2A1RA

Crystal structure of parn nuclease domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
423
structure length
300
Chain Sequence
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLRHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*A)-3'
publication title Structural insight into poly(A) binding and catalytic mechanism of human PARN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 86
structure length 300
sequence length 423
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2a1rA01
4CHNA 1HNVA 3PO4A 1KLNA 3V9XA 3SQ0A 1S6QA 5I42A 4BDZA 3KLFA 3HSTB 5HRPA 1BIZA 4DS5A 1VSLA 2BGGA 2IGIA 4CK3A 1HYVA 3AVBA 3CFRA 1R0AA 1UOCA 4KI6A 4ELVA 2HNYA 4CIEA 3OYDA 3KIOA 3BGRA 1YT3A 3OJUA 4I9QA 3QNNA 1TKXA 1RTDA 3KKRA 2YNGA 3AA4A 3ZSVA 3EYZA 4M3WA 3VQAA 1BL3A 3HL8A 4DS4A 1XHXA 1WN7A 1NK8A 1ZBHA 4O55A 1NK5A 3FFIA 3LP2A 5T7BA 1UWBA 4I2PA 2BANA 4ID1A 1DTTA 1WSHA 3VQ6A 3NH1A 1EXQA 1SL1A 4N41A 2KFZA 3AO1A 3O4NA 1RT3A 4CJTA 4C8KA 3AO2A 1VSMA 3TAMA 5SZTA 4ZTFA 1QTMA 4E1MA 4EZ6A 4CGIA 4N76A 4Z4FA 1BQNA 4KV8A 1VSDA 1I39A 4HCCA 4HUFA 4M3ZA 5D3GA 4Z4CA 3CFPA 4IDKA 4DFKA 1ZBIA 1JXEA 3AVFA 3QINA 1A5XA 3ZSXA 3C94A 2ZQBA 1ASUA 1J9AA 3OYLA 4E7KA 2XY6A 3TAPA 2YNIA 4CERA 1SL0A 4DQPA 1KVBA 1S6PA 3DLRA 4J2BA 3TABA 4RG8A 4RW8A 3I8DA 1VK0A 1KCFA 3AVLA 3K2PA 4R5PA 4BDPA 4NYNA 3OY9A 4FLYA 4LSLA 2FBVA 3OYFA 2Z1HA 1TK0A 4W5RA 4JRPA 4B9SA 4W5TA 4E7LA 3S3NA 1JKHA 3WNEA 3TAGA 2JGUA 3L3UA 3KTQA 3ZSRA 4DG1A 1NK0A 2HHTA 4OKJA 5E41A 1ZBFA 2HHUA 1HYSA 4FW1A 4AHUA 1RTJA 2A1SA 3SV4A 3C6TA 2PYJA 1QHTA 5EU7A 4FCYA 3TI0A 2OA8A 1TGOA 1WLJA 1WSEA 3I0SA 1RT6A 4IG0A 5J1EA 1HQEA 3HVRA 3C6UA 1W0HA 4JLHA 4FM0A 4DQRA 1TKDA 4FJNA 2HHVA 3O3HA 4OPKA 3AA2A 1JLCA 4KO0A 3AVNA 4MFBA 2XY8A 3LP1A 2HNZA 4KAZA 3MAQA 2IOCA 4KHNA 1D8YA 4FYDA 3QESA 3OYAA 1FKPA 3RMBA 4CHPA 2Z1IA 3OYGA 1IKYA 1C1BA 3M8RA 3VQBA 2OPQA 3KKSA 1EETA 4AHTA 1QSLA 4M42A 1NKBA 5FRMA 1RT7A 4BDYA 3AO5A 4Z0UA 4KPYA 4WE1A 3SUPA 1HJRA 3ISNC 3DLGA 2AJQA 1XWLA 3OVNA 1WSGA 3IRXA 1LV5A 4C8NA 4CESA 4ZTJA 4RW6A 1S1WA 1BGXT 1TV6A 4G1QA 4LD0A 4F4KA 1YTUA 2HHWA 3AVGA 3M8QA 4IFVA 4CJ5A 4CJEA 4CIFA 2G8IA 2Y1JA 1SKWA 4LSNA 2YHAA 5HBMA 3HPOA 4DFMA 5HRNA 3OYMA 3LP0A 4J2AA 3K58A 3VQQA 2YNFA 4HVJA 3K5LA 4DWIA 4TSXA 1NJWA 3O3GA 4NYFA 4CK1A 4HCBA 4DTSA 1ITGA 3OYNA 4CHZA 1D9FA 4CJWA 1A5VA 1BHLA 2IDOA 2G8VA 3TARA 5KGWA 1RDCA 3AA3A 3OS2A 1RTIA 2WOMA 3ZT3A 4CJFA 3V9ZA 3P83D 4NCBA 4N5SA 4M41A 1CXUA 3DMJA 1NJZA 2Q3SA 4RW9A 1BCOA 1S1UA 1SKSA 3G10A 4RW4A 3HPGA 4H4OA 4B9MA 2GBZA 4DLGA 1JLEA 1EKEA 3SI6A 2IC3A 4KB0A 4FZXC 1NOYA 1QSSA 1SKRA 3TAFA 3CYMA 3SUOA 4CJPA 4IBNA 4ZHRA 1X9WA 1SV5A 4CJKA 2KTQA 1IKWA 1IG9A 4W5OA 5JS1A 4Z4HA 4Z4GA 3NF6A 4CEZA 3OS0A 1T05A 1RNHA 4CJSA 1C1AA 4HHTA 1CLQA 1RDAA 4Y1DA 2QXFA 1WSIA 3AVJA 4CEDA 3K59A 4DSLA 1IH7A 4DF4A 1HNIA 2X6SA 4AHVA 1U48A 3HJFA 3B6PA 4YNQA 3SPZA 1VSFA 2DFHA 2FBTA 1HMVA 1CZ9A 3OS1A 4M3UA 2A1RA 4JRQA 2RF2A 3SZ2A 1Q9YA 1ZBLA 3MEGA 4CIGA 3TAQA 3SUQA 1U47A 3RTVA 3WNGA 5K14A 3QEPA 4ELUA 3AVMA 5CY4A 1A5WA 1NK4A 1TL1A 4N56A 3NGIA 3VA3A 4M3TA 4GMJB 3RWUA 1FKOA 1SUQA 4E1NA 4IFYA 3TR8A 4KHYA 1C0MA 4FJ8A 4KB1A 2EHGA 4LH5A 4FM2A 5KI6A 2D0CA 2QKKA 1TVRA 4F8RA 4KTZA 4CEAA 2HMIA 4K8ZA 4FJIA 3LP3A 3QEIA 3KLEA 4DFJA 1HRHA 4PY5A 4J2DA 3CG7A 2OPSA 4FK0A 4IG3A 4CF8A 4FVMA 1KFSA 2WONA 1W9HA 3ALYA 1XHZA 2B5JA 2Z1GA 2P5OA 3BDPA 1JL2A 1HPZA 2P1JA 2XRIA 5DMRA 1ZBUA 4CJLA 1REVA 1TKZA 3L8BA 2PZSA 4B9UA 1LW2A 5J2NA 3ASMA 1RT5A 4DSKA 1JLAA 1ASVA 3DOLA 3O4QA 4B9LA 3MXIA 5I3UA 2DFFA 2ITGA 5SWMA 4KFBA 4E7JA 2G8UA 2P5GA 2QKBA 4CGHA 3L2UA 4JS5A 3AO3A 4KHQA 1NKCA 2O4GA 3SV3A 1T7PA 3DLHA 2HW3A 5C24A 2HVIA 4UQGA 4Z4IA 1LW0A 1QQCA 3AVIA 4I2QA 3LWMA 4MQ3A 3TAEA 2FBXA 1GOBA 3CFOA 3DLKA 4B9NA 4JS4A 4B3OA 3QLHA 4KTQA 4KTWA 3QERA 3L2QA 3L3VA 4DTXA 3HVTA 1LWFA 1RBSA 2XY5A 4FJKA 5J2MA 4DSFA 1TKTA 4CECA 4FJGA 3SYZA 2VG7A 4FJ5A 1RTHA 3NAEA 5FDLA 3KLGA 3CQ8A 1LWCA 4LY7A 4RW7A 3MXMA 1HYZA 1IO2A 5DK5A 3QIOA 3RRHA 3SQ2A 1GOCA 4DMNA 1RDDA 2FC0A 1BCMA 4I9LA 1BI4B 3DM2A 4CHOA 3RMAA 1BQMA 5HRRA 5HRSA 5KRTA 3ZT4A 4H4MA 1KVCA 1RT2A 1B92A 1RBTA 2VWKA 3AA5X 1EX4A 2KW4A 4O44A 2G8KA 4DTRA 4CGFA 4DTPA 2VWJA 3U6FA 4B9VA 3OYKA 1HQUA 4KHUA 3SNNA 4BE2A 1RBUA 5CZ1A 3V9UA 3DLBA 3V81A 2R7YA 4ICLA 3NF9A 4DSIA 4KHWA 1WNSA 4KRFA 2HHQA 2B6AA 4FJXA 1KTQA 4BWMA 4FLWA 1LAVA 2IAJA 3HM9A 3ULDA 1N5YA 3ZT2A 2HHSA 1VRTA 3IAYA 2XY7A 2O4IA 3K5NA 1KRPA 4DTJA 1C0UA 1IKVA 3U3GA 4DU4A 3OYHA 2G8WA 2QK9A 3SQ1A 3V1QA 4E19A 5C42A 4Q0BA 3TANA 1L3VA 3HYFA 4CF2A 4GVMA 1C1CA 3CM5A 3HO1A 2HVHA 2F8TA 1TK8A 3K57A 4OPJA 4BACA 3DOKA 4DFPA 1J5OA 3VQDA 2X78A 2OZMA 1YVUA 4FLZA 5HROA 3AVKA 1GOAA 4FK4A 3KK1A 3DI6A 4PQUA 1X9MA 1KVAA 3PX0A 3RMCA 3RR8A 3H08A 4GW6A 3K5OA 5KTQA 1Q9XA 1SL2A 3LZIA 3PO5A 1X1PA 2ETJA 3S9HA 2DFEA 2OPRA 2G8HA 4DTUA 3ZSWA 2Z1JA 4FK2A 1C0TA 4OJRA 4CJVA 3OYEA 3LWLA 1O1WA 3PUFA 3L2VA 4FJJA 1VSEA 4CEQA 4FZZA 3MECA 3AVAA 3VQ8A 1NJXA 2KZZA 3ITHA 3V4IA 3QNOA 1L3SA 4F3OA 2FBYA 4OGEA 3NGZA 3L2RA 1L3TA 2BDPA 2OZSA 4CHQA 3OYJA 4M3RA 1QE1A 4AHCA 4CJ4A 3ZCMA 4CF1A 3RMDA 3DYAA 4LH4A 3V1OA 1KSPA 2F8SA 4F2RA 4OLAA 1J53A 1B9DA 1TL3A 5JS2A 1RT1A 4BE1A 1QS4A 4N47A 3ZSYA 4B08A 1U45A 3OYCA 3SCXA 4C8LA 3G0ZA 3T3FA 4CJRA 4Z4EA 3V9SA 4CEFA 4FLVA 1JL1A 3KLIA 3P1GA 3VQ7A 3HPHA 4NCGA 4FXDA 4AH9A 1B9FA 4E89A 3NH0A 3RRGA 3LZJA 3NF7A 3QETA 4QAGA 3HP9A 2LSNA 3LAKA 1WAJA 3AO4A 2KQ2A 3C95A 1RBRA 3M8SA 4KKOA 3RR7A 1RBVA 4CGGA 3QEVA 3V6DA 1VSKA 1Y97A 1VRUA 3V9WA 1N6QA 4KI4A 2PY5A 1NK9A 3MXJA 4FW2A 4HUEA 4B9TA 3D45A 5J2PA 2GUIA 3TWHA 4DTNA 1QSYA 4I7FA 1NJYA 3MEDA 3B6OA 3L2WA 5FRNA 3S3OA 4C8OA 4L8RB 2D0BA 1I3AA 3QO9A 1WSFA 4C8MA 4XIUA 4DQIA 3V1RA 3NHGA 1VSHA 2IS3A 3CM6A 3DRSA 3UIQA 1XC9A 3PX6A 3WNHA 1U04A 3HK2A 2D0AA 3A2FA 2E6LA 1G15A 3NCIA 1Z26A 3ZT0A 1U4BA 4KREA 3ZT1A 1FXXA 1KLMA 5KRSA 2GV9A 3OYIA 3SQ4A 1L5UA 4NCAA 4Y1CA 4OKKA 3NGYA 3VQCA 4CFDA 3HP6A 1XI1A 1TK5A 4W5NA 4DSEA 4PA1A 4CFBA 4E7IA 1DTQA 1NKEA 4DU3A 3ZSQA 3KD5E 1Q8IA 1VSJA 2DTUA 1CXQA 1KFDA 3VQ5A 4DLEA 4FJ9A 4DF8A 2JLEA 3KJVA 2ZD1A 3P5JA 4KHSA 2YKNA 2YKMA 3VQPA 2ZE2A 4PWDA 1WSJA 3M8PA 4K8XA 4FJLA 5KGXA 5HLFA 3IG1A 4CHYA 3F73A 1BISA 4B8CA 3OYBA 4EZ9A 1LAWA 1RCHA 4ELTA 4FJ7A 4QCLA 3NFAA 2KFNA 4CEOA 3NF8A 4CCHA 2E6MA 2Y1IA 2EX3A 3E01A 4FJMA 3AVHA 3EZ5A 4FLXA 3D0PA 4BWJA 4CJUA 3VQ4A 4DTOA 5CYMA 4CGJA 4CEBA 1DLOA 1S5JA 1C6VA 1JXBA 4CE9A 3HT3A 3WNFA 4DQSA 3LDSA 4O0JA 4FLTA 3JSMA 3LPTA 1RT4A 1JLBA 2OPPA 2YHBA 3LPUA 2P51A 5CZ2A 4O5BA 5FROA 4W5QA 3THVA 1JLGA 1BI4A 3VQEA 3LANA 4F3TA 4DQQA 5J2QA 3U3YA 1T8EA 3EY1A 4HTUA 3NH2A 4E3SA 3DLEA 3HXMA 4AILC 4DSJA 4CJ3A 2D5RA 1ASWA 3PY8A 2W42A 4EP4A 3LALA 2E4LA 4B8AB 3QEXA 4QOZB 4E7HA 2X6NA 4AHSA 1TAUA 1UAXA 1JLQA 1NK7A 4CGDA 3AVCA 2VG5A 4CF9A 3O3FA 1NK6A 2RN2A 4IKFA 2XO7A 3F9KA 1RILA 2NUBA 3QEWA 3PX4A 4M3XA 3VN5A 1U49A 2KZMA 1MU2A 2I5JA 4M45A 3DRRA 2G8FA 4FZYA 4FJHA 2RPIA 3KD1E 1T03A 2XHBA 1S1VA 4DU1A 1YTAA 1LWEA 4CEEA 3T1AA 3IS9A 4OGCA 3ZSOA 3SPYA 3JYTA 4OLBA 2DY4A 3K5MA 2YNHA 1FK9A 4DTMA 1F21A 1WAFA 1Z25A 1EP4A 2X74A 4OVLA 3VA0A 1X9SA 2HHXA 4F2SA 3SUNA 3S3MA 3PV8A 1L3UA 1BIUA 4YFUA 3VQ9A 1D9DA 5HP1A 1IKXA 1S9EA 4FLUA 2OYQA 1S9GA 3KK2A 3KK3A 1NOZA 1UA1A 4M3YA 4O4GA 2VG6A 1D5AA 4BE0A 5CYQA 4FM1A 2RKIA 4H8KA 1UA0A 4J2EA 1S1XA 2ATQA 3ZSZA 4CK2A 4EP5A 3I0RA 1JLFA 2BE2A 3LAMA 2HB5A 4CFCA 4OKEA 2PYLA 1S1TA 3QIPA 1RDBA 4CF0A 2B4JA 4AHRA 4CFAA 4HUGA 2YV0X 3T19A 3SJJA 3DRPA 4Q5VA 1CZBA 4E0DA 5C25A 1VSIA 2HNDA 3OJSA 3KLHA 2F96A 1J54A 4PUOA 3AV9A 4ID5A 4CJQA 4O0IA 3NDKA 1TAQA 3NE6A 1ZYQA 3NBPA 1K6YA 3MEEA
chains in the Genus database with same CATH superfamily
1HNVA 4JHDB 3KLFA 3HSTB 5ELZA 3RVCA 3AVBA 4ILGB 4ELVA 5KPRA 3O08A 4MO4A 1RGIA 2H3GX 3MMVA 1VQ4N 4JV5K 2YJFA 1BL3A 3QFUA 1NK8A 3GL1A 4O55A 1IBKK 2FSJA 3FFIA 1DTTA 3AO1A 2E2QA 4C8KA 5AQNA 4DR3K 3TAMA 4ZTFA 4JK8A 1BDGA 4DV2K 4V19S 1OH6A 1XMOK 4M3ZA 5D3GA 5EXWA 4Z4CA 4IDKA 3AVFA 3QINA 2ZQBA 5GAGP 1JCEA 2Q36A 3OYLA 4E7KA 2XY6A 1HR0K 1YF5L 2QWNA 4IFEA 4J2BA 3CJ1A 1VK0A 4R5PA 3OY9A 4FLYA 2FBVA 4FSVA 4W5TA 3VEYA 3TAGA 4DQ8A 3D6RA 4M7XA 1V4SA 1RTJA 2HBJA 2O8CB 1WLJA 4UY8O 4OLAA 1RT6A 4DU1A 4FM0A 4JLHA 1WB9A 3O3HA 3IFRA 3UKUB 3LP1A 3MAQA 2I7NA 2O8CA 1FKPA 3CJ7A 3OYGA 3O8MA 3I56N 2OPQA 3KKSA 3J80O 1RT7A 4ISGA 4BRDA 1WBDA 4KPYA 3DJCA 3SUPA 1TUYA 3VESA 1XWLA 1WSGA 3OBYA 3WXKA 4C8NA 4AQYK 1TV6A 1YXQA 1QQNA 4G1QA 4F4KA 4CJ5A 4CIFA 4DV0K 3IKMA 5HBMA 3OYMA 4H5RA 4E1JA 3PLAA 3VQQA 1IBLK 3CF5L 2W41A 4DWIA 1NJWA 4CK1A 2VYPA 3CJAA 4DTSA 4CHZA 3E9LA 3FLCO 1BHLA 1RTIA 3D7EO 4LFAK 4H0TB 3P83D 4JK9A 1BCOA 1S1UA 2IVNA 4IJAA 4JKEA 4CI6A 2P9LB 4QS7A 3JAMO 1EKEA 1HKBA 4KB0A 1NOYA 5E84A 4IXCA 3SJHA 3CYMA 2RE2A 3OBWA 1X9WA 4H0YB 4OO1J 4LF4K 1IKWA 4Z4GA 1T05A 1RNHA 3A0IX 4PHTX 1C1AA 5BPLA 2P9LA 4CEDA 1IH7A 5BRFA 2X6SA 3H46O 3HJFA 2FBTA 3T1HK 1YJNN 3O5BA 1SS6A 3W3DA 3ZETA 3RTVA 3WNGA 5K14A 4ELUA 3AVMA 3QBWA 1A5WA 1TL1A 2A41A 1QVFM 3RWUA 1KD1O 2JWKA 4LH5A 4FM2A 5KI6A 2D0CA 5E26A 4KTZA 4I6MB 2GWJA 3LDPA 4FVMA 1KFSA 2WONA 1W9HA 3ALYA 3DLLL 2P5OA 4JI0K 3BDPA 4HTLA 1JL2A 2XRIA 5JLFA 1ZBUA 3ASMA 4I6MA 2G8UA 5SWMA 2P5GA 3P39A 2QKBA 1T7PA 4Z4IA 1QQCA 3AVIA 3LWMA 4DV4K 3MN9A 3CFOA 3PSIA 4KTQA 1X9JA 4FJKA 2XY5A 3THWB 4FJGA 3SYZA 2VG7A 4O8UA 4FJ5A 2RHKA 5FDLA 3CQ8A 1KAYA 3JS6A 4LFBK 4DR6K 1HYZA 1GOCA 4CHOA 3VEXA 1BI4B 4FO0A 1BQMA 5HRRA 1KVCA 1B92A 3DXKA 1RBTA 2VWKA 2G8KA 4DTPA 4CGFA 1J6ZA 4BE2A 2OANA 1RBUA 3OHRA 5CZ1A 3V81A 5AQRA 4FLWA 4OPAA 3I55N 2HMPA 2O4IA 1Q7YO 3I33A 3K5NA 2GTDA 5AQWA 2W40A 3OYHA 3V1QA 1VQKN 4Q0BA 3HYFA 3HO1A 2HVHA 3K57A 4BACA 3AARA 3VEWA 4FWRA 2X78A 3VQDA 1M1KO 3CCRN 4WQ4C 4JKDA 3AVKA 5AQPA 2QI2A 3RMCA 3RR8A 3PO5A 2DFEA 3ZSWA 1S22A 4OJRA 1VSEA 2V7YA 2P9SB 3AVAA 3E66A 4JKCA 2Q0RA 3QNOA 3CCVN 5F0XA 4OGEA 1GLBG 1L3TA 2BDPA 2OZSA 1YITN 4M3RA 1ZXOA 4CJ4A 3RMDA 4JYAK 4OX9K 3P38A 3FE1A 3ZSYA 4BRIA 3V9SA 3VQ7A 5M1FA 4DUYK 4E89A 5F2RA 3R6MA 1XMQK 3NF7A 5BR9A 2O8DB 3AO4A 2KQ2A 4FOEA 4CGGA 1VSKA 4FWNA 1XQSC 3L2WA 3S3OA 1EQYA 4K41A 1WSFA 4JKHA 4XIUA 3NHGA 4U7BA 3ATUA 1DEJA 3CM6A 1OH7A 3PX6A 1U04A 4RCHA 4JD2A 3HK2A 2D0AA 5FPDA 1U4BA 3FZLA 4CFDA 5M1NA 1DTQA 1NKEA 3C0BA 2DTUA 1KFDA 4FJ9A 4DLEA 3VPZA 4GV3A 3RSEB 2ZD1A 4KHSA 1CZAN 2YKNA 4IOAL 1WSJA 2UYTA 4B3MK 3OYBA 1IG8A 1RCHA 4QCLA 2Y1IA 3AVHA 3EZ5A 4IEIA 4CGJA 5KQDA 1S5JA 3SAHA 3WNFA 4NXNK 3FR0A 4FLTA 3JSMA 1JLBA 2YHBA 5CZ2A 3VF4A 5KQ8A 3U3YA 4AILC 2D5RA 1ASWA 2CGKA 1TYQA 3MN5A 3LALA 2E4LA 4QOZB 1ILYA 1RDWX 1JLQA 4DKWA 3K9KA 2RN2A 1HKGA 3M6GA 3C6AA 1MU2A 4FZYA 4FJHA 1BG3A 4CBWA 4KH6A 4KH5A 1SZ2A 3BZCA 3T1AA 3IS9A 4OLBA 3J7YP 3CERA 3VA0A 3CMEN 1EP4A 2X74A 3SUNA 3S3MA 5EY4A 4YFUA 1C0FA 1IKXA 3L4IA 2OYQA 1NGHA 2BUPA 4KH4A 1NOZA 3C7NB 4BE0A 4JKFA 4IEEA 4FM1A 2RKIA 4H8KA 3TTDA 4CK2A 2BE2A 2D1KA 4OKEA 2I7PA 5F1XA 4CFAA 3QIPA 1RDBA 2Q1NA 4HUGA 2YV0X 1CZBA 4GKJK 2F96A 1J54A 5C10A 3NBPA 5EVZA 1GLAG 3PO4A 1EWRA 1KLNA 3V9XA 3SQ0A 3EKUA 5HRPA 1BIZA 1VSLA 3T69A 2IGIA 2BGGA 1R0AA 1UOCA 2HF3A 3KIOA 1GLJO 3D2FB 1TKXA 1RTDA 3KKRA 2YNGA 3AA4A 3ZSVA 3WUHA 3IUCA 3HL8A 3WEEB 4DS4A 3O4WA 4RTFD 2P9UA 3LP2A 3UE5A 1K73O 1BO5O 3NH1A 1SL1A 1WSHA 1EXQA 1YAGA 3IMXA 3D2FA 4ILJA 4EZ6A 4E1MA 3WXLA 1BQNA 3D2EB 1VSDA 3WEEA 1I39A 1MA9B 4DFKA 1JXEA 1KAZA 1J9AA 3CXCM 4DQPA 1K8KB 3BZKA 4LC9B 1TK0A 5GAHP 3C65A 3D2EA 4W5RA 4JRPA 3DAWA 1JKHA 3WNEA 2NRXA 3L3UA 3KTQA 1HJOA 1N32K 1HYSA 4AHUA 3SV4A 1E3MA 1K8KA 1QHTA 5EU7A 4FCYA 2OA8A 3QFPA 5LMNK 3I0SA 1WSEA 2A40A 5CE3A 1VQMN 4FJNA 3C6UA 2HHVA 4BGBA 4NB4A 4DR4K 1NGBA 3AA2A 1JLCA 2E88A 5GIOA 2HNZA 1T6DA 5AFUA 2O8BB 4FYDA 3QESA 3OYAA 4CHPA 2Z1IA 4K43A 1V4TA 1C1BA 4B1XB 5FRMA 1M90O 2QXLA 4WE1A 3L6QA 3G6EN 1NGDA 4CESA 2GUPA 1S1WA 1YTUA 2VCPA 2Y1JA 4BR7A 5M1PA 3KVGA 4DFMA 4J2AA 3K58A 2WBNA 3K5LA 3TSQA 2FXUA 1ITGA 4PKGA 3G4SN 2IDOA 2G8VA 3TARA 4MO5A 3AA3A 3OS2A 1VQ7N 2WOMA 3MCPA 4CJFA 4M41A 4RW4A 1OKJA 5AQFA 4YORA 3C6HA 4BQLA 3O80A 4A2AA 1SKRA 3TAFA 2NRHA 4ZHRA 1SV5A 4CJKA 4Z4HA 4CEZA 4ISFA 3ZX0A 2HSTA 3AVJA 1WSIA 3BF3A 4IJNA 3J81O 3SPZA 1BA1A 3HI0A 4JHDA 4M3UA 3VMFB 4JRQA 2RF2A 3SZ2A 1P90A 2P9NB 1WBBA 1NK4A 1D4XA 3KHYA 4M3TA 4GMJB 1SUQA 1C0MA 4H03B 5ADXA 4JAXA 2QKKA 4F8RA 3VOVA 4CEAA 4FJIA 3KLEA 4DFJA 1HRHA 4IG3A 3EL2A 1XHZA 1LOTB 2Z1GA 1ATRA 1HPZA 3CCJN 1REVA 1MDUB 1RT5A 2FF3B 4WF9L 3DOLA 4NLBA 4BRAA 3MXIA 2DFFA 2ITGA 4E7JA 2NRRA 4CGHA 4JS5A 1NKCA 3DLHA 2HW3A 3O9UA 4UQGA 1LW0A 4MQ3A 4RWTA 4B9NA 4B3OA 4KTWA 3QERA 3L2QA 2UUAK 4CZIA 3T7ZA 4JI6K 4DSFA 1Q86O 4WFNL 3R9PA 4A59A 3WXJA 4LY7A 4RW7A 2GELA 5DK5A 3SQ2A 3QIOA 5KPZA 1BCMA 4MDAA 2QM1A 5HRSA 4H4MA 1RT2A 1Y64A 3U9ZA 3AA5X 2VWJA 5LY3A 3UKUA 1NWKA 2NZTA 4R79A 1Q82O 3ENBA 3V9UA 1N34K 3NF9A 2ASPA 4BR5A 3HRGA 3VEVA 3A5LC 5AQLA 1OH5A 2GWKA 2HHSA 1VRTA 3IAYA 2XY7A 1IKVA 4MDBA 4WQ5C 2G8WA 1Q81O 3VEZA 4E19A 5IWAK 4B1YB 4GVMA 1TK8A 5AQJA 4CZGA 4Y0WA 4CVNE 1OH8A 4FK4A 1YJ9N 5JICA 1KVAA 3CCQN 4GW6A 5KTQA 1Q9XA 4BRGA 2OPRA 4BVOA 4FK2A 1N8RO 3PUFA 4XH5A 2FSKA 2KZZA 3V4IA 1KQSM 1WUAA 1Q18A 3WXMB 1L3SA 3THYB 3L2RA 3L4QA 4AHCA 2F8SA 4MLHA 3GG4A 4CF1A 4DUZK 1B9DA 5JS2A 3G0ZA 3T3FA 1ATSA 4CEFA 4BG8A 1JL1A 4FLVA 2PAVA 3HPHA 4DV6K 4AH9A 1B9FA 3RRGA 3A5OC 2Q31A 3PSFA 2LSNA 3LAKA 1WAJA 2IIRA 2D0OA 3M8SA 2ITMA 3QEVA 3V9WA 3AAPA 3MXJA 3D45A 5C2FA 4DTNA 1QSYA 4C8OA 4QS8A 2D0BA 4BRQA 1VQ5N 2O8EB 3MK6A 2IS3A 3UIQA 3WNHA 2E6LA 3NCIA 4LF9K 4KREA 3ZT1A 3BP8A 1FW6A 1XC3A 1XI1A 3QDKA 4DSEA 3PIPL 2O8EA 3Q7CA 3KD5E 3I8BA 3CMAN 3ZEUB 3MN7A 3WT0A 1GLLO 2JLEA 3KJVA 3N4PA 2QTDA 2YKMA 2ZE2A 4PWDA 1RFQA 3M8PA 5HLFA 3IG1A 3TPQA 4EZ9A 1LAWA 4H0PA 3TU5A 2KHOA 4FOIA 2E6MA 1SAZA 3E01A 1IBMK 4BRFA 3F9MA 4FLXA 3D0PA 4BWJA 3THWA 2Q0UA 2OTLN 3NVKA 4CEBA 5M1QA 5DM6L 1DGKN 4BG9A 4JK7A 2F9TA 1RT4A 3LPUA 5FROA 1BI4A 3VQEA 4F3TA 3CCMN 4HTUA 2ZM6K 4E3SA 3DLEA 1MWKA 5DM7L 3HXMA 3SBTA 4EP4A 1QHAA 4E7HA 4CGDA 4IKFA 4Z94A 3F9KA 2XO7A 3QBXA 4M3XA 4YY3K 2E1ZA 2I5JA 3DRRA 2F4VK 2RPIA 3KD1E 1T03A 1LWEA 1KAXA 4CEEA 4K42A 3SPYA 3ZSOA 3J7AP 3K5MA 4DTMA 1F21A 4IO9L 2V7ZA 1QQOA 3U9DA 3PV8A 1OVYA 2YHXA 4A5BA 3J8AA 1UA1A 4M3YA 4XH4A 5CYQA 1UA0A 4J2EA 2KKZA 3ZSZA 5LMUK 3SAFA 3EEQA 3I0RA 3CETA 3LAMA 3M3ZA 2HB5A 3H3NO 1S1TA 2P9IB 2B4JA 2YI1A 4AM7A 3DRPA 4E0DA 5C25A 1VSIA 2HNDA 3KLHA 4ID5A 1ZYQA 3NE6A 2P9SA 3NDKA 2ZJRL 1FJGK 1K6YA 3N4QA 1S6QA 4BDZA 4B3RK 4CK3A 3CFRA 2P9IA 4NXMK 4KI6A 3ATVA 3OYDA 3BGRA 3VGKA 3E1YA 4PL7A 3OJUA 4I9QA 3QNNA 2YHYA 3LDOA 2ZGZA 4M3WA 3VQAA 1QQMA 1XHXA 1WN7A 1ZBHA 1NK5A 2O8DA 5TKYA 3HOSA 4A62A 5T7BA 3AGKA 4I2PA 4ID1A 4N41A 1NM1A 3FZFA 4GVEA 3BEXA 1VSMA 3ZYYX 1QTMA 4N76A 2GX9A 4XH1A 4BGAA 4Z4FA 4KV8A 4BC2A 1NLVA 4HCCA 4HUFA 2A5XA 3CFPA 1ZBIA 3ZSXA 3C94A 5AQMA 3UB5A 2YNIA 1SL0A 4AF1A 1U2VB 3DLRA 3TABA 3EE8A 3I8DA 3K2PA 1E4GT 2NLXA 4BDPA 3NMUA 4LSLA 3GE1A 2Z1HA 3CHWA 3ZSRA 4DG1A 5FLXO 4OKJA 5AZIB 4B1ZA 1ZBFA 3O1BA 4FW1A 2A1SA 3C6TA 2PYJA 3M1FA 3RSEA 3TI0A 1W97L 1TGOA 5J1EA 1HQEA 1TKDA 2FSNA 3SLCA 2XY8A 2CGJA 2IOCA 4KHNA 3H6EA 1D8YA 3A5MC 3CPEA 3RMBA 3VQBA 1EETA 4AHTA 3DWLA 4M42A 4JI2K 3EE9A 4FPAA 5BREA 1GLCG 3AO5A 4YOWA 3CQYA 4YDUC 5AJ3K 4LF6K 2E2NA 5AZJB 3DLGA 3IRXA 1LV5A 1YUWA 4RW6A 1BGXT 4LD0A 2HHWA 3AVGA 3M8QA 5KPTA 5AQZA 4YOVA 3HBTA 2Q2RA 3HPOA 5HRNA 3J7ZO 4H0XB 4ILHA 1S72N 4PKIA 3B8AX 5AZJA 5M1KA 3CQXA 4TSXA 4LFCK 3O3GA 4NYFA 2HBKA 3OW2M 5C12A 3OYNA 1D9FA 5LJVA 4CJWA 2UXCK 4BVPA 5KGWA 3P4IA 1RDCA 3EZWA 4NCBA 4N5SA 1NJZA 4WQ4A 4RW9A 2WUSA 1SKSA 3CC2N 3HPGA 4B9MA 4EHTA 3ID6A 3MWTA 1JLEA 3C7NA 3SI6A 2IC3A 3KZBA 4FZXC 3E9PA 4CJPA 4M63C 3OA9A 1IG9A 3NF6A 4L3QA 3CCSN 4CJSA 1RDAA 3SMPA 4Y1DA 5AR0A 3K59A 4DF4A 1HNIA 4AHVA 2HBMA 1VSFA 1HMVA 5LJWA 1CZ9A 1JJ2M 2A1RA 3TAQA 4CIGA 2CH6A 1U47A 2EWSA 3VF6A 4DV1K 3NGIA 3VA3A 1FKOA 4E1NA 4IFYA 4H0VB 4FJ8A 2W6LA 4BRLA 4PL8A 4A5AA 2BH1A 2YJEA 4IOCL 2HMIA 4K8ZA 3LP3A 4PY5A 4J2DA 1ZC6A 2OPSA 1VQON 4GV6A 2ZGYA 2B5JA 1TKZA 3L8BA 1LW2A 5J2NA 1JLAA 2NRTA 4KFBA 5M1OA 3L2UA 2VWBA 4BRCA 3WQUA 2O4GA 3SV3A 3EKSA 2HVIA 3BUZB 4I2QA 3TAEA 2FBXA 2VGNA 1GOBA 3CJ9A 2UXBK 4YOTA 2CGLA 4DTXA 4FVUA 1LWFA 1RBSA 4BC5A 5J2MA 3DXMB 4CECA 4CBUA 1QVGM 1RTHA 3NAEA 2NRVA 3MXMA 3R1XA 1T3VA 2P9PB 1VQ8N 4DMNA 1RDDA 2FC0A 4IWVA 3ZT4A 5IT9O 1NNEA 4JKBA 4A61A 4A57A 1EX4A 4DTRA 5B8HA 3U6FA 1MWMA 3OYKA 1HQUA 4KHUA 3SNNA 2O8BA 1VHXA 3DLBA 1NGIA 4KHWA 4ICLA 1WNSA 1NGGA 3KWIA 2B6AA 4CW7B 2HHQA 2HF4A 3VGMA 4FJXA 3TTFA 1KTQA 4EHUA 2IAJA 1N5YA 3ZT2A 2E2OA 3L0QA 4ISEA 3ENOA 4DU4A 4BR9A 2IVOA 3AGRA 5C42A 3SMSA 1C1CA 4OPJA 1J5OA 5HROA 3MDQA 3KK1A 4PQUA 1X9MA 3PX0A 3EO3A 1W7AA 3H08A 3K5OA 1X1PA 2ETJA 2Z1JA 4FJJA 3LWLA 1O1WA 3L2VA 4CEQA 2ASOA 3VF2A 3MECA 3VQ8A 1NJXA 3K9JA 3NGZA 4BC3A 4CHQA 2A3ZA 1QE1A 5I9EB 3ZCMA 3DYAA 3V1OA 1KSPA 3JXUA 4BE1A 3O9TA 4N47A 1U45A 3OYCA 2E20A 4BRKA 4CJRA 4BRNA 2UUCK 4Z4EA 3P1GA 3KLIA 1X3MA 4NCGA 3SBGA 3NH0A 3FZHA 1QZ5A 3NVMA 3LZJA 3QETA 4BROA 3HP9A 1T6CA 3VENA 3VGLA 1RBRA 4KKOA 1RBVA 1NG9A 3V6DA 4KI4A 1Y97A 1VRUA 3P31A 1N6QA 1NK9A 4CD1A 1HUXA 2GUIA 5J2PA 4I7FA 1NJYA 3MEDA 4IDHA 5FRNA 1I3AA 4BY9C 2P9NA 3FGUA 4DQIA 3V1RA 1VSHA 1XC9A 3Q7BA 3VTIA 3A2FA 1Z26A 3CC7N 5KRSA 5LL6Z 5EX5A 3SQ4A 2GV9A 5AQTA 5MLCQ 3OYIA 2NRWA 4Y1CA 3HP6A 3VQCA 4H5NA 2HHHK 2AA4A 5AQXA 4CFBA 4E7IA 1Q8IA 3VQ5A 3UKRB 4DF8A 3VQPA 4BRHA 2V51B 5KGXA 4FJLA 4DR5K 3MWPA 3F73A 3VTHA 4IO8A 1LCUA 2YHWA 3NFAA 1OVQA 4CEOA 4CZEA 3UKRA 4CCHA 3TSUA 1ATNA 1ZBSA 3ZX3A 4FJMA 5H1SQ 2O8FB 3VQ4A 1NJIO 5CYMA 5BR8K 4U67L 1DLOA 1C6VA 5AQOA 3LDSA 4O0JA 4A2BA 1BOTO 3LDQA 2OPPA 4O5BA 2QWPA 1JLGA 2A6AA 3LANA 4DQQA 1T8EA 3EY1A 4DSJA 4CJ3A 3PY8A 2O8FA 2W42A 1YVNA 3QEXA 4B8AB 2X6NA 1TAUA 1UAXA 1SQKA 2BTFA 1NK7A 3AVCA 1VQLN 3VERA 1RILA 3HM8A 4WFBL 5AFUH 4M45A 2G8FA 4JI7K 3O9RA 3R8EA 5AQQA 5GIPA 3E9OA 1YTAA 1ESVA 1GLEG 3JYTA 2DY4A 2YCHA 5GAEP 1FK9A 3HSCA 4C1NI 1WAFA 1Z25A 1G99A 2HHXA 4DR7K 4F2SA 1R59O 1L3UA 4FWOA 4CZLA 3VQ9A 1D9DA 1BWFO 4LF5K 1S9GA 3KK3A 1O13A 4KBOA 4O4GA 2VG6A 1D5AA 5JMVA 4FPBA 4LF7K 4X65K 3G25A 1P8ZA 3H1VX 4BR4A 3LM9A 5AQGA 4CF0A 4H0OA 3SJJA 4Q5VA 1S3XA 3OJSA 4PUOA 1C0GA 3KK7A 4EFHA 2QEXN 4CHNA 5I42A 3THYA 4DS5A 2E1YA 3F2KA 3ZETB 1HYVA 4JEPA 2HNYA 4CIEA 1HLUA 1YT3A 3TSPA 5CHIA 4FWMA 3EYZA 4H5TA 3LL3A 2FF6A 1EO1A 5AQUA 4BRPA 5FPNA 1XNQK 1HNWK 4YOYA 4BC4A 2VGMA 1K9MO 4K25A 1UWBA 3VQ6A 2BANA 1YJWN 2QW9A 4WYBA 3THXB 2KFZA 5AQSA 3O4NA 1RT3A 4CJTA 3CC4N 3AO2A 3O9QA 5SZTA 1NGCA 4CGIA 3AY9A 1GLDG 3ENHA 2V52B 3M5RA 4CZFA 1A5XA 1H1VA 3QB0A 4DR2K 1ASUA 3TAPA 1KC8O 3CI5A 4CERA 1I94K 3THXA 1KVBA 1S6PA 5ADXH 4RG8A 4RW8A 5FPMA 5BPNA 1KCFA 3U8XA 3AVLA 4NYNA 1BUPA 1GLFO 3OYFA 4B9SA 4HWIA 3AAQA 4E7LA 4JKGB 3S3NA 2JGUA 5HOOA 1NK0A 2HHTA 5E41A 1XUPO 2HHUA 3ZEUA 4CZJA 4BQZA 2IVPA 3ID8A 1RDUA 4DTUA 4IG0A 3HVRA 4DQRA 1W0HA 3DXKB 4DV5K 4JKGA 3ZX2A 3FZMA 2PBDA 2WFBA 3BF1A 4OPKA 5FPEA 4DR1K 4KO0A 3AVNA 4MFBA 2QWLA 4KAZA 4B1UB 2JWLA 2A42A 3MN6A 4B9QA 4K0KK 1IKYA 3MX2A 3M8RA 3O9SA 2E8AA 1QSLA 1NMDA 1NKBA 1YI2N 2FLOA 4BDYA 4WCEL 4Z0UA 3LM2A 1HJRA 3ISNC 2AJQA 1JCGA 3OVNA 3A5NC 3S41A 4ZTJA 3TTCA 2G8IA 4IFVA 3KWGA 4FWQA 4CJEA 2ZJQL 1SKWA 4LSNA 2YHAA 4G9ZA 1DKGD 3LP0A 3WQTA 1IV0A 2YNFA 4HVJA 1TUUA 4WQ5A 4HCBA 1BA0A 1A5VA 2OTJN 3ZT3A 3V9ZA 2F7TA 3ZLJA 1CXUA 3DMJA 4FWKA 4IZ9A 2Q3SA 4JI8K 1XNRK 3G10A 4H4OA 2GBZA 1HKCA 4JKAA 4DLGA 1QSSA 2QWMA 3SUOA 4CBXA 3FFKB 4IBNA 2KTQA 5JS1A 4JI5K 4W5OA 4C1NK 3W0LA 3LDLA 4EIAA 3OS0A 4HHTA 3O1WA 3CJBA 1CLQA 5HL7L 1VQ9N 2QXFA 4DB3A 4DSLA 3CCEN 1U48A 3T1YK 3B6PA 4YNQA 2DFHA 3GBTA 4X66K 4JI3K 3OS1A 4MLEA 5AQYA 1Q9YA 1ZBLA 3MEGA 3OTOK 4O8KA 3SUQA 3QEPA 5CY4A 1YHQN 1N33K 4DCHA 4N56A 3TR8A 4KHYA 2EHGA 3FZKA 4JD2B 2CH5A 1TVRA 1Z6RA 3H1QA 3QEIA 3CG7A 4FK0A 2Q97A 4CF8A 1BU6O 4PKHA 4OPHA 4CJLA 2P1JA 5DMRA 2PZSA 4B9UA 5BN9A 4DSKA 5GADP 1ASVA 1J5EK 3O4QA 4B9LA 3VEOA 5I3UA 4YHHK 3CCUN 4JNEA 3AO3A 4KHQA 5C24A 2DPNA 1NGEA 3QICA 1U2VA 3DLKA 4JS4A 3QLHA 2WC9A 4KHPK 3L3VA 5C2DA 3HVTA 4LF8K 4M7YA 1TKTA 3K0SA 4EAHD 4H5WA 2ZJPL 5AZIA 3KLGA 1LWCA 2ASMA 3RRHA 1IO2A 4CZHA 4J8FA 4I9LA 3DM2A 3RMAA 2QWQA 1VAZA 4BR2A 1JCFA 5KRTA 4CZKA 4O44A 2KW4A 1TYQB 3HOTA 5JVGL 4B9VA 5BRHA 3GDQA 5TKWA 1EWQA 2F9WA 2R7YA 4DSIA 5C15A 1VQPN 4KRFA 4DV3K 2HOEA 5C0YA 4BWMA 1LAVA 2AP1A 3HM9A 3ULDA 3GOIA 2QWRA 4JI4K 1KRPA 2D0PA 1C0UA 4QS9A 3U3GA 4DTJA 5GINA 1HX1A 5BRDA 2QK9A 3SQ1A 1VQ6N 3TANA 1VQNN 1L3VA 4CF2A 3CM5A 3MX5A 3WXIA 2F8TA 3DOKA 4DFPA 4YOXA 3LDNA 2OZMA 1YVUA 4FLZA 1NMNA 4X62K 1GOAA 1DT9A 2PFUA 3DI6A 1HNZK 1W2BM 4JI1K 1SL2A 3LZIA 3S9HA 4F9OA 1NGFA 3HTVA 2G8HA 5AQHA 1C0TA 4CJVA 3OYEA 4FZZA 2NNWA 3IDHA 3G71N 1Z05A 3ITHA 4CJ7A 2E5LK 4F3OA 2FBYA 1WOQA 3CJCA 2WTUA 3OYJA 1IJJA 1T44A 2W6KA 4LH4A 3ULEB 4AM6A 4F2RA 1J53A 1TL3A 1RT1A 1QS4A 4B08A 2VQEK 5JLHA 4C8LA 3SCXA 2QA4N 3U4LA 3SK3A 4FXDA 3CPWM 4QAGA 4JN4A 2P9UB 3ULEA 3F5TA 3C95A 4WFAL 2HBLA 3RR7A 4B3TK 4KB1A 3HZ6A 3EN9A 2PY5A 4B9TA 4FW2A 4HUEA 2GEMA 3TWHA 3CCLN 4GV9A 3B6OA 4L8RB 3QO9A 4C8MA 4B1VA 4FWPA 3DRSA 2ZWHA 1G15A 3ZT0A 4H5VA 4NCAA 1FXXA 1KLMA 4GNIA 1L5UA 4OKKA 3NGYA 1TK5A 4IOXA 4W5NA 4PA1A 4GY2B 2E2PA 4DU3A 3ZSQA 1VSJA 1CXQA 1X3NA 2P9KB 1KXPA 2UUBK 3SAGA 4O5FA 3P5JA 3A8YA 4K8XA 2VQFK 2OCEA 5AQKA 4CHYA 1BISA 4B8CA 4FWSA 3QMLA 2YX6A 4ELTA 3H45C 1K8AO 2UU9K 4FJ7A 2KFNA 3NF8A 2ZF5O 2P9KA 2EX3A 3MCAB 4CJUA 3DXMA 4DTOA 1E4FT 1JXBA 3H3OB 4CE9A 3HT3A 4DQSA 4B1WB 5AQVA 3LPTA 2P9PA 2UXDK 2P51A 4W5QA 3THVA 4B3SK 5J2QA 4C23A 1U6ZA 3NH2A 2D4WA 4BRMA 5BPMA 4BREA 1NU0A 4AHSA 2KLAA 4CF9A 2VG5A 3O3FA 1NK6A 1NBWA 4GKKK 2NUBA 3QEWA 4NLCA 3PX4A 2QWOA 4YDUA 3VN5A 4DHYA 1U49A 2KZMA 1N36K 5CR4A 3BY5A 4CZMA 2XHBA 1S1VA 4OGCA 2YNHA 4OVLA 1X9SA 4NO7A 3R3LA 5BN8A 1BIUA 5HP1A 1S9EA 4FLUA 3KK2A 5AQIA 4YOUA 1NGJA 1S1XA 2ATQA 4EP5A 1HNXK 1JLFA 2NRZA 4FL9A 1YIJN 2J4RA 4CFCA 3VETA 2PYLA 1NGAA 4DV7K 4AHRA 4BR0A 4X64K 4XEIA 3T19A 4FWLA 3PIOL 3O6WA 3CIPA 4CD3A 1HPMA 1QZ6A 3AV9A 4CJQA 5A2QO 4O0IA 1TAQA 5JVHL 5EOYA 3MEEA 3CD6N
chains in the Genus database with same CATH topology
4CHNA 1HNVA 3PO4A 1KLNA 3V9XA 3SQ0A 1S6QA 5I42A 4BDZA 3KLFA 3HSTB 5HRPA 1BIZA 4DS5A 1VSLA 2BGGA 2IGIA 4CK3A 1HYVA 3AVBA 3CFRA 1R0AA 1UOCA 4KI6A 4ELVA 2HNYA 4CIEA 3OYDA 3KIOA 3BGRA 1YT3A 3OJUA 4I9QA 3QNNA 1TKXA 1RTDA 3KKRA 2YNGA 3AA4A 3ZSVA 3EYZA 4M3WA 3VQAA 1BL3A 3HL8A 4DS4A 1XHXA 1WN7A 1NK8A 1ZBHA 4O55A 1NK5A 3FFIA 3LP2A 5T7BA 1UWBA 4I2PA 2BANA 4ID1A 1DTTA 1WSHA 3VQ6A 3NH1A 1EXQA 1SL1A 4N41A 2KFZA 3AO1A 3O4NA 1RT3A 4CJTA 4C8KA 3AO2A 1VSMA 3TAMA 5SZTA 4ZTFA 1QTMA 4E1MA 4EZ6A 4CGIA 4N76A 4Z4FA 1BQNA 4KV8A 1VSDA 1I39A 4HCCA 4HUFA 4M3ZA 5D3GA 4Z4CA 3CFPA 4IDKA 4DFKA 1ZBIA 1JXEA 3AVFA 3QINA 1A5XA 3ZSXA 3C94A 2ZQBA 1ASUA 1J9AA 3OYLA 4E7KA 2XY6A 3TAPA 2YNIA 4CERA 1SL0A 4DQPA 1KVBA 1S6PA 3DLRA 4J2BA 3TABA 4RG8A 4RW8A 3I8DA 1VK0A 1KCFA 3AVLA 3K2PA 4R5PA 4BDPA 4NYNA 3OY9A 4FLYA 4LSLA 2FBVA 3OYFA 2Z1HA 1TK0A 4W5RA 4JRPA 4B9SA 4W5TA 4E7LA 3S3NA 1JKHA 3WNEA 3TAGA 2JGUA 3L3UA 3KTQA 3ZSRA 4DG1A 1NK0A 2HHTA 4OKJA 5E41A 1ZBFA 2HHUA 1HYSA 4FW1A 4AHUA 1RTJA 2A1SA 3SV4A 3C6TA 2PYJA 1QHTA 5EU7A 4FCYA 3TI0A 2OA8A 1TGOA 1WLJA 1WSEA 3I0SA 1RT6A 4IG0A 5J1EA 1HQEA 3HVRA 3C6UA 1W0HA 4JLHA 4FM0A 4DQRA 1TKDA 4FJNA 2HHVA 3O3HA 4OPKA 3AA2A 1JLCA 4KO0A 3AVNA 4MFBA 2XY8A 3LP1A 2HNZA 4KAZA 3MAQA 2IOCA 4KHNA 1D8YA 4FYDA 3QESA 3OYAA 1FKPA 3RMBA 4CHPA 2Z1IA 3OYGA 1IKYA 1C1BA 3M8RA 3VQBA 2OPQA 3KKSA 1EETA 4AHTA 1QSLA 4M42A 1NKBA 5FRMA 1RT7A 4BDYA 3AO5A 4Z0UA 4KPYA 4WE1A 3SUPA 1HJRA 3ISNC 3DLGA 2AJQA 1XWLA 3OVNA 1WSGA 3IRXA 1LV5A 4C8NA 4CESA 4ZTJA 4RW6A 1S1WA 1BGXT 1TV6A 4G1QA 4LD0A 4F4KA 1YTUA 2HHWA 3AVGA 3M8QA 4IFVA 4CJ5A 4CJEA 4CIFA 2G8IA 2Y1JA 1SKWA 4LSNA 2YHAA 5HBMA 3HPOA 4DFMA 5HRNA 3OYMA 3LP0A 4J2AA 3K58A 3VQQA 2YNFA 4HVJA 3K5LA 4DWIA 4TSXA 1NJWA 3O3GA 4NYFA 4CK1A 4HCBA 4DTSA 1ITGA 3OYNA 4CHZA 1D9FA 4CJWA 1A5VA 1BHLA 2IDOA 2G8VA 3TARA 5KGWA 1RDCA 3AA3A 3OS2A 1RTIA 2WOMA 3ZT3A 4CJFA 3V9ZA 3P83D 4NCBA 4N5SA 4M41A 1CXUA 3DMJA 1NJZA 2Q3SA 4RW9A 1BCOA 1S1UA 1SKSA 3G10A 4RW4A 3HPGA 4H4OA 4B9MA 2GBZA 4DLGA 1JLEA 1EKEA 3SI6A 2IC3A 4KB0A 4FZXC 1NOYA 1QSSA 1SKRA 3TAFA 3CYMA 3SUOA 4CJPA 4IBNA 4ZHRA 1X9WA 1SV5A 4CJKA 2KTQA 1IKWA 1IG9A 4W5OA 5JS1A 4Z4HA 4Z4GA 3NF6A 4CEZA 3OS0A 1T05A 1RNHA 4CJSA 1C1AA 4HHTA 1CLQA 1RDAA 4Y1DA 2QXFA 1WSIA 3AVJA 4CEDA 3K59A 4DSLA 1IH7A 4DF4A 1HNIA 2X6SA 4AHVA 1U48A 3HJFA 3B6PA 4YNQA 3SPZA 1VSFA 2DFHA 2FBTA 1HMVA 1CZ9A 3OS1A 4M3UA 2A1RA 4JRQA 2RF2A 3SZ2A 1Q9YA 1ZBLA 3MEGA 4CIGA 3TAQA 3SUQA 1U47A 3RTVA 3WNGA 5K14A 3QEPA 4ELUA 3AVMA 5CY4A 1A5WA 1NK4A 1TL1A 4N56A 3NGIA 3VA3A 4M3TA 4GMJB 3RWUA 1FKOA 1SUQA 4E1NA 4IFYA 3TR8A 4KHYA 1C0MA 4FJ8A 4KB1A 2EHGA 4LH5A 4FM2A 5KI6A 2D0CA 2QKKA 1TVRA 4F8RA 4KTZA 4CEAA 2HMIA 4K8ZA 4FJIA 3LP3A 3QEIA 3KLEA 4DFJA 1HRHA 4PY5A 4J2DA 3CG7A 2OPSA 4FK0A 4IG3A 4CF8A 4FVMA 1KFSA 2WONA 1W9HA 3ALYA 1XHZA 2B5JA 2Z1GA 2P5OA 3BDPA 1JL2A 1HPZA 2P1JA 2XRIA 5DMRA 1ZBUA 4CJLA 1REVA 1TKZA 3L8BA 2PZSA 4B9UA 1LW2A 5J2NA 3ASMA 1RT5A 4DSKA 1JLAA 1ASVA 3DOLA 3O4QA 4B9LA 3MXIA 5I3UA 2DFFA 2ITGA 5SWMA 4KFBA 4E7JA 2G8UA 2P5GA 2QKBA 4CGHA 3L2UA 4JS5A 3AO3A 4KHQA 1NKCA 2O4GA 3SV3A 1T7PA 3DLHA 2HW3A 5C24A 2HVIA 4UQGA 4Z4IA 1LW0A 1QQCA 3AVIA 4I2QA 3LWMA 4MQ3A 3TAEA 2FBXA 1GOBA 3CFOA 3DLKA 4B9NA 4JS4A 4B3OA 3QLHA 4KTQA 4KTWA 3QERA 3L2QA 3L3VA 4DTXA 3HVTA 1LWFA 1RBSA 2XY5A 4FJKA 5J2MA 4DSFA 1TKTA 4CECA 4FJGA 3SYZA 2VG7A 4FJ5A 1RTHA 3NAEA 5FDLA 3KLGA 3CQ8A 1LWCA 4LY7A 4RW7A 3MXMA 1HYZA 1IO2A 5DK5A 3QIOA 3RRHA 3SQ2A 1GOCA 4DMNA 1RDDA 2FC0A 1BCMA 4I9LA 1BI4B 3DM2A 4CHOA 3RMAA 1BQMA 5HRRA 5HRSA 5KRTA 3ZT4A 4H4MA 1KVCA 1RT2A 1B92A 1RBTA 2VWKA 3AA5X 1EX4A 2KW4A 4O44A 2G8KA 4DTRA 4CGFA 4DTPA 2VWJA 3U6FA 4B9VA 3OYKA 1HQUA 4KHUA 3SNNA 4BE2A 1RBUA 5CZ1A 3V9UA 3DLBA 3V81A 2R7YA 4ICLA 3NF9A 4DSIA 4KHWA 1WNSA 4KRFA 2HHQA 2B6AA 4FJXA 1KTQA 4BWMA 4FLWA 1LAVA 2IAJA 3HM9A 3ULDA 1N5YA 3ZT2A 2HHSA 1VRTA 3IAYA 2XY7A 2O4IA 3K5NA 1KRPA 4DTJA 1C0UA 1IKVA 3U3GA 4DU4A 3OYHA 2G8WA 2QK9A 3SQ1A 3V1QA 4E19A 5C42A 4Q0BA 3TANA 1L3VA 3HYFA 4CF2A 4GVMA 1C1CA 3CM5A 3HO1A 2HVHA 2F8TA 1TK8A 3K57A 4OPJA 4BACA 3DOKA 4DFPA 1J5OA 3VQDA 2X78A 2OZMA 1YVUA 4FLZA 5HROA 3AVKA 1GOAA 4FK4A 3KK1A 3DI6A 4PQUA 1X9MA 1KVAA 3PX0A 3RMCA 3RR8A 3H08A 4GW6A 3K5OA 5KTQA 1Q9XA 1SL2A 3LZIA 3PO5A 1X1PA 2ETJA 3S9HA 2DFEA 2OPRA 2G8HA 4DTUA 3ZSWA 2Z1JA 4FK2A 1C0TA 4OJRA 4CJVA 3OYEA 3LWLA 1O1WA 3PUFA 3L2VA 4FJJA 1VSEA 4CEQA 4FZZA 3MECA 3AVAA 3VQ8A 1NJXA 2KZZA 3ITHA 3V4IA 3QNOA 1L3SA 4F3OA 2FBYA 4OGEA 3NGZA 3L2RA 1L3TA 2BDPA 2OZSA 4CHQA 3OYJA 4M3RA 1QE1A 4AHCA 4CJ4A 3ZCMA 4CF1A 3RMDA 3DYAA 4LH4A 3V1OA 1KSPA 2F8SA 4F2RA 4OLAA 1J53A 1B9DA 1TL3A 5JS2A 1RT1A 4BE1A 1QS4A 4N47A 3ZSYA 4B08A 1U45A 3OYCA 3SCXA 4C8LA 3G0ZA 3T3FA 4CJRA 4Z4EA 3V9SA 4CEFA 4FLVA 1JL1A 3KLIA 3P1GA 3VQ7A 3HPHA 4NCGA 4FXDA 4AH9A 1B9FA 4E89A 3NH0A 3RRGA 3LZJA 3NF7A 3QETA 4QAGA 3HP9A 2LSNA 3LAKA 1WAJA 3AO4A 2KQ2A 3C95A 1RBRA 3M8SA 4KKOA 3RR7A 1RBVA 4CGGA 3QEVA 3V6DA 1VSKA 1Y97A 1VRUA 3V9WA 1N6QA 4KI4A 2PY5A 1NK9A 3MXJA 4FW2A 4HUEA 4B9TA 3D45A 5J2PA 2GUIA 3TWHA 4DTNA 1QSYA 4I7FA 1NJYA 3MEDA 3B6OA 3L2WA 5FRNA 3S3OA 4C8OA 4L8RB 2D0BA 1I3AA 3QO9A 1WSFA 4C8MA 4XIUA 4DQIA 3V1RA 3NHGA 1VSHA 2IS3A 3CM6A 3DRSA 3UIQA 1XC9A 3PX6A 3WNHA 1U04A 3HK2A 2D0AA 3A2FA 2E6LA 1G15A 3NCIA 1Z26A 3ZT0A 1U4BA 4KREA 3ZT1A 1FXXA 1KLMA 5KRSA 2GV9A 3OYIA 3SQ4A 1L5UA 4NCAA 4Y1CA 4OKKA 3NGYA 3VQCA 4CFDA 3HP6A 1XI1A 1TK5A 4W5NA 4DSEA 4PA1A 4CFBA 4E7IA 1DTQA 1NKEA 4DU3A 3ZSQA 3KD5E 1Q8IA 1VSJA 2DTUA 1CXQA 1KFDA 3VQ5A 4DLEA 4FJ9A 4DF8A 2JLEA 3KJVA 2ZD1A 3P5JA 4KHSA 2YKNA 2YKMA 3VQPA 2ZE2A 4PWDA 1WSJA 3M8PA 4K8XA 4FJLA 5KGXA 5HLFA 3IG1A 4CHYA 3F73A 1BISA 4B8CA 3OYBA 4EZ9A 1LAWA 1RCHA 4ELTA 4FJ7A 4QCLA 3NFAA 2KFNA 4CEOA 3NF8A 4CCHA 2E6MA 2Y1IA 2EX3A 3E01A 4FJMA 3AVHA 3EZ5A 4FLXA 3D0PA 4BWJA 4CJUA 3VQ4A 4DTOA 5CYMA 4CGJA 4CEBA 1DLOA 1S5JA 1C6VA 1JXBA 4CE9A 3HT3A 3WNFA 4DQSA 3LDSA 4O0JA 4FLTA 3JSMA 3LPTA 1RT4A 1JLBA 2OPPA 2YHBA 3LPUA 2P51A 5CZ2A 4O5BA 5FROA 4W5QA 3THVA 1JLGA 1BI4A 3VQEA 3LANA 4F3TA 4DQQA 5J2QA 3U3YA 1T8EA 3EY1A 4HTUA 3NH2A 4E3SA 3DLEA 3HXMA 4AILC 4DSJA 4CJ3A 2D5RA 1ASWA 3PY8A 2W42A 4EP4A 3LALA 2E4LA 4B8AB 3QEXA 4QOZB 4E7HA 2X6NA 4AHSA 1TAUA 1UAXA 1JLQA 1NK7A 4CGDA 3AVCA 2VG5A 4CF9A 3O3FA 1NK6A 2RN2A 4IKFA 2XO7A 3F9KA 1RILA 2NUBA 3QEWA 3PX4A 4M3XA 3VN5A 1U49A 2KZMA 1MU2A 2I5JA 4M45A 3DRRA 2G8FA 4FZYA 4FJHA 2RPIA 3KD1E 1T03A 2XHBA 1S1VA 4DU1A 1YTAA 1LWEA 4CEEA 3T1AA 3IS9A 4OGCA 3ZSOA 3SPYA 3JYTA 4OLBA 2DY4A 3K5MA 2YNHA 1FK9A 4DTMA 1F21A 1WAFA 1Z25A 1EP4A 2X74A 4OVLA 3VA0A 1X9SA 2HHXA 4F2SA 3SUNA 3S3MA 3PV8A 1L3UA 1BIUA 4YFUA 3VQ9A 1D9DA 5HP1A 1IKXA 1S9EA 4FLUA 2OYQA 1S9GA 3KK2A 3KK3A 1NOZA 1UA1A 4M3YA 4O4GA 2VG6A 1D5AA 4BE0A 5CYQA 4FM1A 2RKIA 4H8KA 1UA0A 4J2EA 1S1XA 2ATQA 3ZSZA 4CK2A 4EP5A 3I0RA 1JLFA 2BE2A 3LAMA 2HB5A 4CFCA 4OKEA 2PYLA 1S1TA 3QIPA 1RDBA 4CF0A 2B4JA 4AHRA 4CFAA 4HUGA 2YV0X 3T19A 3SJJA 3DRPA 4Q5VA 1CZBA 4E0DA 5C25A 1VSIA 2HNDA 3OJSA 3KLHA 2F96A 1J54A 4PUOA 3AV9A 4ID5A 4CJQA 4O0IA 3NDKA 1TAQA 3NE6A 1ZYQA 3NBPA 1K6YA 3MEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHN A;  1HNV A;  3PO4 A;  1KLN A;  3V9X A;  3SQ0 A;  1S6Q A;  5I42 A;  4BDZ A;  3KLF A;  3HST B;  5HRP A;  1BIZ A;  4DS5 A;  1VSL A;  2BGG A;  2IGI A;  4CK3 A;  1HYV A;  3AVB A;  3CFR A;  1R0A A;  1UOC A;  4KI6 A;  4ELV A;  2HNY A;  4CIE A;  3OYD A;  3KIO A;  3BGR A;  1YT3 A;  3OJU A;  4I9Q A;  3QNN A;  1TKX A;  1RTD A;  3KKR A;  2YNG A;  3AA4 A;  3ZSV A;  3EYZ A;  4M3W A;  3VQA A;  1BL3 A;  3HL8 A;  4DS4 A;  1XHX A;  1WN7 A;  1NK8 A;  1ZBH A;  4O55 A;  1NK5 A;  3FFI A;  3LP2 A;  5T7B A;  1UWB A;  4I2P A;  2BAN A;  4ID1 A;  1DTT A;  1WSH A;  3VQ6 A;  3NH1 A;  1EXQ A;  1SL1 A;  4N41 A;  2KFZ A;  3AO1 A;  3O4N A;  1RT3 A;  4CJT A;  4C8K A;  3AO2 A;  1VSM A;  3TAM A;  5SZT A;  4ZTF A;  1QTM A;  4E1M A;  4EZ6 A;  4CGI A;  4N76 A;  4Z4F A;  1BQN A;  4KV8 A;  1VSD A;  1I39 A;  4HCC A;  4HUF A;  4M3Z A;  5D3G A;  4Z4C A;  3CFP A;  4IDK A;  4DFK A;  1ZBI A;  1JXE A;  3AVF A;  3QIN A;  1A5X A;  3ZSX A;  3C94 A;  2ZQB A;  1ASU A;  1J9A A;  3OYL A;  4E7K A;  2XY6 A;  3TAP A;  2YNI A;  4CER A;  1SL0 A;  4DQP A;  1KVB A;  1S6P A;  3DLR A;  4J2B A;  3TAB A;  4RG8 A;  4RW8 A;  3I8D A;  1VK0 A;  1KCF A;  3AVL A;  3K2P A;  4R5P A;  4BDP A;  4NYN A;  3OY9 A;  4FLY A;  4LSL A;  2FBV A;  3OYF A;  2Z1H A;  1TK0 A;  4W5R A;  4JRP A;  4B9S A;  4W5T A;  4E7L A;  3S3N A;  1JKH A;  3WNE A;  3TAG A;  2JGU A;  3L3U A;  3KTQ A;  3ZSR A;  4DG1 A;  1NK0 A;  2HHT A;  4OKJ A;  5E41 A;  1ZBF A;  2HHU A;  1HYS A;  4FW1 A;  4AHU A;  1RTJ A;  2A1S A;  3SV4 A;  3C6T A;  2PYJ A;  1QHT A;  5EU7 A;  4FCY A;  3TI0 A;  2OA8 A;  1TGO A;  1WLJ A;  1WSE A;  3I0S A;  1RT6 A;  4IG0 A;  5J1E A;  1HQE A;  3HVR A;  3C6U A;  1W0H A;  4JLH A;  4FM0 A;  4DQR A;  1TKD A;  4FJN A;  2HHV A;  3O3H A;  4OPK A;  3AA2 A;  1JLC A;  4KO0 A;  3AVN A;  4MFB A;  2XY8 A;  3LP1 A;  2HNZ A;  4KAZ A;  3MAQ A;  2IOC A;  4KHN A;  1D8Y A;  4FYD A;  3QES A;  3OYA A;  1FKP A;  3RMB A;  4CHP A;  2Z1I A;  3OYG A;  1IKY A;  1C1B A;  3M8R A;  3VQB A;  2OPQ A;  3KKS A;  1EET A;  4AHT A;  1QSL A;  4M42 A;  1NKB A;  5FRM A;  1RT7 A;  4BDY A;  3AO5 A;  4Z0U A;  4KPY A;  4WE1 A;  3SUP A;  1HJR A;  3ISN C;  3DLG A;  2AJQ A;  1XWL A;  3OVN A;  1WSG A;  3IRX A;  1LV5 A;  4C8N A;  4CES A;  4ZTJ A;  4RW6 A;  1S1W A;  1BGX T;  1TV6 A;  4G1Q A;  4LD0 A;  4F4K A;  1YTU A;  2HHW A;  3AVG A;  3M8Q A;  4IFV A;  4CJ5 A;  4CJE A;  4CIF A;  2G8I A;  2Y1J A;  1SKW A;  4LSN A;  2YHA A;  5HBM A;  3HPO A;  4DFM A;  5HRN A;  3OYM A;  3LP0 A;  4J2A A;  3K58 A;  3VQQ A;  2YNF A;  4HVJ A;  3K5L A;  4DWI A;  4TSX A;  1NJW A;  3O3G A;  4NYF A;  4CK1 A;  4HCB A;  4DTS A;  1ITG A;  3OYN A;  4CHZ A;  1D9F A;  4CJW A;  1A5V A;  1BHL A;  2IDO A;  2G8V A;  3TAR A;  5KGW A;  1RDC A;  3AA3 A;  3OS2 A;  1RTI A;  2WOM A;  3ZT3 A;  4CJF A;  3V9Z A;  3P83 D;  4NCB A;  4N5S A;  4M41 A;  1CXU A;  3DMJ A;  1NJZ A;  2Q3S A;  4RW9 A;  1BCO A;  1S1U A;  1SKS A;  3G10 A;  4RW4 A;  3HPG A;  4H4O A;  4B9M A;  2GBZ A;  4DLG A;  1JLE A;  1EKE A;  3SI6 A;  2IC3 A;  4KB0 A;  4FZX C;  1NOY A;  1QSS A;  1SKR A;  3TAF A;  3CYM A;  3SUO A;  4CJP A;  4IBN A;  4ZHR A;  1X9W A;  1SV5 A;  4CJK A;  2KTQ A;  1IKW A;  1IG9 A;  4W5O A;  5JS1 A;  4Z4H A;  4Z4G A;  3NF6 A;  4CEZ A;  3OS0 A;  1T05 A;  1RNH A;  4CJS A;  1C1A A;  4HHT A;  1CLQ A;  1RDA A;  4Y1D A;  2QXF A;  1WSI A;  3AVJ A;  4CED A;  3K59 A;  4DSL A;  1IH7 A;  4DF4 A;  1HNI A;  2X6S A;  4AHV A;  1U48 A;  3HJF A;  3B6P A;  4YNQ A;  3SPZ A;  1VSF A;  2DFH A;  2FBT A;  1HMV A;  1CZ9 A;  3OS1 A;  4M3U A;  2A1R A;  4JRQ A;  2RF2 A;  3SZ2 A;  1Q9Y A;  1ZBL A;  3MEG A;  4CIG A;  3TAQ A;  3SUQ A;  1U47 A;  3RTV A;  3WNG A;  5K14 A;  3QEP A;  4ELU A;  3AVM A;  5CY4 A;  1A5W A;  1NK4 A;  1TL1 A;  4N56 A;  3NGI A;  3VA3 A;  4M3T A;  4GMJ B;  3RWU A;  1FKO A;  1SUQ A;  4E1N A;  4IFY A;  3TR8 A;  4KHY A;  1C0M A;  4FJ8 A;  4KB1 A;  2EHG A;  4LH5 A;  4FM2 A;  5KI6 A;  2D0C A;  2QKK A;  1TVR A;  4F8R A;  4KTZ A;  4CEA A;  2HMI A;  4K8Z A;  4FJI A;  3LP3 A;  3QEI A;  3KLE A;  4DFJ A;  1HRH A;  4PY5 A;  4J2D A;  3CG7 A;  2OPS A;  4FK0 A;  4IG3 A;  4CF8 A;  4FVM A;  1KFS A;  2WON A;  1W9H A;  3ALY A;  1XHZ A;  2B5J A;  2Z1G A;  2P5O A;  3BDP A;  1JL2 A;  1HPZ A;  2P1J A;  2XRI A;  5DMR A;  1ZBU A;  4CJL A;  1REV A;  1TKZ A;  3L8B A;  2PZS A;  4B9U A;  1LW2 A;  5J2N A;  3ASM A;  1RT5 A;  4DSK A;  1JLA A;  1ASV A;  3DOL A;  3O4Q A;  4B9L A;  3MXI A;  5I3U A;  2DFF A;  2ITG A;  5SWM A;  4KFB A;  4E7J A;  2G8U A;  2P5G A;  2QKB A;  4CGH A;  3L2U A;  4JS5 A;  3AO3 A;  4KHQ A;  1NKC A;  2O4G A;  3SV3 A;  1T7P A;  3DLH A;  2HW3 A;  5C24 A;  2HVI A;  4UQG A;  4Z4I A;  1LW0 A;  1QQC A;  3AVI A;  4I2Q A;  3LWM A;  4MQ3 A;  3TAE A;  2FBX A;  1GOB A;  3CFO A;  3DLK A;  4B9N A;  4JS4 A;  4B3O A;  3QLH A;  4KTQ A;  4KTW A;  3QER A;  3L2Q A;  3L3V A;  4DTX A;  3HVT A;  1LWF A;  1RBS A;  2XY5 A;  4FJK A;  5J2M A;  4DSF A;  1TKT A;  4CEC A;  4FJG A;  3SYZ A;  2VG7 A;  4FJ5 A;  1RTH A;  3NAE A;  5FDL A;  3KLG A;  3CQ8 A;  1LWC A;  4LY7 A;  4RW7 A;  3MXM A;  1HYZ A;  1IO2 A;  5DK5 A;  3QIO A;  3RRH A;  3SQ2 A;  1GOC A;  4DMN A;  1RDD A;  2FC0 A;  1BCM A;  4I9L A;  1BI4 B;  3DM2 A;  4CHO A;  3RMA A;  1BQM A;  5HRR A;  5HRS A;  5KRT A;  3ZT4 A;  4H4M A;  1KVC A;  1RT2 A;  1B92 A;  1RBT A;  2VWK A;  3AA5 X;  1EX4 A;  2KW4 A;  4O44 A;  2G8K A;  4DTR A;  4CGF A;  4DTP A;  2VWJ A;  3U6F A;  4B9V A;  3OYK A;  1HQU A;  4KHU A;  3SNN A;  4BE2 A;  1RBU A;  5CZ1 A;  3V9U A;  3DLB A;  3V81 A;  2R7Y A;  4ICL A;  3NF9 A;  4DSI A;  4KHW A;  1WNS A;  4KRF A;  2HHQ A;  2B6A A;  4FJX A;  1KTQ A;  4BWM A;  4FLW A;  1LAV A;  2IAJ A;  3HM9 A;  3ULD A;  1N5Y A;  3ZT2 A;  2HHS A;  1VRT A;  3IAY A;  2XY7 A;  2O4I A;  3K5N A;  1KRP A;  4DTJ A;  1C0U A;  1IKV A;  3U3G A;  4DU4 A;  3OYH A;  2G8W A;  2QK9 A;  3SQ1 A;  3V1Q A;  4E19 A;  5C42 A;  4Q0B A;  3TAN A;  1L3V A;  3HYF A;  4CF2 A;  4GVM A;  1C1C A;  3CM5 A;  3HO1 A;  2HVH A;  2F8T A;  1TK8 A;  3K57 A;  4OPJ A;  4BAC A;  3DOK A;  4DFP A;  1J5O A;  3VQD A;  2X78 A;  2OZM A;  1YVU A;  4FLZ A;  5HRO A;  3AVK A;  1GOA A;  4FK4 A;  3KK1 A;  3DI6 A;  4PQU A;  1X9M A;  1KVA A;  3PX0 A;  3RMC A;  3RR8 A;  3H08 A;  4GW6 A;  3K5O A;  5KTQ A;  1Q9X A;  1SL2 A;  3LZI A;  3PO5 A;  1X1P A;  2ETJ A;  3S9H A;  2DFE A;  2OPR A;  2G8H A;  4DTU A;  3ZSW A;  2Z1J A;  4FK2 A;  1C0T A;  4OJR A;  4CJV A;  3OYE A;  3LWL A;  1O1W A;  3PUF A;  3L2V A;  4FJJ A;  1VSE A;  4CEQ A;  4FZZ A;  3MEC A;  3AVA A;  3VQ8 A;  1NJX A;  2KZZ A;  3ITH A;  3V4I A;  3QNO A;  1L3S A;  4F3O A;  2FBY A;  4OGE A;  3NGZ A;  3L2R A;  1L3T A;  2BDP A;  2OZS A;  4CHQ A;  3OYJ A;  4M3R A;  1QE1 A;  4AHC A;  4CJ4 A;  3ZCM A;  4CF1 A;  3RMD A;  3DYA A;  4LH4 A;  3V1O A;  1KSP A;  2F8S A;  4F2R A;  4OLA A;  1J53 A;  1B9D A;  1TL3 A;  5JS2 A;  1RT1 A;  4BE1 A;  1QS4 A;  4N47 A;  3ZSY A;  4B08 A;  1U45 A;  3OYC A;  3SCX A;  4C8L A;  3G0Z A;  3T3F A;  4CJR A;  4Z4E A;  3V9S A;  4CEF A;  4FLV A;  1JL1 A;  3KLI A;  3P1G A;  3VQ7 A;  3HPH A;  4NCG A;  4FXD A;  4AH9 A;  1B9F A;  4E89 A;  3NH0 A;  3RRG A;  3LZJ A;  3NF7 A;  3QET A;  4QAG A;  3HP9 A;  2LSN A;  3LAK A;  1WAJ A;  3AO4 A;  2KQ2 A;  3C95 A;  1RBR A;  3M8S A;  4KKO A;  3RR7 A;  1RBV A;  4CGG A;  3QEV A;  3V6D A;  1VSK A;  1Y97 A;  1VRU A;  3V9W A;  1N6Q A;  4KI4 A;  2PY5 A;  1NK9 A;  3MXJ A;  4FW2 A;  4HUE A;  4B9T A;  3D45 A;  5J2P A;  2GUI A;  3TWH A;  4DTN A;  1QSY A;  4I7F A;  1NJY A;  3MED A;  3B6O A;  3L2W A;  5FRN A;  3S3O A;  4C8O A;  4L8R B;  2D0B A;  1I3A A;  3QO9 A;  1WSF A;  4C8M A;  4XIU A;  4DQI A;  3V1R A;  3NHG A;  1VSH A;  2IS3 A;  3CM6 A;  3DRS A;  3UIQ A;  1XC9 A;  3PX6 A;  3WNH A;  1U04 A;  3HK2 A;  2D0A A;  3A2F A;  2E6L A;  1G15 A;  3NCI A;  1Z26 A;  3ZT0 A;  1U4B A;  4KRE A;  3ZT1 A;  1FXX A;  1KLM A;  5KRS A;  2GV9 A;  3OYI A;  3SQ4 A;  1L5U A;  4NCA A;  4Y1C A;  4OKK A;  3NGY A;  3VQC A;  4CFD A;  3HP6 A;  1XI1 A;  1TK5 A;  4W5N A;  4DSE A;  4PA1 A;  4CFB A;  4E7I A;  1DTQ A;  1NKE A;  4DU3 A;  3ZSQ A;  3KD5 E;  1Q8I A;  1VSJ A;  2DTU A;  1CXQ A;  1KFD A;  3VQ5 A;  4DLE A;  4FJ9 A;  4DF8 A;  2JLE A;  3KJV A;  2ZD1 A;  3P5J A;  4KHS A;  2YKN A;  2YKM A;  3VQP A;  2ZE2 A;  4PWD A;  1WSJ A;  3M8P A;  4K8X A;  4FJL A;  5KGX A;  5HLF A;  3IG1 A;  4CHY A;  3F73 A;  1BIS A;  4B8C A;  3OYB A;  4EZ9 A;  1LAW A;  1RCH A;  4ELT A;  4FJ7 A;  4QCL A;  3NFA A;  2KFN A;  4CEO A;  3NF8 A;  4CCH A;  2E6M A;  2Y1I A;  2EX3 A;  3E01 A;  4FJM A;  3AVH A;  3EZ5 A;  4FLX A;  3D0P A;  4BWJ A;  4CJU A;  3VQ4 A;  4DTO A;  5CYM A;  4CGJ A;  4CEB A;  1DLO A;  1S5J A;  1C6V A;  1JXB A;  4CE9 A;  3HT3 A;  3WNF A;  4DQS A;  3LDS A;  4O0J A;  4FLT A;  3JSM A;  3LPT A;  1RT4 A;  1JLB A;  2OPP A;  2YHB A;  3LPU A;  2P51 A;  5CZ2 A;  4O5B A;  5FRO A;  4W5Q A;  3THV A;  1JLG A;  1BI4 A;  3VQE A;  3LAN A;  4F3T A;  4DQQ A;  5J2Q A;  3U3Y A;  1T8E A;  3EY1 A;  4HTU A;  3NH2 A;  4E3S A;  3DLE A;  3HXM A;  4AIL C;  4DSJ A;  4CJ3 A;  2D5R A;  1ASW A;  3PY8 A;  2W42 A;  4EP4 A;  3LAL A;  2E4L A;  4B8A B;  3QEX A;  4QOZ B;  4E7H A;  2X6N A;  4AHS A;  1TAU A;  1UAX A;  1JLQ A;  1NK7 A;  4CGD A;  3AVC A;  2VG5 A;  4CF9 A;  3O3F A;  1NK6 A;  2RN2 A;  4IKF A;  2XO7 A;  3F9K A;  1RIL A;  2NUB A;  3QEW A;  3PX4 A;  4M3X A;  3VN5 A;  1U49 A;  2KZM A;  1MU2 A;  2I5J A;  4M45 A;  3DRR A;  2G8F A;  4FZY A;  4FJH A;  2RPI A;  3KD1 E;  1T03 A;  2XHB A;  1S1V A;  4DU1 A;  1YTA A;  1LWE A;  4CEE A;  3T1A A;  3IS9 A;  4OGC A;  3ZSO A;  3SPY A;  3JYT A;  4OLB A;  2DY4 A;  3K5M A;  2YNH A;  1FK9 A;  4DTM A;  1F21 A;  1WAF A;  1Z25 A;  1EP4 A;  2X74 A;  4OVL A;  3VA0 A;  1X9S A;  2HHX A;  4F2S A;  3SUN A;  3S3M A;  3PV8 A;  1L3U A;  1BIU A;  4YFU A;  3VQ9 A;  1D9D A;  5HP1 A;  1IKX A;  1S9E A;  4FLU A;  2OYQ A;  1S9G A;  3KK2 A;  3KK3 A;  1NOZ A;  1UA1 A;  4M3Y A;  4O4G A;  2VG6 A;  1D5A A;  4BE0 A;  5CYQ A;  4FM1 A;  2RKI A;  4H8K A;  1UA0 A;  4J2E A;  1S1X A;  2ATQ A;  3ZSZ A;  4CK2 A;  4EP5 A;  3I0R A;  1JLF A;  2BE2 A;  3LAM A;  2HB5 A;  4CFC A;  4OKE A;  2PYL A;  1S1T A;  3QIP A;  1RDB A;  4CF0 A;  2B4J A;  4AHR A;  4CFA A;  4HUG A;  2YV0 X;  3T19 A;  3SJJ A;  3DRP A;  4Q5V A;  1CZB A;  4E0D A;  5C25 A;  1VSI A;  2HND A;  3OJS A;  3KLH A;  2F96 A;  1J54 A;  4PUO A;  3AV9 A;  4ID5 A;  4CJQ A;  4O0I A;  3NDK A;  1TAQ A;  3NE6 A;  1ZYQ A;  3NBP A;  1K6Y A;  3MEE A; 
#chains in the Genus database with same CATH topology
 1HNV A;  4JHD B;  3KLF A;  3HST B;  5ELZ A;  3RVC A;  3AVB A;  4ILG B;  4ELV A;  5KPR A;  3O08 A;  4MO4 A;  1RGI A;  2H3G X;  3MMV A;  1VQ4 N;  4JV5 K;  2YJF A;  1BL3 A;  3QFU A;  1NK8 A;  3GL1 A;  4O55 A;  1IBK K;  2FSJ A;  3FFI A;  1DTT A;  3AO1 A;  2E2Q A;  4C8K A;  5AQN A;  4DR3 K;  3TAM A;  4ZTF A;  4JK8 A;  1BDG A;  4DV2 K;  4V19 S;  1OH6 A;  1XMO K;  4M3Z A;  5D3G A;  5EXW A;  4Z4C A;  4IDK A;  3AVF A;  3QIN A;  2ZQB A;  5GAG P;  1JCE A;  2Q36 A;  3OYL A;  4E7K A;  2XY6 A;  1HR0 K;  1YF5 L;  2QWN A;  4IFE A;  4J2B A;  3CJ1 A;  1VK0 A;  4R5P A;  3OY9 A;  4FLY A;  2FBV A;  4FSV A;  4W5T A;  3VEY A;  3TAG A;  4DQ8 A;  3D6R A;  4M7X A;  1V4S A;  1RTJ A;  2HBJ A;  2O8C B;  1WLJ A;  4UY8 O;  4OLA A;  1RT6 A;  4DU1 A;  4FM0 A;  4JLH A;  1WB9 A;  3O3H A;  3IFR A;  3UKU B;  3LP1 A;  3MAQ A;  2I7N A;  2O8C A;  1FKP A;  3CJ7 A;  3OYG A;  3O8M A;  3I56 N;  2OPQ A;  3KKS A;  3J80 O;  1RT7 A;  4ISG A;  4BRD A;  1WBD A;  4KPY A;  3DJC A;  3SUP A;  1TUY A;  3VES A;  1XWL A;  1WSG A;  3OBY A;  3WXK A;  4C8N A;  4AQY K;  1TV6 A;  1YXQ A;  1QQN A;  4G1Q A;  4F4K A;  4CJ5 A;  4CIF A;  4DV0 K;  3IKM A;  5HBM A;  3OYM A;  4H5R A;  4E1J A;  3PLA A;  3VQQ A;  1IBL K;  3CF5 L;  2W41 A;  4DWI A;  1NJW A;  4CK1 A;  2VYP A;  3CJA A;  4DTS A;  4CHZ A;  3E9L A;  3FLC O;  1BHL A;  1RTI A;  3D7E O;  4LFA K;  4H0T B;  3P83 D;  4JK9 A;  1BCO A;  1S1U A;  2IVN A;  4IJA A;  4JKE A;  4CI6 A;  2P9L B;  4QS7 A;  3JAM O;  1EKE A;  1HKB A;  4KB0 A;  1NOY A;  5E84 A;  4IXC A;  3SJH A;  3CYM A;  2RE2 A;  3OBW A;  1X9W A;  4H0Y B;  4OO1 J;  4LF4 K;  1IKW A;  4Z4G A;  1T05 A;  1RNH A;  3A0I X;  4PHT X;  1C1A A;  5BPL A;  2P9L A;  4CED A;  1IH7 A;  5BRF A;  2X6S A;  3H46 O;  3HJF A;  2FBT A;  3T1H K;  1YJN N;  3O5B A;  1SS6 A;  3W3D A;  3ZET A;  3RTV A;  3WNG A;  5K14 A;  4ELU A;  3AVM A;  3QBW A;  1A5W A;  1TL1 A;  2A41 A;  1QVF M;  3RWU A;  1KD1 O;  2JWK A;  4LH5 A;  4FM2 A;  5KI6 A;  2D0C A;  5E26 A;  4KTZ A;  4I6M B;  2GWJ A;  3LDP A;  4FVM A;  1KFS A;  2WON A;  1W9H A;  3ALY A;  3DLL L;  2P5O A;  4JI0 K;  3BDP A;  4HTL A;  1JL2 A;  2XRI A;  5JLF A;  1ZBU A;  3ASM A;  4I6M A;  2G8U A;  5SWM A;  2P5G A;  3P39 A;  2QKB A;  1T7P A;  4Z4I A;  1QQC A;  3AVI A;  3LWM A;  4DV4 K;  3MN9 A;  3CFO A;  3PSI A;  4KTQ A;  1X9J A;  4FJK A;  2XY5 A;  3THW B;  4FJG A;  3SYZ A;  2VG7 A;  4O8U A;  4FJ5 A;  2RHK A;  5FDL A;  3CQ8 A;  1KAY A;  3JS6 A;  4LFB K;  4DR6 K;  1HYZ A;  1GOC A;  4CHO A;  3VEX A;  1BI4 B;  4FO0 A;  1BQM A;  5HRR A;  1KVC A;  1B92 A;  3DXK A;  1RBT A;  2VWK A;  2G8K A;  4DTP A;  4CGF A;  1J6Z A;  4BE2 A;  2OAN A;  1RBU A;  3OHR A;  5CZ1 A;  3V81 A;  5AQR A;  4FLW A;  4OPA A;  3I55 N;  2HMP A;  2O4I A;  1Q7Y O;  3I33 A;  3K5N A;  2GTD A;  5AQW A;  2W40 A;  3OYH A;  3V1Q A;  1VQK N;  4Q0B A;  3HYF A;  3HO1 A;  2HVH A;  3K57 A;  4BAC A;  3AAR A;  3VEW A;  4FWR A;  2X78 A;  3VQD A;  1M1K O;  3CCR N;  4WQ4 C;  4JKD A;  3AVK A;  5AQP A;  2QI2 A;  3RMC A;  3RR8 A;  3PO5 A;  2DFE A;  3ZSW A;  1S22 A;  4OJR A;  1VSE A;  2V7Y A;  2P9S B;  3AVA A;  3E66 A;  4JKC A;  2Q0R A;  3QNO A;  3CCV N;  5F0X A;  4OGE A;  1GLB G;  1L3T A;  2BDP A;  2OZS A;  1YIT N;  4M3R A;  1ZXO A;  4CJ4 A;  3RMD A;  4JYA K;  4OX9 K;  3P38 A;  3FE1 A;  3ZSY A;  4BRI A;  3V9S A;  3VQ7 A;  5M1F A;  4DUY K;  4E89 A;  5F2R A;  3R6M A;  1XMQ K;  3NF7 A;  5BR9 A;  2O8D B;  3AO4 A;  2KQ2 A;  4FOE A;  4CGG A;  1VSK A;  4FWN A;  1XQS C;  3L2W A;  3S3O A;  1EQY A;  4K41 A;  1WSF A;  4JKH A;  4XIU A;  3NHG A;  4U7B A;  3ATU A;  1DEJ A;  3CM6 A;  1OH7 A;  3PX6 A;  1U04 A;  4RCH A;  4JD2 A;  3HK2 A;  2D0A A;  5FPD A;  1U4B A;  3FZL A;  4CFD A;  5M1N A;  1DTQ A;  1NKE A;  3C0B A;  2DTU A;  1KFD A;  4FJ9 A;  4DLE A;  3VPZ A;  4GV3 A;  3RSE B;  2ZD1 A;  4KHS A;  1CZA N;  2YKN A;  4IOA L;  1WSJ A;  2UYT A;  4B3M K;  3OYB A;  1IG8 A;  1RCH A;  4QCL A;  2Y1I A;  3AVH A;  3EZ5 A;  4IEI A;  4CGJ A;  5KQD A;  1S5J A;  3SAH A;  3WNF A;  4NXN K;  3FR0 A;  4FLT A;  3JSM A;  1JLB A;  2YHB A;  5CZ2 A;  3VF4 A;  5KQ8 A;  3U3Y A;  4AIL C;  2D5R A;  1ASW A;  2CGK A;  1TYQ A;  3MN5 A;  3LAL A;  2E4L A;  4QOZ B;  1ILY A;  1RDW X;  1JLQ A;  4DKW A;  3K9K A;  2RN2 A;  1HKG A;  3M6G A;  3C6A A;  1MU2 A;  4FZY A;  4FJH A;  1BG3 A;  4CBW A;  4KH6 A;  4KH5 A;  1SZ2 A;  3BZC A;  3T1A A;  3IS9 A;  4OLB A;  3J7Y P;  3CER A;  3VA0 A;  3CME N;  1EP4 A;  2X74 A;  3SUN A;  3S3M A;  5EY4 A;  4YFU A;  1C0F A;  1IKX A;  3L4I A;  2OYQ A;  1NGH A;  2BUP A;  4KH4 A;  1NOZ A;  3C7N B;  4BE0 A;  4JKF A;  4IEE A;  4FM1 A;  2RKI A;  4H8K A;  3TTD A;  4CK2 A;  2BE2 A;  2D1K A;  4OKE A;  2I7P A;  5F1X A;  4CFA A;  3QIP A;  1RDB A;  2Q1N A;  4HUG A;  2YV0 X;  1CZB A;  4GKJ K;  2F96 A;  1J54 A;  5C10 A;  3NBP A;  5EVZ A;  1GLA G;  3PO4 A;  1EWR A;  1KLN A;  3V9X A;  3SQ0 A;  3EKU A;  5HRP A;  1BIZ A;  1VSL A;  3T69 A;  2IGI A;  2BGG A;  1R0A A;  1UOC A;  2HF3 A;  3KIO A;  1GLJ O;  3D2F B;  1TKX A;  1RTD A;  3KKR A;  2YNG A;  3AA4 A;  3ZSV A;  3WUH A;  3IUC A;  3HL8 A;  3WEE B;  4DS4 A;  3O4W A;  4RTF D;  2P9U A;  3LP2 A;  3UE5 A;  1K73 O;  1BO5 O;  3NH1 A;  1SL1 A;  1WSH A;  1EXQ A;  1YAG A;  3IMX A;  3D2F A;  4ILJ A;  4EZ6 A;  4E1M A;  3WXL A;  1BQN A;  3D2E B;  1VSD A;  3WEE A;  1I39 A;  1MA9 B;  4DFK A;  1JXE A;  1KAZ A;  1J9A A;  3CXC M;  4DQP A;  1K8K B;  3BZK A;  4LC9 B;  1TK0 A;  5GAH P;  3C65 A;  3D2E A;  4W5R A;  4JRP A;  3DAW A;  1JKH A;  3WNE A;  2NRX A;  3L3U A;  3KTQ A;  1HJO A;  1N32 K;  1HYS A;  4AHU A;  3SV4 A;  1E3M A;  1K8K A;  1QHT A;  5EU7 A;  4FCY A;  2OA8 A;  3QFP A;  5LMN K;  3I0S A;  1WSE A;  2A40 A;  5CE3 A;  1VQM N;  4FJN A;  3C6U A;  2HHV A;  4BGB A;  4NB4 A;  4DR4 K;  1NGB A;  3AA2 A;  1JLC A;  2E88 A;  5GIO A;  2HNZ A;  1T6D A;  5AFU A;  2O8B B;  4FYD A;  3QES A;  3OYA A;  4CHP A;  2Z1I A;  4K43 A;  1V4T A;  1C1B A;  4B1X B;  5FRM A;  1M90 O;  2QXL A;  4WE1 A;  3L6Q A;  3G6E N;  1NGD A;  4CES A;  2GUP A;  1S1W A;  1YTU A;  2VCP A;  2Y1J A;  4BR7 A;  5M1P A;  3KVG A;  4DFM A;  4J2A A;  3K58 A;  2WBN A;  3K5L A;  3TSQ A;  2FXU A;  1ITG A;  4PKG A;  3G4S N;  2IDO A;  2G8V A;  3TAR A;  4MO5 A;  3AA3 A;  3OS2 A;  1VQ7 N;  2WOM A;  3MCP A;  4CJF A;  4M41 A;  4RW4 A;  1OKJ A;  5AQF A;  4YOR A;  3C6H A;  4BQL A;  3O80 A;  4A2A A;  1SKR A;  3TAF A;  2NRH A;  4ZHR A;  1SV5 A;  4CJK A;  4Z4H A;  4CEZ A;  4ISF A;  3ZX0 A;  2HST A;  3AVJ A;  1WSI A;  3BF3 A;  4IJN A;  3J81 O;  3SPZ A;  1BA1 A;  3HI0 A;  4JHD A;  4M3U A;  3VMF B;  4JRQ A;  2RF2 A;  3SZ2 A;  1P90 A;  2P9N B;  1WBB A;  1NK4 A;  1D4X A;  3KHY A;  4M3T A;  4GMJ B;  1SUQ A;  1C0M A;  4H03 B;  5ADX A;  4JAX A;  2QKK A;  4F8R A;  3VOV A;  4CEA A;  4FJI A;  3KLE A;  4DFJ A;  1HRH A;  4IG3 A;  3EL2 A;  1XHZ A;  1LOT B;  2Z1G A;  1ATR A;  1HPZ A;  3CCJ N;  1REV A;  1MDU B;  1RT5 A;  2FF3 B;  4WF9 L;  3DOL A;  4NLB A;  4BRA A;  3MXI A;  2DFF A;  2ITG A;  4E7J A;  2NRR A;  4CGH A;  4JS5 A;  1NKC A;  3DLH A;  2HW3 A;  3O9U A;  4UQG A;  1LW0 A;  4MQ3 A;  4RWT A;  4B9N A;  4B3O A;  4KTW A;  3QER A;  3L2Q A;  2UUA K;  4CZI A;  3T7Z A;  4JI6 K;  4DSF A;  1Q86 O;  4WFN L;  3R9P A;  4A59 A;  3WXJ A;  4LY7 A;  4RW7 A;  2GEL A;  5DK5 A;  3SQ2 A;  3QIO A;  5KPZ A;  1BCM A;  4MDA A;  2QM1 A;  5HRS A;  4H4M A;  1RT2 A;  1Y64 A;  3U9Z A;  3AA5 X;  2VWJ A;  5LY3 A;  3UKU A;  1NWK A;  2NZT A;  4R79 A;  1Q82 O;  3ENB A;  3V9U A;  1N34 K;  3NF9 A;  2ASP A;  4BR5 A;  3HRG A;  3VEV A;  3A5L C;  5AQL A;  1OH5 A;  2GWK A;  2HHS A;  1VRT A;  3IAY A;  2XY7 A;  1IKV A;  4MDB A;  4WQ5 C;  2G8W A;  1Q81 O;  3VEZ A;  4E19 A;  5IWA K;  4B1Y B;  4GVM A;  1TK8 A;  5AQJ A;  4CZG A;  4Y0W A;  4CVN E;  1OH8 A;  4FK4 A;  1YJ9 N;  5JIC A;  1KVA A;  3CCQ N;  4GW6 A;  5KTQ A;  1Q9X A;  4BRG A;  2OPR A;  4BVO A;  4FK2 A;  1N8R O;  3PUF A;  4XH5 A;  2FSK A;  2KZZ A;  3V4I A;  1KQS M;  1WUA A;  1Q18 A;  3WXM B;  1L3S A;  3THY B;  3L2R A;  3L4Q A;  4AHC A;  2F8S A;  4MLH A;  3GG4 A;  4CF1 A;  4DUZ K;  1B9D A;  5JS2 A;  3G0Z A;  3T3F A;  1ATS A;  4CEF A;  4BG8 A;  1JL1 A;  4FLV A;  2PAV A;  3HPH A;  4DV6 K;  4AH9 A;  1B9F A;  3RRG A;  3A5O C;  2Q31 A;  3PSF A;  2LSN A;  3LAK A;  1WAJ A;  2IIR A;  2D0O A;  3M8S A;  2ITM A;  3QEV A;  3V9W A;  3AAP A;  3MXJ A;  3D45 A;  5C2F A;  4DTN A;  1QSY A;  4C8O A;  4QS8 A;  2D0B A;  4BRQ A;  1VQ5 N;  2O8E B;  3MK6 A;  2IS3 A;  3UIQ A;  3WNH A;  2E6L A;  3NCI A;  4LF9 K;  4KRE A;  3ZT1 A;  3BP8 A;  1FW6 A;  1XC3 A;  1XI1 A;  3QDK A;  4DSE A;  3PIP L;  2O8E A;  3Q7C A;  3KD5 E;  3I8B A;  3CMA N;  3ZEU B;  3MN7 A;  3WT0 A;  1GLL O;  2JLE A;  3KJV A;  3N4P A;  2QTD A;  2YKM A;  2ZE2 A;  4PWD A;  1RFQ A;  3M8P A;  5HLF A;  3IG1 A;  3TPQ A;  4EZ9 A;  1LAW A;  4H0P A;  3TU5 A;  2KHO A;  4FOI A;  2E6M A;  1SAZ A;  3E01 A;  1IBM K;  4BRF A;  3F9M A;  4FLX A;  3D0P A;  4BWJ A;  3THW A;  2Q0U A;  2OTL N;  3NVK A;  4CEB A;  5M1Q A;  5DM6 L;  1DGK N;  4BG9 A;  4JK7 A;  2F9T A;  1RT4 A;  3LPU A;  5FRO A;  1BI4 A;  3VQE A;  4F3T A;  3CCM N;  4HTU A;  2ZM6 K;  4E3S A;  3DLE A;  1MWK A;  5DM7 L;  3HXM A;  3SBT A;  4EP4 A;  1QHA A;  4E7H A;  4CGD A;  4IKF A;  4Z94 A;  3F9K A;  2XO7 A;  3QBX A;  4M3X A;  4YY3 K;  2E1Z A;  2I5J A;  3DRR A;  2F4V K;  2RPI A;  3KD1 E;  1T03 A;  1LWE A;  1KAX A;  4CEE A;  4K42 A;  3SPY A;  3ZSO A;  3J7A P;  3K5M A;  4DTM A;  1F21 A;  4IO9 L;  2V7Z A;  1QQO A;  3U9D A;  3PV8 A;  1OVY A;  2YHX A;  4A5B A;  3J8A A;  1UA1 A;  4M3Y A;  4XH4 A;  5CYQ A;  1UA0 A;  4J2E A;  2KKZ A;  3ZSZ A;  5LMU K;  3SAF A;  3EEQ A;  3I0R A;  3CET A;  3LAM A;  3M3Z A;  2HB5 A;  3H3N O;  1S1T A;  2P9I B;  2B4J A;  2YI1 A;  4AM7 A;  3DRP A;  4E0D A;  5C25 A;  1VSI A;  2HND A;  3KLH A;  4ID5 A;  1ZYQ A;  3NE6 A;  2P9S A;  3NDK A;  2ZJR L;  1FJG K;  1K6Y A;  3N4Q A;  1S6Q A;  4BDZ A;  4B3R K;  4CK3 A;  3CFR A;  2P9I A;  4NXM K;  4KI6 A;  3ATV A;  3OYD A;  3BGR A;  3VGK A;  3E1Y A;  4PL7 A;  3OJU A;  4I9Q A;  3QNN A;  2YHY A;  3LDO A;  2ZGZ A;  4M3W A;  3VQA A;  1QQM A;  1XHX A;  1WN7 A;  1ZBH A;  1NK5 A;  2O8D A;  5TKY A;  3HOS A;  4A62 A;  5T7B A;  3AGK A;  4I2P A;  4ID1 A;  4N41 A;  1NM1 A;  3FZF A;  4GVE A;  3BEX A;  1VSM A;  3ZYY X;  1QTM A;  4N76 A;  2GX9 A;  4XH1 A;  4BGA A;  4Z4F A;  4KV8 A;  4BC2 A;  1NLV A;  4HCC A;  4HUF A;  2A5X A;  3CFP A;  1ZBI A;  3ZSX A;  3C94 A;  5AQM A;  3UB5 A;  2YNI A;  1SL0 A;  4AF1 A;  1U2V B;  3DLR A;  3TAB A;  3EE8 A;  3I8D A;  3K2P A;  1E4G T;  2NLX A;  4BDP A;  3NMU A;  4LSL A;  3GE1 A;  2Z1H A;  3CHW A;  3ZSR A;  4DG1 A;  5FLX O;  4OKJ A;  5AZI B;  4B1Z A;  1ZBF A;  3O1B A;  4FW1 A;  2A1S A;  3C6T A;  2PYJ A;  3M1F A;  3RSE A;  3TI0 A;  1W97 L;  1TGO A;  5J1E A;  1HQE A;  1TKD A;  2FSN A;  3SLC A;  2XY8 A;  2CGJ A;  2IOC A;  4KHN A;  3H6E A;  1D8Y A;  3A5M C;  3CPE A;  3RMB A;  3VQB A;  1EET A;  4AHT A;  3DWL A;  4M42 A;  4JI2 K;  3EE9 A;  4FPA A;  5BRE A;  1GLC G;  3AO5 A;  4YOW A;  3CQY A;  4YDU C;  5AJ3 K;  4LF6 K;  2E2N A;  5AZJ B;  3DLG A;  3IRX A;  1LV5 A;  1YUW A;  4RW6 A;  1BGX T;  4LD0 A;  2HHW A;  3AVG A;  3M8Q A;  5KPT A;  5AQZ A;  4YOV A;  3HBT A;  2Q2R A;  3HPO A;  5HRN A;  3J7Z O;  4H0X B;  4ILH A;  1S72 N;  4PKI A;  3B8A X;  5AZJ A;  5M1K A;  3CQX A;  4TSX A;  4LFC K;  3O3G A;  4NYF A;  2HBK A;  3OW2 M;  5C12 A;  3OYN A;  1D9F A;  5LJV A;  4CJW A;  2UXC K;  4BVP A;  5KGW A;  3P4I A;  1RDC A;  3EZW A;  4NCB A;  4N5S A;  1NJZ A;  4WQ4 A;  4RW9 A;  2WUS A;  1SKS A;  3CC2 N;  3HPG A;  4B9M A;  4EHT A;  3ID6 A;  3MWT A;  1JLE A;  3C7N A;  3SI6 A;  2IC3 A;  3KZB A;  4FZX C;  3E9P A;  4CJP A;  4M63 C;  3OA9 A;  1IG9 A;  3NF6 A;  4L3Q A;  3CCS N;  4CJS A;  1RDA A;  3SMP A;  4Y1D A;  5AR0 A;  3K59 A;  4DF4 A;  1HNI A;  4AHV A;  2HBM A;  1VSF A;  1HMV A;  5LJW A;  1CZ9 A;  1JJ2 M;  2A1R A;  3TAQ A;  4CIG A;  2CH6 A;  1U47 A;  2EWS A;  3VF6 A;  4DV1 K;  3NGI A;  3VA3 A;  1FKO A;  4E1N A;  4IFY A;  4H0V B;  4FJ8 A;  2W6L A;  4BRL A;  4PL8 A;  4A5A A;  2BH1 A;  2YJE A;  4IOC L;  2HMI A;  4K8Z A;  3LP3 A;  4PY5 A;  4J2D A;  1ZC6 A;  2OPS A;  1VQO N;  4GV6 A;  2ZGY A;  2B5J A;  1TKZ A;  3L8B A;  1LW2 A;  5J2N A;  1JLA A;  2NRT A;  4KFB A;  5M1O A;  3L2U A;  2VWB A;  4BRC A;  3WQU A;  2O4G A;  3SV3 A;  3EKS A;  2HVI A;  3BUZ B;  4I2Q A;  3TAE A;  2FBX A;  2VGN A;  1GOB A;  3CJ9 A;  2UXB K;  4YOT A;  2CGL A;  4DTX A;  4FVU A;  1LWF A;  1RBS A;  4BC5 A;  5J2M A;  3DXM B;  4CEC A;  4CBU A;  1QVG M;  1RTH A;  3NAE A;  2NRV A;  3MXM A;  3R1X A;  1T3V A;  2P9P B;  1VQ8 N;  4DMN A;  1RDD A;  2FC0 A;  4IWV A;  3ZT4 A;  5IT9 O;  1NNE A;  4JKB A;  4A61 A;  4A57 A;  1EX4 A;  4DTR A;  5B8H A;  3U6F A;  1MWM A;  3OYK A;  1HQU A;  4KHU A;  3SNN A;  2O8B A;  1VHX A;  3DLB A;  1NGI A;  4KHW A;  4ICL A;  1WNS A;  1NGG A;  3KWI A;  2B6A A;  4CW7 B;  2HHQ A;  2HF4 A;  3VGM A;  4FJX A;  3TTF A;  1KTQ A;  4EHU A;  2IAJ A;  1N5Y A;  3ZT2 A;  2E2O A;  3L0Q A;  4ISE A;  3ENO A;  4DU4 A;  4BR9 A;  2IVO A;  3AGR A;  5C42 A;  3SMS A;  1C1C A;  4OPJ A;  1J5O A;  5HRO A;  3MDQ A;  3KK1 A;  4PQU A;  1X9M A;  3PX0 A;  3EO3 A;  1W7A A;  3H08 A;  3K5O A;  1X1P A;  2ETJ A;  2Z1J A;  4FJJ A;  3LWL A;  1O1W A;  3L2V A;  4CEQ A;  2ASO A;  3VF2 A;  3MEC A;  3VQ8 A;  1NJX A;  3K9J A;  3NGZ A;  4BC3 A;  4CHQ A;  2A3Z A;  1QE1 A;  5I9E B;  3ZCM A;  3DYA A;  3V1O A;  1KSP A;  3JXU A;  4BE1 A;  3O9T A;  4N47 A;  1U45 A;  3OYC A;  2E20 A;  4BRK A;  4CJR A;  4BRN A;  2UUC K;  4Z4E A;  3P1G A;  3KLI A;  1X3M A;  4NCG A;  3SBG A;  3NH0 A;  3FZH A;  1QZ5 A;  3NVM A;  3LZJ A;  3QET A;  4BRO A;  3HP9 A;  1T6C A;  3VEN A;  3VGL A;  1RBR A;  4KKO A;  1RBV A;  1NG9 A;  3V6D A;  4KI4 A;  1Y97 A;  1VRU A;  3P31 A;  1N6Q A;  1NK9 A;  4CD1 A;  1HUX A;  2GUI A;  5J2P A;  4I7F A;  1NJY A;  3MED A;  4IDH A;  5FRN A;  1I3A A;  4BY9 C;  2P9N A;  3FGU A;  4DQI A;  3V1R A;  1VSH A;  1XC9 A;  3Q7B A;  3VTI A;  3A2F A;  1Z26 A;  3CC7 N;  5KRS A;  5LL6 Z;  5EX5 A;  3SQ4 A;  2GV9 A;  5AQT A;  5MLC Q;  3OYI A;  2NRW A;  4Y1C A;  3HP6 A;  3VQC A;  4H5N A;  2HHH K;  2AA4 A;  5AQX A;  4CFB A;  4E7I A;  1Q8I A;  3VQ5 A;  3UKR B;  4DF8 A;  3VQP A;  4BRH A;  2V51 B;  5KGX A;  4FJL A;  4DR5 K;  3MWP A;  3F73 A;  3VTH A;  4IO8 A;  1LCU A;  2YHW A;  3NFA A;  1OVQ A;  4CEO A;  4CZE A;  3UKR A;  4CCH A;  3TSU A;  1ATN A;  1ZBS A;  3ZX3 A;  4FJM A;  5H1S Q;  2O8F B;  3VQ4 A;  1NJI O;  5CYM A;  5BR8 K;  4U67 L;  1DLO A;  1C6V A;  5AQO A;  3LDS A;  4O0J A;  4A2B A;  1BOT O;  3LDQ A;  2OPP A;  4O5B A;  2QWP A;  1JLG A;  2A6A A;  3LAN A;  4DQQ A;  1T8E A;  3EY1 A;  4DSJ A;  4CJ3 A;  3PY8 A;  2O8F A;  2W42 A;  1YVN A;  3QEX A;  4B8A B;  2X6N A;  1TAU A;  1UAX A;  1SQK A;  2BTF A;  1NK7 A;  3AVC A;  1VQL N;  3VER A;  1RIL A;  3HM8 A;  4WFB L;  5AFU H;  4M45 A;  2G8F A;  4JI7 K;  3O9R A;  3R8E A;  5AQQ A;  5GIP A;  3E9O A;  1YTA A;  1ESV A;  1GLE G;  3JYT A;  2DY4 A;  2YCH A;  5GAE P;  1FK9 A;  3HSC A;  4C1N I;  1WAF A;  1Z25 A;  1G99 A;  2HHX A;  4DR7 K;  4F2S A;  1R59 O;  1L3U A;  4FWO A;  4CZL A;  3VQ9 A;  1D9D A;  1BWF O;  4LF5 K;  1S9G A;  3KK3 A;  1O13 A;  4KBO A;  4O4G A;  2VG6 A;  1D5A A;  5JMV A;  4FPB A;  4LF7 K;  4X65 K;  3G25 A;  1P8Z A;  3H1V X;  4BR4 A;  3LM9 A;  5AQG A;  4CF0 A;  4H0O A;  3SJJ A;  4Q5V A;  1S3X A;  3OJS A;  4PUO A;  1C0G A;  3KK7 A;  4EFH A;  2QEX N;  4CHN A;  5I42 A;  3THY A;  4DS5 A;  2E1Y A;  3F2K A;  3ZET B;  1HYV A;  4JEP A;  2HNY A;  4CIE A;  1HLU A;  1YT3 A;  3TSP A;  5CHI A;  4FWM A;  3EYZ A;  4H5T A;  3LL3 A;  2FF6 A;  1EO1 A;  5AQU A;  4BRP A;  5FPN A;  1XNQ K;  1HNW K;  4YOY A;  4BC4 A;  2VGM A;  1K9M O;  4K25 A;  1UWB A;  3VQ6 A;  2BAN A;  1YJW N;  2QW9 A;  4WYB A;  3THX B;  2KFZ A;  5AQS A;  3O4N A;  1RT3 A;  4CJT A;  3CC4 N;  3AO2 A;  3O9Q A;  5SZT A;  1NGC A;  4CGI A;  3AY9 A;  1GLD G;  3ENH A;  2V52 B;  3M5R A;  4CZF A;  1A5X A;  1H1V A;  3QB0 A;  4DR2 K;  1ASU A;  3TAP A;  1KC8 O;  3CI5 A;  4CER A;  1I94 K;  3THX A;  1KVB A;  1S6P A;  5ADX H;  4RG8 A;  4RW8 A;  5FPM A;  5BPN A;  1KCF A;  3U8X A;  3AVL A;  4NYN A;  1BUP A;  1GLF O;  3OYF A;  4B9S A;  4HWI A;  3AAQ A;  4E7L A;  4JKG B;  3S3N A;  2JGU A;  5HOO A;  1NK0 A;  2HHT A;  5E41 A;  1XUP O;  2HHU A;  3ZEU A;  4CZJ A;  4BQZ A;  2IVP A;  3ID8 A;  1RDU A;  4DTU A;  4IG0 A;  3HVR A;  4DQR A;  1W0H A;  3DXK B;  4DV5 K;  4JKG A;  3ZX2 A;  3FZM A;  2PBD A;  2WFB A;  3BF1 A;  4OPK A;  5FPE A;  4DR1 K;  4KO0 A;  3AVN A;  4MFB A;  2QWL A;  4KAZ A;  4B1U B;  2JWL A;  2A42 A;  3MN6 A;  4B9Q A;  4K0K K;  1IKY A;  3MX2 A;  3M8R A;  3O9S A;  2E8A A;  1QSL A;  1NMD A;  1NKB A;  1YI2 N;  2FLO A;  4BDY A;  4WCE L;  4Z0U A;  3LM2 A;  1HJR A;  3ISN C;  2AJQ A;  1JCG A;  3OVN A;  3A5N C;  3S41 A;  4ZTJ A;  3TTC A;  2G8I A;  4IFV A;  3KWG A;  4FWQ A;  4CJE A;  2ZJQ L;  1SKW A;  4LSN A;  2YHA A;  4G9Z A;  1DKG D;  3LP0 A;  3WQT A;  1IV0 A;  2YNF A;  4HVJ A;  1TUU A;  4WQ5 A;  4HCB A;  1BA0 A;  1A5V A;  2OTJ N;  3ZT3 A;  3V9Z A;  2F7T A;  3ZLJ A;  1CXU A;  3DMJ A;  4FWK A;  4IZ9 A;  2Q3S A;  4JI8 K;  1XNR K;  3G10 A;  4H4O A;  2GBZ A;  1HKC A;  4JKA A;  4DLG A;  1QSS A;  2QWM A;  3SUO A;  4CBX A;  3FFK B;  4IBN A;  2KTQ A;  5JS1 A;  4JI5 K;  4W5O A;  4C1N K;  3W0L A;  3LDL A;  4EIA A;  3OS0 A;  4HHT A;  3O1W A;  3CJB A;  1CLQ A;  5HL7 L;  1VQ9 N;  2QXF A;  4DB3 A;  4DSL A;  3CCE N;  1U48 A;  3T1Y K;  3B6P A;  4YNQ A;  2DFH A;  3GBT A;  4X66 K;  4JI3 K;  3OS1 A;  4MLE A;  5AQY A;  1Q9Y A;  1ZBL A;  3MEG A;  3OTO K;  4O8K A;  3SUQ A;  3QEP A;  5CY4 A;  1YHQ N;  1N33 K;  4DCH A;  4N56 A;  3TR8 A;  4KHY A;  2EHG A;  3FZK A;  4JD2 B;  2CH5 A;  1TVR A;  1Z6R A;  3H1Q A;  3QEI A;  3CG7 A;  4FK0 A;  2Q97 A;  4CF8 A;  1BU6 O;  4PKH A;  4OPH A;  4CJL A;  2P1J A;  5DMR A;  2PZS A;  4B9U A;  5BN9 A;  4DSK A;  5GAD P;  1ASV A;  1J5E K;  3O4Q A;  4B9L A;  3VEO A;  5I3U A;  4YHH K;  3CCU N;  4JNE A;  3AO3 A;  4KHQ A;  5C24 A;  2DPN A;  1NGE A;  3QIC A;  1U2V A;  3DLK A;  4JS4 A;  3QLH A;  2WC9 A;  4KHP K;  3L3V A;  5C2D A;  3HVT A;  4LF8 K;  4M7Y A;  1TKT A;  3K0S A;  4EAH D;  4H5W A;  2ZJP L;  5AZI A;  3KLG A;  1LWC A;  2ASM A;  3RRH A;  1IO2 A;  4CZH A;  4J8F A;  4I9L A;  3DM2 A;  3RMA A;  2QWQ A;  1VAZ A;  4BR2 A;  1JCF A;  5KRT A;  4CZK A;  4O44 A;  2KW4 A;  1TYQ B;  3HOT A;  5JVG L;  4B9V A;  5BRH A;  3GDQ A;  5TKW A;  1EWQ A;  2F9W A;  2R7Y A;  4DSI A;  5C15 A;  1VQP N;  4KRF A;  4DV3 K;  2HOE A;  5C0Y A;  4BWM A;  1LAV A;  2AP1 A;  3HM9 A;  3ULD A;  3GOI A;  2QWR A;  4JI4 K;  1KRP A;  2D0P A;  1C0U A;  4QS9 A;  3U3G A;  4DTJ A;  5GIN A;  1HX1 A;  5BRD A;  2QK9 A;  3SQ1 A;  1VQ6 N;  3TAN A;  1VQN N;  1L3V A;  4CF2 A;  3CM5 A;  3MX5 A;  3WXI A;  2F8T A;  3DOK A;  4DFP A;  4YOX A;  3LDN A;  2OZM A;  1YVU A;  4FLZ A;  1NMN A;  4X62 K;  1GOA A;  1DT9 A;  2PFU A;  3DI6 A;  1HNZ K;  1W2B M;  4JI1 K;  1SL2 A;  3LZI A;  3S9H A;  4F9O A;  1NGF A;  3HTV A;  2G8H A;  5AQH A;  1C0T A;  4CJV A;  3OYE A;  4FZZ A;  2NNW A;  3IDH A;  3G71 N;  1Z05 A;  3ITH A;  4CJ7 A;  2E5L K;  4F3O A;  2FBY A;  1WOQ A;  3CJC A;  2WTU A;  3OYJ A;  1IJJ A;  1T44 A;  2W6K A;  4LH4 A;  3ULE B;  4AM6 A;  4F2R A;  1J53 A;  1TL3 A;  1RT1 A;  1QS4 A;  4B08 A;  2VQE K;  5JLH A;  4C8L A;  3SCX A;  2QA4 N;  3U4L A;  3SK3 A;  4FXD A;  3CPW M;  4QAG A;  4JN4 A;  2P9U B;  3ULE A;  3F5T A;  3C95 A;  4WFA L;  2HBL A;  3RR7 A;  4B3T K;  4KB1 A;  3HZ6 A;  3EN9 A;  2PY5 A;  4B9T A;  4FW2 A;  4HUE A;  2GEM A;  3TWH A;  3CCL N;  4GV9 A;  3B6O A;  4L8R B;  3QO9 A;  4C8M A;  4B1V A;  4FWP A;  3DRS A;  2ZWH A;  1G15 A;  3ZT0 A;  4H5V A;  4NCA A;  1FXX A;  1KLM A;  4GNI A;  1L5U A;  4OKK A;  3NGY A;  1TK5 A;  4IOX A;  4W5N A;  4PA1 A;  4GY2 B;  2E2P A;  4DU3 A;  3ZSQ A;  1VSJ A;  1CXQ A;  1X3N A;  2P9K B;  1KXP A;  2UUB K;  3SAG A;  4O5F A;  3P5J A;  3A8Y A;  4K8X A;  2VQF K;  2OCE A;  5AQK A;  4CHY A;  1BIS A;  4B8C A;  4FWS A;  3QML A;  2YX6 A;  4ELT A;  3H45 C;  1K8A O;  2UU9 K;  4FJ7 A;  2KFN A;  3NF8 A;  2ZF5 O;  2P9K A;  2EX3 A;  3MCA B;  4CJU A;  3DXM A;  4DTO A;  1E4F T;  1JXB A;  3H3O B;  4CE9 A;  3HT3 A;  4DQS A;  4B1W B;  5AQV A;  3LPT A;  2P9P A;  2UXD K;  2P51 A;  4W5Q A;  3THV A;  4B3S K;  5J2Q A;  4C23 A;  1U6Z A;  3NH2 A;  2D4W A;  4BRM A;  5BPM A;  4BRE A;  1NU0 A;  4AHS A;  2KLA A;  4CF9 A;  2VG5 A;  3O3F A;  1NK6 A;  1NBW A;  4GKK K;  2NUB A;  3QEW A;  4NLC A;  3PX4 A;  2QWO A;  4YDU A;  3VN5 A;  4DHY A;  1U49 A;  2KZM A;  1N36 K;  5CR4 A;  3BY5 A;  4CZM A;  2XHB A;  1S1V A;  4OGC A;  2YNH A;  4OVL A;  1X9S A;  4NO7 A;  3R3L A;  5BN8 A;  1BIU A;  5HP1 A;  1S9E A;  4FLU A;  3KK2 A;  5AQI A;  4YOU A;  1NGJ A;  1S1X A;  2ATQ A;  4EP5 A;  1HNX K;  1JLF A;  2NRZ A;  4FL9 A;  1YIJ N;  2J4R A;  4CFC A;  3VET A;  2PYL A;  1NGA A;  4DV7 K;  4AHR A;  4BR0 A;  4X64 K;  4XEI A;  3T19 A;  4FWL A;  3PIO L;  3O6W A;  3CIP A;  4CD3 A;  1HPM A;  1QZ6 A;  3AV9 A;  4CJQ A;  5A2Q O;  4O0I A;  1TAQ A;  5JVH L;  5EOY A;  3MEE A;  3CD6 N; 
#chains in the Genus database with same CATH homology
 4CHN A;  1HNV A;  3PO4 A;  1KLN A;  3V9X A;  3SQ0 A;  1S6Q A;  5I42 A;  4BDZ A;  3KLF A;  3HST B;  5HRP A;  1BIZ A;  4DS5 A;  1VSL A;  2BGG A;  2IGI A;  4CK3 A;  1HYV A;  3AVB A;  3CFR A;  1R0A A;  1UOC A;  4KI6 A;  4ELV A;  2HNY A;  4CIE A;  3OYD A;  3KIO A;  3BGR A;  1YT3 A;  3OJU A;  4I9Q A;  3QNN A;  1TKX A;  1RTD A;  3KKR A;  2YNG A;  3AA4 A;  3ZSV A;  3EYZ A;  4M3W A;  3VQA A;  1BL3 A;  3HL8 A;  4DS4 A;  1XHX A;  1WN7 A;  1NK8 A;  1ZBH A;  4O55 A;  1NK5 A;  3FFI A;  3LP2 A;  5T7B A;  1UWB A;  4I2P A;  2BAN A;  4ID1 A;  1DTT A;  1WSH A;  3VQ6 A;  3NH1 A;  1EXQ A;  1SL1 A;  4N41 A;  2KFZ A;  3AO1 A;  3O4N A;  1RT3 A;  4CJT A;  4C8K A;  3AO2 A;  1VSM A;  3TAM A;  5SZT A;  4ZTF A;  1QTM A;  4E1M A;  4EZ6 A;  4CGI A;  4N76 A;  4Z4F A;  1BQN A;  4KV8 A;  1VSD A;  1I39 A;  4HCC A;  4HUF A;  4M3Z A;  5D3G A;  4Z4C A;  3CFP A;  4IDK A;  4DFK A;  1ZBI A;  1JXE A;  3AVF A;  3QIN A;  1A5X A;  3ZSX A;  3C94 A;  2ZQB A;  1ASU A;  1J9A A;  3OYL A;  4E7K A;  2XY6 A;  3TAP A;  2YNI A;  4CER A;  1SL0 A;  4DQP A;  1KVB A;  1S6P A;  3DLR A;  4J2B A;  3TAB A;  4RG8 A;  4RW8 A;  3I8D A;  1VK0 A;  1KCF A;  3AVL A;  3K2P A;  4R5P A;  4BDP A;  4NYN A;  3OY9 A;  4FLY A;  4LSL A;  2FBV A;  3OYF A;  2Z1H A;  1TK0 A;  4W5R A;  4JRP A;  4B9S A;  4W5T A;  4E7L A;  3S3N A;  1JKH A;  3WNE A;  3TAG A;  2JGU A;  3L3U A;  3KTQ A;  3ZSR A;  4DG1 A;  1NK0 A;  2HHT A;  4OKJ A;  5E41 A;  1ZBF A;  2HHU A;  1HYS A;  4FW1 A;  4AHU A;  1RTJ A;  2A1S A;  3SV4 A;  3C6T A;  2PYJ A;  1QHT A;  5EU7 A;  4FCY A;  3TI0 A;  2OA8 A;  1TGO A;  1WLJ A;  1WSE A;  3I0S A;  1RT6 A;  4IG0 A;  5J1E A;  1HQE A;  3HVR A;  3C6U A;  1W0H A;  4JLH A;  4FM0 A;  4DQR A;  1TKD A;  4FJN A;  2HHV A;  3O3H A;  4OPK A;  3AA2 A;  1JLC A;  4KO0 A;  3AVN A;  4MFB A;  2XY8 A;  3LP1 A;  2HNZ A;  4KAZ A;  3MAQ A;  2IOC A;  4KHN A;  1D8Y A;  4FYD A;  3QES A;  3OYA A;  1FKP A;  3RMB A;  4CHP A;  2Z1I A;  3OYG A;  1IKY A;  1C1B A;  3M8R A;  3VQB A;  2OPQ A;  3KKS A;  1EET A;  4AHT A;  1QSL A;  4M42 A;  1NKB A;  5FRM A;  1RT7 A;  4BDY A;  3AO5 A;  4Z0U A;  4KPY A;  4WE1 A;  3SUP A;  1HJR A;  3ISN C;  3DLG A;  2AJQ A;  1XWL A;  3OVN A;  1WSG A;  3IRX A;  1LV5 A;  4C8N A;  4CES A;  4ZTJ A;  4RW6 A;  1S1W A;  1BGX T;  1TV6 A;  4G1Q A;  4LD0 A;  4F4K A;  1YTU A;  2HHW A;  3AVG A;  3M8Q A;  4IFV A;  4CJ5 A;  4CJE A;  4CIF A;  2G8I A;  2Y1J A;  1SKW A;  4LSN A;  2YHA A;  5HBM A;  3HPO A;  4DFM A;  5HRN A;  3OYM A;  3LP0 A;  4J2A A;  3K58 A;  3VQQ A;  2YNF A;  4HVJ A;  3K5L A;  4DWI A;  4TSX A;  1NJW A;  3O3G A;  4NYF A;  4CK1 A;  4HCB A;  4DTS A;  1ITG A;  3OYN A;  4CHZ A;  1D9F A;  4CJW A;  1A5V A;  1BHL A;  2IDO A;  2G8V A;  3TAR A;  5KGW A;  1RDC A;  3AA3 A;  3OS2 A;  1RTI A;  2WOM A;  3ZT3 A;  4CJF A;  3V9Z A;  3P83 D;  4NCB A;  4N5S A;  4M41 A;  1CXU A;  3DMJ A;  1NJZ A;  2Q3S A;  4RW9 A;  1BCO A;  1S1U A;  1SKS A;  3G10 A;  4RW4 A;  3HPG A;  4H4O A;  4B9M A;  2GBZ A;  4DLG A;  1JLE A;  1EKE A;  3SI6 A;  2IC3 A;  4KB0 A;  4FZX C;  1NOY A;  1QSS A;  1SKR A;  3TAF A;  3CYM A;  3SUO A;  4CJP A;  4IBN A;  4ZHR A;  1X9W A;  1SV5 A;  4CJK A;  2KTQ A;  1IKW A;  1IG9 A;  4W5O A;  5JS1 A;  4Z4H A;  4Z4G A;  3NF6 A;  4CEZ A;  3OS0 A;  1T05 A;  1RNH A;  4CJS A;  1C1A A;  4HHT A;  1CLQ A;  1RDA A;  4Y1D A;  2QXF A;  1WSI A;  3AVJ A;  4CED A;  3K59 A;  4DSL A;  1IH7 A;  4DF4 A;  1HNI A;  2X6S A;  4AHV A;  1U48 A;  3HJF A;  3B6P A;  4YNQ A;  3SPZ A;  1VSF A;  2DFH A;  2FBT A;  1HMV A;  1CZ9 A;  3OS1 A;  4M3U A;  2A1R A;  4JRQ A;  2RF2 A;  3SZ2 A;  1Q9Y A;  1ZBL A;  3MEG A;  4CIG A;  3TAQ A;  3SUQ A;  1U47 A;  3RTV A;  3WNG A;  5K14 A;  3QEP A;  4ELU A;  3AVM A;  5CY4 A;  1A5W A;  1NK4 A;  1TL1 A;  4N56 A;  3NGI A;  3VA3 A;  4M3T A;  4GMJ B;  3RWU A;  1FKO A;  1SUQ A;  4E1N A;  4IFY A;  3TR8 A;  4KHY A;  1C0M A;  4FJ8 A;  4KB1 A;  2EHG A;  4LH5 A;  4FM2 A;  5KI6 A;  2D0C A;  2QKK A;  1TVR A;  4F8R A;  4KTZ A;  4CEA A;  2HMI A;  4K8Z A;  4FJI A;  3LP3 A;  3QEI A;  3KLE A;  4DFJ A;  1HRH A;  4PY5 A;  4J2D A;  3CG7 A;  2OPS A;  4FK0 A;  4IG3 A;  4CF8 A;  4FVM A;  1KFS A;  2WON A;  1W9H A;  3ALY A;  1XHZ A;  2B5J A;  2Z1G A;  2P5O A;  3BDP A;  1JL2 A;  1HPZ A;  2P1J A;  2XRI A;  5DMR A;  1ZBU A;  4CJL A;  1REV A;  1TKZ A;  3L8B A;  2PZS A;  4B9U A;  1LW2 A;  5J2N A;  3ASM A;  1RT5 A;  4DSK A;  1JLA A;  1ASV A;  3DOL A;  3O4Q A;  4B9L A;  3MXI A;  5I3U A;  2DFF A;  2ITG A;  5SWM A;  4KFB A;  4E7J A;  2G8U A;  2P5G A;  2QKB A;  4CGH A;  3L2U A;  4JS5 A;  3AO3 A;  4KHQ A;  1NKC A;  2O4G A;  3SV3 A;  1T7P A;  3DLH A;  2HW3 A;  5C24 A;  2HVI A;  4UQG A;  4Z4I A;  1LW0 A;  1QQC A;  3AVI A;  4I2Q A;  3LWM A;  4MQ3 A;  3TAE A;  2FBX A;  1GOB A;  3CFO A;  3DLK A;  4B9N A;  4JS4 A;  4B3O A;  3QLH A;  4KTQ A;  4KTW A;  3QER A;  3L2Q A;  3L3V A;  4DTX A;  3HVT A;  1LWF A;  1RBS A;  2XY5 A;  4FJK A;  5J2M A;  4DSF A;  1TKT A;  4CEC A;  4FJG A;  3SYZ A;  2VG7 A;  4FJ5 A;  1RTH A;  3NAE A;  5FDL A;  3KLG A;  3CQ8 A;  1LWC A;  4LY7 A;  4RW7 A;  3MXM A;  1HYZ A;  1IO2 A;  5DK5 A;  3QIO A;  3RRH A;  3SQ2 A;  1GOC A;  4DMN A;  1RDD A;  2FC0 A;  1BCM A;  4I9L A;  1BI4 B;  3DM2 A;  4CHO A;  3RMA A;  1BQM A;  5HRR A;  5HRS A;  5KRT A;  3ZT4 A;  4H4M A;  1KVC A;  1RT2 A;  1B92 A;  1RBT A;  2VWK A;  3AA5 X;  1EX4 A;  2KW4 A;  4O44 A;  2G8K A;  4DTR A;  4CGF A;  4DTP A;  2VWJ A;  3U6F A;  4B9V A;  3OYK A;  1HQU A;  4KHU A;  3SNN A;  4BE2 A;  1RBU A;  5CZ1 A;  3V9U A;  3DLB A;  3V81 A;  2R7Y A;  4ICL A;  3NF9 A;  4DSI A;  4KHW A;  1WNS A;  4KRF A;  2HHQ A;  2B6A A;  4FJX A;  1KTQ A;  4BWM A;  4FLW A;  1LAV A;  2IAJ A;  3HM9 A;  3ULD A;  1N5Y A;  3ZT2 A;  2HHS A;  1VRT A;  3IAY A;  2XY7 A;  2O4I A;  3K5N A;  1KRP A;  4DTJ A;  1C0U A;  1IKV A;  3U3G A;  4DU4 A;  3OYH A;  2G8W A;  2QK9 A;  3SQ1 A;  3V1Q A;  4E19 A;  5C42 A;  4Q0B A;  3TAN A;  1L3V A;  3HYF A;  4CF2 A;  4GVM A;  1C1C A;  3CM5 A;  3HO1 A;  2HVH A;  2F8T A;  1TK8 A;  3K57 A;  4OPJ A;  4BAC A;  3DOK A;  4DFP A;  1J5O A;  3VQD A;  2X78 A;  2OZM A;  1YVU A;  4FLZ A;  5HRO A;  3AVK A;  1GOA A;  4FK4 A;  3KK1 A;  3DI6 A;  4PQU A;  1X9M A;  1KVA A;  3PX0 A;  3RMC A;  3RR8 A;  3H08 A;  4GW6 A;  3K5O A;  5KTQ A;  1Q9X A;  1SL2 A;  3LZI A;  3PO5 A;  1X1P A;  2ETJ A;  3S9H A;  2DFE A;  2OPR A;  2G8H A;  4DTU A;  3ZSW A;  2Z1J A;  4FK2 A;  1C0T A;  4OJR A;  4CJV A;  3OYE A;  3LWL A;  1O1W A;  3PUF A;  3L2V A;  4FJJ A;  1VSE A;  4CEQ A;  4FZZ A;  3MEC A;  3AVA A;  3VQ8 A;  1NJX A;  2KZZ A;  3ITH A;  3V4I A;  3QNO A;  1L3S A;  4F3O A;  2FBY A;  4OGE A;  3NGZ A;  3L2R A;  1L3T A;  2BDP A;  2OZS A;  4CHQ A;  3OYJ A;  4M3R A;  1QE1 A;  4AHC A;  4CJ4 A;  3ZCM A;  4CF1 A;  3RMD A;  3DYA A;  4LH4 A;  3V1O A;  1KSP A;  2F8S A;  4F2R A;  4OLA A;  1J53 A;  1B9D A;  1TL3 A;  5JS2 A;  1RT1 A;  4BE1 A;  1QS4 A;  4N47 A;  3ZSY A;  4B08 A;  1U45 A;  3OYC A;  3SCX A;  4C8L A;  3G0Z A;  3T3F A;  4CJR A;  4Z4E A;  3V9S A;  4CEF A;  4FLV A;  1JL1 A;  3KLI A;  3P1G A;  3VQ7 A;  3HPH A;  4NCG A;  4FXD A;  4AH9 A;  1B9F A;  4E89 A;  3NH0 A;  3RRG A;  3LZJ A;  3NF7 A;  3QET A;  4QAG A;  3HP9 A;  2LSN A;  3LAK A;  1WAJ A;  3AO4 A;  2KQ2 A;  3C95 A;  1RBR A;  3M8S A;  4KKO A;  3RR7 A;  1RBV A;  4CGG A;  3QEV A;  3V6D A;  1VSK A;  1Y97 A;  1VRU A;  3V9W A;  1N6Q A;  4KI4 A;  2PY5 A;  1NK9 A;  3MXJ A;  4FW2 A;  4HUE A;  4B9T A;  3D45 A;  5J2P A;  2GUI A;  3TWH A;  4DTN A;  1QSY A;  4I7F A;  1NJY A;  3MED A;  3B6O A;  3L2W A;  5FRN A;  3S3O A;  4C8O A;  4L8R B;  2D0B A;  1I3A A;  3QO9 A;  1WSF A;  4C8M A;  4XIU A;  4DQI A;  3V1R A;  3NHG A;  1VSH A;  2IS3 A;  3CM6 A;  3DRS A;  3UIQ A;  1XC9 A;  3PX6 A;  3WNH A;  1U04 A;  3HK2 A;  2D0A A;  3A2F A;  2E6L A;  1G15 A;  3NCI A;  1Z26 A;  3ZT0 A;  1U4B A;  4KRE A;  3ZT1 A;  1FXX A;  1KLM A;  5KRS A;  2GV9 A;  3OYI A;  3SQ4 A;  1L5U A;  4NCA A;  4Y1C A;  4OKK A;  3NGY A;  3VQC A;  4CFD A;  3HP6 A;  1XI1 A;  1TK5 A;  4W5N A;  4DSE A;  4PA1 A;  4CFB A;  4E7I A;  1DTQ A;  1NKE A;  4DU3 A;  3ZSQ A;  3KD5 E;  1Q8I A;  1VSJ A;  2DTU A;  1CXQ A;  1KFD A;  3VQ5 A;  4DLE A;  4FJ9 A;  4DF8 A;  2JLE A;  3KJV A;  2ZD1 A;  3P5J A;  4KHS A;  2YKN A;  2YKM A;  3VQP A;  2ZE2 A;  4PWD A;  1WSJ A;  3M8P A;  4K8X A;  4FJL A;  5KGX A;  5HLF A;  3IG1 A;  4CHY A;  3F73 A;  1BIS A;  4B8C A;  3OYB A;  4EZ9 A;  1LAW A;  1RCH A;  4ELT A;  4FJ7 A;  4QCL A;  3NFA A;  2KFN A;  4CEO A;  3NF8 A;  4CCH A;  2E6M A;  2Y1I A;  2EX3 A;  3E01 A;  4FJM A;  3AVH A;  3EZ5 A;  4FLX A;  3D0P A;  4BWJ A;  4CJU A;  3VQ4 A;  4DTO A;  5CYM A;  4CGJ A;  4CEB A;  1DLO A;  1S5J A;  1C6V A;  1JXB A;  4CE9 A;  3HT3 A;  3WNF A;  4DQS A;  3LDS A;  4O0J A;  4FLT A;  3JSM A;  3LPT A;  1RT4 A;  1JLB A;  2OPP A;  2YHB A;  3LPU A;  2P51 A;  5CZ2 A;  4O5B A;  5FRO A;  4W5Q A;  3THV A;  1JLG A;  1BI4 A;  3VQE A;  3LAN A;  4F3T A;  4DQQ A;  5J2Q A;  3U3Y A;  1T8E A;  3EY1 A;  4HTU A;  3NH2 A;  4E3S A;  3DLE A;  3HXM A;  4AIL C;  4DSJ A;  4CJ3 A;  2D5R A;  1ASW A;  3PY8 A;  2W42 A;  4EP4 A;  3LAL A;  2E4L A;  4B8A B;  3QEX A;  4QOZ B;  4E7H A;  2X6N A;  4AHS A;  1TAU A;  1UAX A;  1JLQ A;  1NK7 A;  4CGD A;  3AVC A;  2VG5 A;  4CF9 A;  3O3F A;  1NK6 A;  2RN2 A;  4IKF A;  2XO7 A;  3F9K A;  1RIL A;  2NUB A;  3QEW A;  3PX4 A;  4M3X A;  3VN5 A;  1U49 A;  2KZM A;  1MU2 A;  2I5J A;  4M45 A;  3DRR A;  2G8F A;  4FZY A;  4FJH A;  2RPI A;  3KD1 E;  1T03 A;  2XHB A;  1S1V A;  4DU1 A;  1YTA A;  1LWE A;  4CEE A;  3T1A A;  3IS9 A;  4OGC A;  3ZSO A;  3SPY A;  3JYT A;  4OLB A;  2DY4 A;  3K5M A;  2YNH A;  1FK9 A;  4DTM A;  1F21 A;  1WAF A;  1Z25 A;  1EP4 A;  2X74 A;  4OVL A;  3VA0 A;  1X9S A;  2HHX A;  4F2S A;  3SUN A;  3S3M A;  3PV8 A;  1L3U A;  1BIU A;  4YFU A;  3VQ9 A;  1D9D A;  5HP1 A;  1IKX A;  1S9E A;  4FLU A;  2OYQ A;  1S9G A;  3KK2 A;  3KK3 A;  1NOZ A;  1UA1 A;  4M3Y A;  4O4G A;  2VG6 A;  1D5A A;  4BE0 A;  5CYQ A;  4FM1 A;  2RKI A;  4H8K A;  1UA0 A;  4J2E A;  1S1X A;  2ATQ A;  3ZSZ A;  4CK2 A;  4EP5 A;  3I0R A;  1JLF A;  2BE2 A;  3LAM A;  2HB5 A;  4CFC A;  4OKE A;  2PYL A;  1S1T A;  3QIP A;  1RDB A;  4CF0 A;  2B4J A;  4AHR A;  4CFA A;  4HUG A;  2YV0 X;  3T19 A;  3SJJ A;  3DRP A;  4Q5V A;  1CZB A;  4E0D A;  5C25 A;  1VSI A;  2HND A;  3OJS A;  3KLH A;  2F96 A;  1J54 A;  4PUO A;  3AV9 A;  4ID5 A;  4CJQ A;  4O0I A;  3NDK A;  1TAQ A;  3NE6 A;  1ZYQ A;  3NBP A;  1K6Y A;  3MEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...