 5F2DA 3V96A 4A3KG 1X40A 5ALMA 1R4QB 1IYVA 1TS5A 2LPEA 2D0OA 5C5LA 4BWJA 5E7NA 5GTIU 1ZXTA 5KNIA 2GA4B 8ICPA 1PYBA 2W7OA 1PH7A 2ZG6A 3M4YA 4GNXA 1JRPA 5KFOA 5IP7G 1YJWA 2RHSB 5C0XH 4OHJA 2JEGA 1V97A 1JCKB 2RF4A 1DD2A 4RGNA 4QZ8A 2FDRA 3EW9A 2BZFA 3U4VA 4APVA 8ICKA 1X6JA 1N5WA 1RL2A 1BVSA 4LFAL 4MIUA 5KTQA 3BDLA 4GN3B 2JA5H 4KHVA 2R92B 3O13A 3IAYA 3G4SA 1B1ZA 1HNZQ 1ECWA 1PRTD 1JOQA 4UB8U 5EKLA 4C56C 4DR6L 3WKCA 2YY6A 4Y2PA 1EQTA 4L5QA 4P74A 4POGA 1JJ2A 5ALRA 4RA8A 2HCCA 2SEBD 1ZQIA 1DK2A 4PMWA 4LF5L 3SV3A 2WKCA 4KLDA 1K8AC 5IT9L 3U50C 1NR2A 5CORA 2KZ3A 5JPNC 1RYUA 5L1LA 1Q1BA 2K52A 5C0XG 4IQWA 1TWFB 8ICSA 3HOZB 2BE5D 1JE4A 2KVSA 1XSLA 4IL6U 1S77D 2I46A 1SROA 2IBKA 1GO3F 3H91A 5CV6A 1ZXIA 3DDHA 1Q81C 2JEFA 1C48A 3E58A 2NVYH 2JA5G 4DK1A 2AGPA 1SYCA 1KDCA 2F0IA 4O2DA 3HPOA 1OW5A 1TWHH 3Q24A 4GNXC 1HIWA 4QZFA 2F0TA 2B21A 5L1MA 2NZHA 4P4MA 4NM2A 9ICHA 1SMYC 1QLNA 2YU9H 1XNQL 4UY8C 2D3DA 3H0GG 4HIKA 2G9DA 2OWOA 4UAIA 3TDQA 1YNND 3D2SA 2Z4HA 1VMCA 2KG5A 1LUZA 3JAML 2NV3A 2EJGC 4UB3A 2K7VA 4BBSB 3J80c 4IFDJ 4OJLA 2QLTA 2F0GA 3NBHB 5A2QE 2JA8H 4KJNA 3GTKB 3P1HA 4MF8A 2A1JA 1RM6C 3JPRA 5C44G 4R8UA 3D4DA 5J0UA 4ELVA 3CNHA 2Z0SA 5LHY1 1I50B 2ISOA 3T79A 2K4HA 3BS5A 4UASA 2YYZA 9ICJA 4DS4A 2K8CB 1TS4A 2OXPA 3EIVA 5C3EB 3BS1A 3E0FA 4CHTB 4F93B 2VS1A 1RIPA 3BG3A 3Q22A 2R7FA 3QUTA 3I3CA 4O0AA 3IFTA 2DY8A 4XA5A 2L0CA 3Q8SB 2OEOA 5IYBH 4B9MA 4IUPA 3OTOQ 1DOMA 3S15H 5KG3A 1J6QA 1DOLA 5DNFA 4IJHA 3GTOB 1Z1VA 2LS01 1L1OB 5CV4A 1RKNA 2KEEA 3K59A 2PQAB 4JI4Q 1ZEQX 3J81i 2JA8G 2UUBL 1SEBD 2PYKA 2HQEA 4ZLTF 7ICTA 1T8EA 1I3QB 5ELBA 5GAGC 5KNDA 1Z4NA 5IILA 1RODA 1X56A 1N33L 2CH4A 1JXEA 4DL4A 1KQSA 4HSVA 1EWCA 4JBJA 1EEID 5LMNQ 4FXKC 4IFDH 5J2BA 4EQOA 1K8MA 3OW2A 2K4PA 4UB4A 3U4ZA 1JOOA 2MAXA 5C6AA 3CYMA 4TQSA 5AK3A 1HPCA 3ERQA 4C3IH 4XQNA 1LACA 2VQEQ 4DF8A 1W6KA 4HIDA 2RCNA 1TWCH 2DBYA 3I1YA 1H9JA 2EAMA 2Y9TA 3UXNA 2Y0SG 3BVZA 2OTJA 2JRZA 2NVXB 1KAWA 1QCKA 1QOHA 4P0QB 4OCZA 1D8BA 1SDFA 4G3IA 5GTHU 1F44A 1VQEA 1X9NA 1R9TB 1NSNS 3WK4A 4LVSA 1TS2A 3T16A 1N32Q 3RR7A 1FGUA 2K8BB 4R63A 3E5SA 2K05A 1AW7A 3SK5A 1Q7YC 1U9RA 3PMFA 2B2YA 5ALGA 5CV9A 3RN2A 4DGZA 2ZXIA 2DFLA 1IV8A 4J9QA 4IFDG 1T9HA 4S3SA 2KIWA 5AJ3L 2KTQA 3CAMA 3KLSA 5J0WA 2EZYA 4JI2L 2XICA 4US8A 5L37A 2ZIVA 4JV5Q 3RJJA 1SMYD 1V43A 2ESEA 1OXVA 4C3IG 1F9QA 4CDGA 2JH1A 4LK1C 2VJ5A 1K73C 1IBKQ 5HHHA 2WAQC 3G6YA 8ICOA 1F9PA 3T13A 1ZD5A 1MSWD 5JU5A 4JV2A 4DQSA 5JEAJ 2XGPA 2VUMH 5IP9H 1MSGA 4J1MA 5KFAA 2F0MA 5AHXA 4H0LC 1ZRNA 1MBYA 1XPRA 5EKIA 2EDUA 1SIJA 5DDYA 2A74C 4B3TQ 4RPZA 5E79U 5BN5A 4C3HH 3N28A 3SQIA 2A68C 1WOCA 2IHFA 3IDWA 3RF9A 3SR1A 4DAPA 5I6WA 5I9OA 4OONA 1XMQL 1GUWA 1NKCA 3OYYA 4EGVA 2RDHA 4C1NI 4CF3A 4BY7B 1PZKD 1HQRD 2ZIWA 1IYUA 3BQ0A 5KT5A 1P7DA 1ZQLA 3HRDD 3GIMA 1IKLA 2W04A 1EIFA 5HGQA 4DR5Q 2BDPA 4NXML 5KAIU 2VY3A 2QKQA 2PFPA 4DV6L 1II3A 4CCHA 2AGOA 1ZQBA 3TP6A 1I6VC 3ONAB 1WTQA 2HBLA 2B2YC 1D9FA 9ICBA 1D1KA 2L9HA 4KLGA 2VUMG 2K03A 2J4XA 5IP9G 2YB4A 1YNJC 4O3NA 4QY7A 3FKIH 1ESFA 2F1HA 3NBIA 4IQVA 3KHRA 2AQ1B 4BBRB 1ZQNA 1N63A 1KSPA 4C3HG 5KFHA 1NZPA 2EYFA 3I72A 1VQ8A 4F5OA 2W7PA 5J0OA 1J2MA 4BXOB 5JEAH 1KFTA 2R3ZA 2B2UA 1ZQZA 3R3OA 1EWIA 2JA7B 2RA4A 2BCOA 4ECYA 2Y9UA 1SV4A 2AUJD 4IRKA 3VCBA 4C7ZA 5BR8Q 4LFCQ 5DQIA 4EX6A 2M0NA 4UAVA 1B50A 2WF5A 1IHZA 3DEOA 5ALOA 4I2FA 1BGXT 2HMXA 3A5ZB 3OMCA 4DQIA 1TE2A 1ET6A 3HKZG 5KG1A 4JC0A 3VA7A 1XWEA 3QNMA 4X3UA 4NLKA 5G5HA 4A3CH 3FKIG 2HHUA 3EA6A 2UXDL 2EH9A 4PZ7A 2YQEA 3VR3A 4A3GB 3GQCA 4K4GA 3R8BA 1S72A 4LFBQ 5J2GA 1FL0A 3F2UA 4CBVA 3NELA 4NLNA 2Y0SE 4I2BA 5FK9C 3BS7A 1ZQMA 2JXJA 4MZ9A 4K0KL 5JEAG 4A3DH 2F0PA 2KKPA 2D6FC 3J81c 2R93H 2HVIA 2K4EA 4IUUA 2JE6I 5J0TA 1H9SA 4A3KB 4JUZA 4J9OA 1OXXK 1S5CD 4IS7A 2EXDA 3MFIA 4JMUA 1SWVA 3QZ8A 9ICEA 3OGUA 2K5NA 1PVQA 4KHPQ 3O0FA 3FP9A 5JJZA 1JE5A 4DV5Q 1HNXQ 1F5SA 2B0CA 1GUNA 3TAPA 1NK9A 1CEZA 5DG9A 4QMGA 3CCRA 1HA5A 1LTID 4PHEA 4IRDA 1STHA 2QDBA 4XXEA 2B2UC 2AJQA 3C1YA 4RQ2A 3V6KA 4X65L 4A3CG 3LWMA 3QEAZ 1KLUD 5KL1B 1GKHA 7ICOA 1SWWA 4DL7A 3T51B 5DAUA 1XMOL 4Y2SA 5EGTA 2A68D 2VQFL 3ICEA 2XN9C 1KFDA 2K4IA 1LTRD 2G5IB 1S5DD 1SYEA 2EYOA 4ZCKA 3S24A 3GV8B 1FVIA 1LTBD 4A3DG 4O3RA 3AFPA 1YZ6A 1TIID 1TK0A 1BCPF 2Q8RE 5KIXA 4NDXA 4DV0Q 2R93G 5J2KA 4EZ6A 3NVWA 4U68A 1LV5A 1PFBA 2VZAA 3B0YA 1X9SA 4KLIA 4QUFA 1WUDA 2DF4B 2KEYA 2WF6A 1CKNB 1KBUA 3VR6A 4YHHQ 4B9VA 5ALQA 3K1ZA 1K9MC 4DN4M 1B7YB 3CCJA 1FIQA 1BO0A 1J9OA 1YNJD 1QG7A 1Y69U 1EIHA 1SJHD 1PMRA 2F2AB 1UE5A 3RBEA 4F4KA 4JI3Q 4P73A 3LYSA 1WFQA 4R9WA 2OEHA 1LT4D 1U45A 4QJFA 3ZYYX 2CXYA 5ALTA 1MQ3A 2JA5B 3D6CA 4KX5A 1SYFA 1KTQA 4ALPA 3CU7A 1BCPB 4LF6L 4EYHB 4KHZA 1WCMB 3Q8KA 3CP8A 1XSPA 1TWGB 2HDOA 3H0GB 8ICUA 5CC4A 1L0WA 3TN2A 4C8MA 5AICA 1Z00B 4DNRB 3UQ0A 1XS9D 4L8JA 2QA4A 1B8AA 2A8VA 4QQBX 1ED1A 5ALIA 2JR5A 4WJ3M 2KZMA 1PZJD 2F52A 5EE9A 4C0ZA 4M0AA 3BQ1A 4NXNQ 1XO1A 4ECZA 3CCLA 2IOFK 5C44B 4QZEA 2XRSD 4QWEA 2VA2A 1PDQA 3FVQA 3U58A 3NASA 4LUOA 2FINB 3KTQA 2NVYB 1VQLA 3A54A 4MTNA 3KFUA 2XGQA 3HKZE 4I28A 4DQQA 2ZIUB 3PSTA 2NB0A 4NXZA 5DBAA 2DY7A 4ODGA 2YU9B 1U4RA 3RJKA 4KMOB 3J80E 4FXDA 1NMFA 4GN4B 3OMGA 4Q44A 1TY0A 5KYIA 5BOMA 1SR3A 1S5LU 3C21A 3EBEA 1N56A 4JI1L 1XC9A 4DNIA 3SV4A 5AKIA 4DF7A 3VYTA 5C4ZA 1N61A 4PJ0U 3KF6A 2XTIA 3LDAA 5J0RA 4X64Q 4FF4A 1LVHA 2W3SA 2Z9HA 1U4BA 1Y8PB 2YMQA 1VQOA 4DK0A 4XDXA 2AH5A 2BGWA 5IGDA 4DL6A 5HY6A 1YNXA 5M5YH 4K8JA 1Z6HA 1C4QA 4JI8Q 4PHDA 3VC8A 4RQ8A 3F5AA 4EQPA 4EQNA 2YMMA 2E2HH 2NVTB 1CA6A 3TAQA 2ATLA 3VYSA 3TQ1A 4PL1A 5G5GA 3AM9A 1CKOA 3UE1A 5EBDA 2XNAC 4DPGA 4ZQ3A 4DSIA 1GXDC 2PI5A 2PMZC 5EAYA 2FMCA 3S15B 2IWHA 2IHEA 2Y0SB 1MKHA 1SMXA 4C8LA 4IO9A 5CV7A 9ICMA 2A1AA 5J2EA 3DM1A 9ICNA 3QWNA 5J0XA 1QSLA 2V4DA 2K50A 2NBFA 2P66A 3C46A 4A3JH 4OWTB 3M8RA 1DZ1A 4P4OA 2PNHA 3OTOL 1HNWQ 1M6YA 1CZWA 3MHBA 4TSSA 1VQGA 4JG2A 2KICA 2CFMA 3D31A 1Q3UA 2E3TA 1SFOH 2L55A 4JI4L 1HEKA 3Q8LA 1G2SA 1QNKA 1HUNA 2B63H 4Y7NH 1EFWA 1K8OA 1HUMA 2JZBB 1FO4A 4C3IB 5FLMH 3QB3A 1SXDA 2BR0A 4A8EA 1TWCB 3H0RB 3RBDA 4J03A 4M9GA 1B9MA 2W8KA 1J2NA 4KY7A 4P72A 3S1MH 4XYQA 4NL9A 1KDHA 1B44D 4NB3A 4WRDA 2LBOA 2KOBA 2KBNA 2ZM6Q 4DV7Q 4JI6Q 2B2VA 4HCSA 2MP1A 3OJUA 3UDGA 4A3JG 1MC8A 4M1UB 2B3GA 2RDGA 3PUYA 5J2CA 1CI3M 1IW7C 5KFIA 2ASJA 2DGZA 3VR4A 2K32A 5EPLA 3NVZA 4PZNA 3WKBA 2F0EA 5KAFU 1NJXA 5J1ZA 1CM9A 2XWBB 4DUZQ 3HOVB 4PL2A 1U48A 1Y1WH 4ID6A 1TK8A 4CDEC 2B63G 4KLOA 1ZQXA 4UAUA 7ICJA 2IT1A 5FLMG 1I94Q 1F9RA 3R9KA 2A3VA 2WFAA 2PQAA 2XVSA 4Q0FA 4GKKQ 4DSKA 2RDJA 4ECWA 4F50A 3AMUA 5ALHA 2MHVA 2VUMB 2F8KA 1ZOLA 3EN2A 3K7AH 1PZNA 1YT3A 5AM0A 1PH9A 4C8OA 5CRXA 1PVPA 7ICIA 1SZPA 4C3HB 3BVMA 1PK3A 8ICLA 1T5EA 4A75A 1ZQGA 1ICWA 4GN5A 4ZH4A 2E5LL 5C3XA 1KXLA 4NL9C 5JUMA 1TVAA 3H8MA 5M5WH 2YB1A 1X55A 2NN6H 3TP7A 2EY5A 3L3OC 3V72A 4KI0A 1Y1WG 5KG6A 1Z9FA 3RD4A 4IURA 5A35A 3H8JA 5DBCA 2B2VC 3HKSA 4Y2YA 1UE7A 1IXRA 4P0QA 1F2MA 5DDMA 2K8AA 4WJ3B 1L0XB 1ZQ1C 1PFMA 4HEDA 1F2ZA 5ELEA 4EVOA 3LVVA 3PSFA 2CN1A 1BPYA 1YITA 5F9NA 1COKA 2NZ1D 3GDEA 3NHHA 1JB3A 4R8NA 2FJ6A 3FKIB 1U9LA 3E0JA 1ZQYA 1L7NA 3F2BA 4NMZA 2ZTCA 1OTCA 2F0JA 4UW9A 3NE5B 5ALWA 4RQ6A 1CRXA 5DQGA 2JP1A 4DCCA 1ZQAA 4GOPB 3KYHC 1DONA 8ICCA 3MXNB 2KNJA 2NN6G 3K0XA 4IPDA 2Y1JA 1A63A 4LZDA 8ICRA 4RWSC 5CHGA 4IRCA 3RAQA 2NRWA 1EXNA 5J2FA 2IPKD 1YJNA 2LI6A 4JYAL 1O78A 4Z6EA 3EPIA 1STGA 3H3VI 2EYMA 4QNLA 2Q2TA 3AU6A 4FZLA 2ENBA 1WCLA 5DGBA 2VIXA 1SE2A 4B3RQ 2HOQA 3D0FA 3CKIB 1V8QA 5J2HA 5KFTA 2H3VA 2E8OA 2VA8A 1BOSA 4F88A 5KT7A 2JN4A 3D2QA 3PV8A 4WJWA 3W1GA 1E2VA 1KRPA 1Z7TA 3J81E 2HBKA 1L3TA 2JEJA 2KVCA 4I7ZC 2ZXPA 1WWUA 3HFZB 4JK1C 5ELNA 4M6WA 1WCNA 5ALLA 1IW7D 3SE0A 1SKSA 2XY5A 4KTQA 4POFA 1W6JA 4HAEA 4OX9Q 4A3DB 4R1JA 4RG1A 4FXGC 2R93B 5M3MH 3PW2A 2BQUA 4HJAA 5GAHC 4OO1J 4JVZA 5E4XA 1VQ7A 2HDLA 2M2LA 4I2EA 2KHSA 4DV4L 4DLEA 5GADC 1IBML 1S97A 1BBWA 1Q86C 1IZ6A 3RB0A 1FFVA 3H15A 4DS5A 2R8KA 5DBBA 4TURA 3PNCA 7ICHA 2HOFA 1SE4A 4YIJA 3HW8A 2ATWA 2VANA 3ND9A 3SVMA 5DQHA 3CCQA 4DQRA 1SRUA 3RZDB 1PH2A 2FHTA 3QO2A 3J7AF 4EBCA 1L3UA 3BU2A 4OJ6A 4KX3A 3WK5A 3MA2B 3M9NB 1T3QA 1GOZA 1HXYD 1ZQUA 1KAAA 1HNXL 1X3GA 4HJ7A 2ZJPA 3S1QH 2K28A 4R4OA 2J7ZA 4X3KA 3W5OA 1WYGA 2QILA 5EE0A 2QARB 2WB1F 3ZDDA 3LK9A 4UBCA 4F7XA 3C28A 5M3MG 4RQNA 7ICLA 5KG2A 2AWNA 4A3BH 3EJIA 4UATA 1K1SA 3BJYA 8ICYA 4LJZC 3R2IA 1GJXA 3LNNA 4J9NA 5IYCH 1JORA 1AQ6A 2JEIA 1RTOA 3FAHA 2EY6A 3TADA 4QWDA 4GC6A 1SYGA 1QUQB 1X32A 1WTWA 1Q46A 1CFMA 1MSHA 3JAMi 3Q23A 4A3MH 1K83H 1PTOF 1KD1C 4JI0L 4OO1H 2AQ0A 4OIKA 1PH3A 4P2HA 1PVRA 1XTDA 8ICNA 3PO2H 2N8NA 3X3MA 3S2HH 2ALZA 2CWAA 4A3LH 3BYTB 4DR3Q 2DKXA 1EY6A 1QQ6A 2B2TC 3AUOA 3E3XA 1PH8A 4LNQA 3W3AA 3JC66 5AM3A 1OXJA 2XI9A 2Q4TA 1DM0B 7ICEA 4G7OC 5J0PA 4A3FH 1A15A 1FEZA 4JI3L 2R8GA 2SOBA 4A3BG 5CBEE 1Z4OA 3D2NA 9ICFA 1K3RA 5DLFA 1A2TA 4JCVE 2EDGA 2UXBQ 1TWAH 2XRQD 5TSSA 1IM4A 3V2TA 3K5NA 3H8WA 1PTOB 1Q3LA 4G57A 4UARA 1HZAA 4A3MG 4O3OA 4OO1G 1X3PA 4P0PB 4XQ8A 1VQMA 5AIBA 1P16A 3B9JA 5FLXc 4J9MA 1EYGA 5HMMA 3PO2G 1UEAB 2JSOA 1D5XC 5C5MA 2UXCQ 1TFRA 4AIMA 2OHFA 4A3LG 1LTGD 4DFDA 3RRGA 1A8VA 1CHPD 4M9LA 2HW3A 2L5TA 4KLKA 3K5MA 3L4PA 4GZYC 4DSJA 4CJ1B 3AU7A 1HR0L 8ICTA 5AKGA 5EJWA 4A3FG 1HFGA 3DHQA 4RQ7A 5DLGA 3N6RA 1ZD2P 2E1FA 1E2WA 1J97A 3SZ2A 4KLSA 3OW7A 4O1NA 3IV6A 2UUCL 5JTIA 2L4NA 4TQUS 1RJTA 1QH9A 2BCVA 2HQLA 4Z9CB 1AEXA 1NR4A 1VQ4A 5T14A 4ME5A 3HX0A 4J8QA 2E2IH 1KDBA 5M5XH 5C0YA 4IUTA 2IX1A 1JJGA 3M3YH 2WACA 2KMDA 3SEIA 2L5YA 3GP7A 4A93H 5JJLA 2HVHA 1XNRQ 5JOBA 4PHAA 1BF4A 5M5YB 5J0QA 5I2YA 1ZQEA 2HCIA 4NW2A 2EQYA 2KV2A 1G8ZD 2AMCB 4KTAA 4YMNA 2E2HB 2N78A 4J6HA 4QZBA 1X42A 2MA1A 4ZKCB 3EFXD 2H3QA 3URYA 4RCNA 2EIFA 2BA0A 3S1RH 2F4VQ 5AKXA 2G0AA 1G6ZA 1L7OA 5ALKA 3WKAA 1U47A 1RXVA 1CQVA 4JI8L 3T5LA 2Q8IB 5J8YA 1N36Q 3DLLA 3H3VC 1Z19A 4L63B 8ICHA 1T94A 1MJCA 2TMPA 3I4OA 4YY3Q 1QZGA 1YEZA 2NYVA 3EPGA 4QW8A 1V1PB 3C1EA 3S1NH 5IIIA 1F0MA 4A3JB 3F5EA 3KBBA 1JWUD 2PI2E 3GD7A 2ZJRA 4A93G 4C1NK 2ZIUA 2J0TD 4L5TA 3M9OB 4K5VA 4C80A 4KLLA 3OWEB 5D3DA 2CQOA 3T5HA 4UP9A 4JBMA 3I90A 2ZUBA 1D2BA 4EENA 1ZQJA 1Y8NB 3M7DA 5IT9c 4GXKA 3H8SA 2MUTA 4Y7NB 4RMFA 2B63B 2RLTA 1GUTA 2QB0A 4MFCA 3R93A 1MN8A 3SMVA 3MVVA 1HNWL 5ALYA 1HHVA 1XO0A 4LF4L 8ICQA 2FMQA 1STAA 1YHQA 1QWYA 2KVMA 4P75A 2XY7A 2XVTA 1E0BA 3ISDA 3M7GA 4YG2A 1EU3A 5ALFA 1BXTA 5IIKA 3DV9A 2CHBD 3CHBD 2PFNA 1GUGA 2H1EA 3GZFA 2EJFC 2KE7A 1B4FA 1F2YA 2LYBA 5JJKA 5KT3A 3M4PA 2BCQA 3K5LA 1HRJA 1ZYRD 4CDFC 3LWLA 3M4QA 4LAAA 3Q6SA 2VKQA 2JA8B 1ZD3A 5J8YC 2J6TA 2EYLA 4NP5A 2BQRA 4CGYB 3LWUA 1X9MA 3KKAA 4ED8A 5FO7B 1Y1WB 5H2FU 1FGBD 4UPAA 3JAMc 1ET9A 5KFWA 4RT2A 4RT3A 2GLEA 3CW2C 2PCFB 5M3FH 3PZPA 5AI0A 3PX4A 3MZ5A 1VDZA 3SEBA 3F1ZA 5KFNA 1S0VA 2QF7A 2BCRA 1JWSD 1A62A 3FYHA 4RUCA 4K2KA 4O42A 1N34Q 2GN5A 1SJED 3GTQH 4EX5A 2B8FA 4YCUA 5D3IB 4YFKA 4ED2A 1BPDA 4B9UA 3K75D 2ISPA 3HT3A 4KLQA 1ZQWA 4JV0A 2ODGA 5J2DA 1ZQRA 2E2JH 8ICAA 5KG7A 4DKAC 4IQUA 4M9JA 2BDUA 1EY4A 1Q82C 2JZBA 3X3NA 3KF8B 2E8PA 4PGYA 1NBWA 1SXTA 5M5WB 5DM63 2AGQA 4DAYB 1N48A 5IYBG 3PF4A 2IY5B 2M9VA 1OXUA 2I5MX 1L5UA 4P71A 2VB3X 4I2GA 1I4QA 5IOCA 4H7BA 2ZXOA 5M3FG 1X6IA 8ICIA 1NAPA 2JA6H 5L9XA 4K5WA 1MGSA 1SE3A 2NRTA 4RQMA 3F8TA 4RHRA 1D8LA 1B0XA 3K4GA 4XUSA 4FBTA 3H40A 2QB1A 2OT2A 1Q8KA 3QU2A 5K4LA 1OXTA 3G6JB 2UU9Q 4DLGA 3D6WA 1CSPA 1VQIA 4LWCA 3KKAC 4OELB 4BY1B 4R64A 3CP0A 1SNOA 4DXFA 1Q1EA 3ULPA 4F72A 5KFXA 1XWLA 2B2WA 1K1QA 2F3IA 3S17H 1F2LA 4O9MA 2KKVA 3L5KA 5B5EU 3QU5A 3I56A 1J8IA 3ER0A 2ICEC 2C2RA 2A19A 1SNPA 2J6SA 1HA6A 2BPGA 1SNDA 3EZ5A 3L9AX 2IJ0A 1ZQPA 5HP4A 3QYPA 4KMUA 4DR2Q 3E9IA 3I4MH 4F4XA 4YCVA 2K04A 2JA6G 4K6LA 3GQBA 2LHTA 5G3LF 5TISU 5AFWA 3ZJYC 4LF7Q 2ZJAA 5AK5A 2WAQG 1L7MA 5D49A 1H9RA 3HS0C 4XIGS 2NVQH 4KY6A 2WF9A 8ICBA 5AIAA 3NPPA 2RDFA 5AKZA 2JEAI 4C7YA 1A3VA 4HMJA 1IG6A 3TFSA 2IX0A 2A73B 2JXMB 4JI5Q 3IN5A 4X66L 1JN3A 1KW4A 2G06A 1ZKOA 4BA1I 3DEEA 3KLWA 3AMZA 1PK1B 5DB6A 4DSEA 1SL2A 3GIKA 4QIWC 5JRTA 5GROA 4QZGA 3RB3A 2N49A 3OOCA 4OXPA 2JMGA 1PRTB 5M3MB 2AXTU 1PYSB 3IRUA 4UQGA 1S4ZA 5HHIA 4QF4A 4JB3A 2LYHA 4KLFA 4U7CA 4J9LA 4F5NA 4DOCA 3RJGA 1U5KA 3FRPB 1FJGL 3I4MG 5HGTA 3T1HL 3OHXC 3AEVA 4TRDA 1EIYB 3PR5B 2B2WC 2AHOB 2RDIA 9ICTA 1E2ZA 1IBLQ 3OJSA 2HHSA 2ZUDA 3IM1A 3PW5A 4CF5A 1NK7A 1KKXA 3TKAA 4F8MA 5IIFA 4GOPA 5JAVA 3UPQA 3T1YQ 3RFAA 3MXNA 4CJ2C 4TKOB 4KMUC 4MN3A 1LTTD 2ZJQA 1DK3A 2R8IA 2D9UA 1JMCA 1NKBA 3EQLC 2KK0A 3QUQA 3C1FA 2KHIA 4O5KA 1U0LA 3CXCA 1D7QA 3K6OA 1RQLA 1X9WA 2HHQA 1E3PA 4EZ9A 4Y2RA 1T3NA 3HRZC 4LF9L 4DR4Q 2C5CA 3ND8A 3BVGA 4A3BB 1SXEA 3PR4A 2Z6BA 4F5PA 1FNUA 5IGEA 1BR9A 4AYBC 2G08A 5CV5A 2NTTA
chains in the Genus database with same CATH topology
1QVCA 2GVAA 2IHEA 4JBWA 1MKHA 1P8LA 1SMXA 2UXBL 1SE8A 4IO9A 2R7ZH 5GAEC 1X65A 1HZ9A 1WCMG 2A1AA 3CMAA 4H02A 1AE2A 4A3IG 1E22A 1VQNA 3RR5A 2K50A 4HIOA 3PUVA 1MIUA 2ZM6L 2HIVA 1BKBA 4A3JH 4OWTB 1H95A 2JA9A 3I2ZA 4IJLA 4DV7L 2PNHA 3OTOL 4JI6L 4FDBA 1HNWQ 4R4QA 5GQOA 5FJ8H 3CC2A 1AE3A 1PH4A 3L7ZC 1VQGA 2KCTA 4JG2A 4UP7A 3D31A 1HJPA 2CFMA 1HH2P 4LF9Q 3I4NH 3PUZA 3K80C 2K75A 1SFOH 4JI4L 4LF8Q 4AQYQ 4BY7G 1V1QA 3J80i 4Y7NH 4IOCA 1VQCA 1EFWA 4DUZL 2B63H 2JA7H 1UEBA 4R4TA 5FLMH 1GM5A 1NMGA 3AYHB 3PO3G 4P72A 1EQRA 1QZHA 1IL2A 2NVTH 3S16H 2UXDQ 5J3BA 1YI2A 1YBYA 1I94L 3S1MH 1G6PA 1X3EA 4NB3A 2R7ZG 4GKKL 1O7IA 1VS0A 1OXSC 3STBD 5LMUL 2KBNA 2ZM6Q 4K0KQ 4DR1L 1ASYA 4DV7Q 4JI6Q 3IRBA 2RHQB 3UDGA 1N9WA 1K0RA 1A0IA 4A3JG 2B3GA 4YWMA 3PUYA 2HHHQ 4QL5A 4A3GH 4BBRG 3KDFB 3RNUA 5FJ8G 2BH8A 2WAQE 3W1BA 4DV1L 3I4NG 2CKZB 2MO1A 5H1SE 1PHJA 2C35B 4DUZQ 4GKJL 1Y1WH 2B63G 4DUYL 2UUAL 5C0XJ 2JA7G 2IT1A 4EQ5A 5FLMG 4A3KH 4X65Q 1I94Q 2KCMA 2QEXA 2PQAA 4GKKQ 2BA1A 2K5VA 1VQBA 5LMUQ 4XTCS 4IPHA 4DR1Q 1QVGA 1JT8A 3SGIA 2B29A 5IP7H 1J5EL 4X62Q 1JB7A 2YTVA 3L0OA 4B3ML 2AWOA 3EN2A 3K7AH 3TREA 1XPOA 1PH9A 4QIWE 3CQZH 3M7NA 4HJ5A 3J7A5 4A3GG 4A75A 1C0AA 4GN5A 1E1TA 2E5LL 1KXLA 4DUYQ 5M5WH 2UUAQ 2N3SA 1X55A 3CMEA 4KI0A 4R4IA 1Y1WG 2JEBI 3J7ZC 1Z9FA 3CD6A 4YWLA 4UP8A 1HNZL 4YWKA 3B6YA 3HKSA 3KJOA 4A3KG 4BA2I 1UE7A 1IXRA 3HOVH 2D0OA 5E7NA 1V9PA 3PV0A 2FXQA 1PYBA 1PH7A 1YITA 4J15A 4GNXA 1YJWA 1VQDA 5IP7G 3GDEA 2RHSB 3WWVA 4B3RL 3CCVA 1LTLA 2RF4A 3PIPA 3GTJH 2L15A 3PIOA 3F2BA 3U4VA 4APVA 2ZTCA 1OTCA 2E5LQ 1RL2A 1BVSA 3GTMH 4LFAL 4GOPB 3KYHC 4GN3B 2JA5H 3MXNB 4JOIA 4AYBE 2NN6G 3K0XA 4IPDA 1NTGA 3BZCA 3G4SA 1HNZQ 4OX9L 4DR7Q 3TEHB 1A63A 3CCSA 1WI5A 3UDXA 1YJNA 4DR6L 1GD7A 4JYAL 4L5QA 4P74A 4POGA 4LUZA 3H3VI 1JJ2A 3K8AA 3HOVG 2Q2TA 2Z6KA 3RLNA 1VQAA 4LF5L 4PMWA 2D0PA 4TVAB 4B3RQ 3PUXA 3D0FA 1K8AC 2I5LX 3U50C 4OWXB 2ASBA 2V1CC 1Q1BA 2K52A 5C0XG 3W1GA 3BZKA 2Q2HA 2VL6A 3E0EA 4LFAQ 4DAMA 2Q2UA 3HFZB 1PFSA 1SROA 5ELNA 5C4XH 4POFA 1Q81C 2NVYH 4JI7Q 4OX9Q 4R1JA 2JA5G 4RG1A 3TRZA 2XGTA 4DR6Q 4JYAQ 4O2DA 5M3MH 4GNXC 1TWHH 4HJAA 1X54A 4B3SQ 5GAHC 1VQ7A 1XNQL 2NZHA 2YU9H 5IE8A 1XJVA 1YHAA 4UY8C 2VNUD 3H0GG 1M1KC 2MO0A 4AYBG 4DV4L 5GADC 4HIKA 1IBML 5LMNW 2OWOA 1BBWA 3I7FA 4IPGA 1IZ6A 1Q86C 3H15A 2HIXA 3M9BA 1VQHA 1LUZA 3A5UA 2ATWA 3J80c 3CCUA 4IFDJ 3NBHB 4A3EH 4JOIC 3CCQA 1PH2A 1SRUA 2JA8H 3CPFA 3GTLH 1KRTA 3BU2A 1EUJA 1MJEA 5C44G 1HZBA 1HNXL 5C4XG 2Z0SA 1X3GA 4HJ7A 3KJPA 4ME3A 2ZJPA 1KHIA 4R4OA 1N34L 4MNOA 2K4KA 3W5OA 3S1QH 1D7QA 2AKWB 2YYZA 4GOPC 3EIVA 1G291 1Q12A 2OTLA 1XNQQ 2LXKA 4DR3L 1I6HH 2VS1A 5M3MG 1KIXA 1UE1A 2AWNA 1RIPA 5LMNL 4DV4Q 2R7FA 1W2BA 4DV2L 4A3BH 1IBMQ 4O0AA 3PF5A 5C4JH 1AH9A 5IYBH 1VCIA 5ELOA 3OTOQ 3S15H 1J6QA 5IYCH 4IJHA 2VQEL 1L1OB 2GVBA 3NENA 1QUQB 4DK6C 1Q46A 2PQAB 3JAMi 4A3MH 3J81i 1KD1C 1K83H 4A3EG 1ASZA 4JI0L 4JI4Q 1PH3A 2JA8G 2CWPA 2UUBL 3S14H 3I55A 1XTDA 3KOJA 3PO2H 2N8NA 3S2HH 5GAGC 4C2MH 3GTGH 2CWAA 1N33L 1X56A 4A3LH 2UU9L 1N32L 2UXCL 4DR3Q 1KQSA 3RZDH 1L1OA 2JJQA 4QGUA 1PH8A 4JBJA 4LNQA 3JC66 1QUQA 5LMNQ 1NY4A 3MEFA 3OW2A 3U4ZA 4BXXH 4A3FH 4A3BG 4JI3L 4C3IH 3E9HA 1HR0W 2VQEQ 4HIDA 3S2DH 4JV5L 2RCNA 1TWCH 1K3RA 2Y0SG 4JCVE 3M4OH 2DGYA 2OTJA 2UXBQ 1TWAH 4DV1Q 1IBKL 4JI0Q 4X6AH 1KAWA 1VQ5A 2UUBQ 3AQQA 1CUKA 1HZAA 1YVCA 1X6OA 4A3MG 4OO1G 1VQMA 4GKJQ 1X9NA 1VQEA 1P16A 3TQYA 5FLXc 2ES2A 1N33Q 1EYGA 1N32Q 1VQJA 1FGUA 3ULLA 4GNXB 3PO2G 2UXCQ 1CSQA 4B3TL 2ID0A 4AIMA 1Q7YC 1XNRL 4A3LG 1PV4A 3J81j 3RN2A 1A8VA 4GLXA 1PA6A 4KLKA 2LSSA 4IFDG 1T9HA 4JI5L 5AJ3L 1HR0L 3CAMA 1J5EQ 4BXXG 4JI2L 4A3FG 4JV5Q 4HIMA 1PH1A 2UUCL 4PG3A 4B3MQ 1V43A 1OXVA 2F4VL 3G48A 4TQUS 2HQLA 4DR5L 1VQ4A 1K73C 1IBKQ 1Y1VH 1S40A 3ULJA 2E2IH 1M90C 5M5XH 1N36L 5EAYA 5JEAJ 1L1OC 3CCEA 4YY3L 2IX1A 2BH2A 2VUMH 3LGJA 5IP9H 1JJGA 3M3YH 3AFQA 3PGZA 1XPRA 4B3TQ 4A93H 5JJLA 1XNRQ 2PMZE 3F2CA 4C3HH 1WOCA 1VQFA 2IHFA 4GLVB 1XMQL 1K8GA 4OONA 1EQQA 2AMCB 3OYYA 2NN6I 5AJ3Q 2E8GA 2N78A 4GS3A 1HR0Q 1JJCB 3HOWH 4JI2Q 1UE6A 3A74A 1G51A 2UUCQ 2K5HA 2EIFA 2BA0A 3S1RH 2F4VQ 5HGQA 1EIFA 2KHJA 4DV3L 4DR5Q 2VW9A 4NXML 2VY3A 2WB1G 4JI8L 5BR8L 4DV6L 1N8RC 4LFCL 1N36Q 3DLLA 3BJUA 1Y1VG 1MJCA 4YY3Q 3I4OA 3VDYA 1QZGA 4DR4L 1CKMA 5C0XI 4HJ8A 1YEZA 2D62A 2R6GA 1B70B 3CCMA 1VQ6A 5IP9G 2VUMG 3S1NH 3GD7A 4WJ4A 2PI2E 3FKIH 4QY7A 2ZJRA 1XMQQ 4A93G 4LW1A 4C3JH 1XPUA 2JK8A 4L5TA 4IOAA 1VQ8A 1YHBA 3UDFA 2CQOA 4UP9A 4LFBL 4JBMA 3HOWG 2OCEA 4LF5Q 1EWIA 1KRSA 5IT9c 2R92H 3CF5A 3PSIA 4RMFA 4NXMQ 1PVOA 5BR8Q 4NPSA 1HNWL 4LFCQ 4LF4L 3DM3A 1YHQA 1C9OA 4P75A 1PH5A 4HJ9A 2ALYB 3A5ZB 2OQ0A 1DGSA 3HOXH 4KHPL 3HKZG 4JC0A 1QVFA 3HOYH 4DV5L 1UWVA 2Z6KC 4A3CH 3FKIG 1TWFH 2UXDL 3HOZH 4OWWB 4PZ7A 5JJKA 2YTXA 3M4PA 1S72A 4LFBQ 3A0JA 3RN5A 1KC8C 1FL0A 1TXYA 1Z47A 3M4QA 3NELA 2Y0SE 4MZ9A 1SN8A 4K0KL 5JEAG 1C7YA 4A3DH 4PZ6A 3PUWA 4UPAA 1SLJA 4BBRH 2QGQA 3JAMc 3J81c 4LF4Q 2R92G 2R93H 1L2FA 2JE6I 2HHHL 3CW2C 1EOVA 1OXXK 5M3FH 2NZOA 2EXDA 4DV0L 2K5NA 3F1ZA 3G71A 3F2DA 2KENA 4KHPQ 3FP9A 1E24A 1JE5A 4DV5Q 1HNXQ 1A62A 3CCRA 3HOXG 1N34Q 1E7ZA 3HOYG 2GN5A 3GTQH 4YHHL 4EX5A 1GO3E 5IWAL 4YCUA 4BBSH 4X65L 5IY0A 3GTKH 4GLAC 4A3CG 2MNAA 5JJIA 1GKHA 3UE0A 2E2JH 1LYLA 3HOZG 1KL9A 1I5FA 4DV2Q 2JQOA 3CC4A 2WP8J 2OQKA 1XMOL 4DKAC 2VQFL 3TS2A 3ICEA 3TS0A 1Q82C 3KF8B 1I50H 3S24A 1NBWA 4X62L 1FVIA 2Q2IA 4A3DG 5C3EH 2WFWA 4DAYB 5IYBG 3PF4A 2IY5B 3AFPA 1YZ6A 2R93G 1OXUA 4DV0Q 2I5MX 4P71A 3UDIA 5IYCG 5M3FG 3ERSX 2R7DA 2JA6H 2VZAA 2I5HA 3M85A 4DR2L 3F8TA 1D8LA 4YHHQ 1CKNB 5IWAQ 2UU9Q 1Q8KA 1K9MC 1OXTA 4LF7L 3GTOH 3KDFA 4OO1I 1B7YB 3CCJA 1CSPA 1VQIA 4LWCA 4BBSG 3CP0A 1XMOQ 2H5XA 2VQFQ 1Q1EA 2WB1E 4NXNL 3ULPA 1UE5A 1Y14B 4JI3Q 2F3IA 4P73A 1WFQA 2HT1A 3S17H 1I3QH 4QJFA 3RLOA 1W3SA 1CKNA 4IFDI 3FHWA 3I56A 3ER0A 3Q8DA 4DK3C 1YIJA 4ALPA 2A19A 5C3EG 4L5RC 4LF6L 5K36G 4KHZA 1LM0A 4DR2Q 3E9IA 4Y52H 3I4MH 1E1OA 4YCVA 2JA6G 1L0WA 1BBUA 3ZJYC 4LF7Q 3H3VH 3RZOH 2WAQG 2QA4A 4QQBX 1B8AA 2A8VA 4XIGS 2NVQH 3STBC 4DR7L 1GVPA 4WJ3M 2NVXH 2F52A 2CCZA 3GTPH 2JEAI 2LXJA 4NXNQ 3K7UC 3CC7A 2IX0A 4JI5Q 1HZCA 4X64L 4A76A 1IBLL 4X66L 1R9TH 3CCLA 3HOUH 5IYDH 4BA1I 3U58A 3KLWA 4LUOA 1VQLA 3T1YL 1PH6A 4BY1H 4LF6Q 4MTNA 3KFUA 5GROA 2N49A 4OXPA