2A1RA

Crystal structure of parn nuclease domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
423
structure length
300
Chain Sequence
b'MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLRHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*A)-3'
publication title Structural insight into poly(A) binding and catalytic mechanism of human PARN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 86
structure length 300
sequence length 423
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2a1rA01
3OS1A 4B8CA 1HJRA 4KO0A 3HL8A 5HRRA 3BDPA 1GOCA 3JSMA 3NGYA 3L2QA 3D45A 1RT5A 1TAUA 4XIUA 2OZSA 3AVNA 4R5PA 4CJ5A 3MXJA 4DFPA 4CJ4A 1T03A 1L3VA 1NOZA 4L8RB 3OYBA 4KHNA 1JLBA 3AVAA 4NCBA 4W5TA 3KKRA 4DMNA 2FBVA 3OYFA 4OGEA 4FLZA 3OYGA 2PYLA 4J2EA 3ZSVA 4FJ8A 4PQUA 1VRUA 3V9UA 1BIZA 4AHRA 3BGRA 4OGCA 2G8FA 3LAMA 3RWUA 4M3ZA 2ZD1A 4FLXA 4DS4A 4ELTA 3HO1A 1JKHA 4FVMA 2HVIA 2YNIA 1RBSA 4NCAA 1LAWA 4DS5A 4J2DA 5CZ1A 5T7BA 4E7KA 2WOMA 1S1UA 1JXEA 2YKNA 3B6PA 3MEGA 4FW1A 5HBMA 4W5QA 1RBVA 3KLFA 3OVNA 3SV4A 3RMCA 4Z0UA 1QQCA 4O0IA 2OPQA 3QEPA 4MQ3A 3OYNA 1UA0A 2KFZA 3QIOA 1C0TA 3O4QA 1S1TA 1CZ9A 4I2QA 3V9XA 3QEWA 1LAVA 2RN2A 4CEBA 4W5NA 2HHSA 3NBPA 3C94A 3NAEA 2G8UA 4CHNA 3OS0A 4IFVA 3VQ6A 3AVIA 1FK9A 4DWIA 3CQ8A 2AJQA 4IKFA 1NJYA 1KVCA 3QO9A 1UWBA 2ATQA 3KIOA 2IDOA 3OJUA 3PO4A 3AO4A 3HPGA 1KLNA 2P5OA 5KRSA 3ZT3A 1NOYA 5J2QA 3P1GA 1VSEA 4JLHA 4M3UA 2YNFA 2HNDA 2QXFA 4LH5A 4CEAA 4E0DA 4BDYA 2Q3SA 4CJ3A 1U49A 4N47A 3AA5X 4FZXC 4HCCA 1S9EA 3NHGA 3SPYA 1ZBFA 4RW7A 2OA8A 4Z4EA 3L8BA 1JLQA 4KV8A 4KB1A 2HVHA 1HYSA 2XY6A 1ZBUA 4DTMA 4OKKA 4FLTA 3ZSQA 3I0SA 1L3UA 3KJVA 1BI4A 4J2AA 2DFFA 2E6LA 2RKIA 3L3VA 2P51A 1ASVA 1D5AA 1TKXA 2D0AA 3VQBA 4ID5A 4YFUA 1ITGA 1T05A 2QKKA 4HCBA 4EZ9A 1SL2A 4KTZA 2NUBA 3LP0A 5J1EA 1KFSA 4DFKA 3TAFA 3MXMA 1T7PA 4DSLA 4ID1A 4CEOA 3ZT0A 1GOAA 3VQDA 3VQ8A 3ZCMA 3F9KA 5E41A 3IS9A 3M8SA 5FRMA 1ZBHA 3RRGA 4DU3A 1LW0A 1VRTA 4TSXA 4AHCA 1NK6A 4C8LA 3LPUA 4CJTA 4O44A 3K5NA 1BGXT 4CJFA 4CGJA 1DTTA 1LWFA 1KLMA 3KD5E 3L3UA 2KQ2A 3I0RA 3TAQA 2E6MA 3KD1E 3KK1A 1KSPA 4J2BA 2Z1HA 5J2MA 1LV5A 4CHYA 3K57A 4OPKA 1RT3A 4I9QA 4FJNA 1LWEA 2ZE2A 4FM1A 3K5LA 1X9WA 1RBRA 2IS3A 1RNHA 4B9MA 1SV5A 2RPIA 4BE0A 3LWLA 1RDDA 2B6AA 4JS4A 1U48A 3DM2A 3KLGA 4B3OA 1HPZA 4BWMA 2IAJA 1I39A 4B9VA 3HM9A 4M42A 3AVCA 4DTUA 1WSEA 3VQ7A 3MAQA 2RF2A 1REVA 2P5GA 4E7JA 3QINA 3LDSA 3ZSXA 3LZIA 4NYNA 4JS5A 4DTOA 3VQ9A 2F8SA 1C0UA 1C6VA 1QHTA 3VQEA 4CF8A 3NF9A 3AA4A 3VQQA 3V1QA 4CF2A 4DSEA 4B9UA 2FBXA 1K6YA 1Q8IA 1ZBLA 4E1NA 4W5OA 5FRNA 3PX4A 4Z4IA 3SZ2A 4RW9A 3D0PA 4PWDA 2HW3A 1C1AA 3LANA 4CGIA 1J5OA 1JLAA 1RT1A 4CJPA 1WSIA 3LALA 3DLHA 1BISA 3PO5A 1WSFA 2HNYA 1RT4A 4AH9A 3DRPA 1W0HA 3CM5A 3DOLA 4CIEA 1N5YA 3SUNA 4KREA 4B9TA 2B4JA 4CIFA 1DTQA 1YTUA 3HVTA 4AHVA 2F8TA 4CFBA 1TVRA 2HHTA 3AO1A 3L2RA 1X9MA 5D3GA 4WE1A 2HB5A 1KVAA 4FLYA 1LW2A 2X78A 5CZ2A 4CESA 1NK9A 1RTJA 1MU2A 1O1WA 4CECA 1NKCA 2ZQBA 1FKOA 4HVJA 1NKBA 3LP2A 3SCXA 1YTAA 3NCIA 3QNNA 1L5UA 1WAJA 3T3FA 3AVJA 5C25A 4H8KA 5HRPA 4IFYA 2OYQA 4G1QA 1LWCA 4E19A 3OY9A 3OJSA 3U6FA 3SQ2A 3UIQA 3DYAA 3KK3A 4EP5A 4KI4A 4B08A 2WONA 3HSTB 4CEDA 4Z4GA 4DQSA 4BE2A 1KCFA 1BI4B 4OJRA 5C24A 3ZT2A 4CJSA 2W42A 4BDPA 3QERA 1Y97A 1TK8A 1HNVA 4H4MA 3V9SA 4KTQA 5I42A 2Z1IA 1JLFA 3HT3A 4DQRA 1VSIA 3SJJA 4KFBA 1SL1A 1SL0A 1IG9A 3A2FA 3OYCA 1TK5A 2XY5A 1IKWA 2X6SA 4NCGA 3L2VA 4CHOA 2G8KA 4HUEA 3EY1A 3OYIA 4JRQA 1C0MA 3TR8A 4CGGA 1U4BA 3ZSWA 3TAEA 3EZ5A 4Q0BA 2G8IA 3ALYA 3K5MA 2G8HA 4B9SA 4CJWA 4M3TA 1IKYA 3G0ZA 4CK3A 1WSGA 3SI6A 1IKVA 3FFIA 3SYZA 4QCLA 3DMJA 4AHUA 4K8ZA 1S6QA 1W9HA 1X1PA 4QOZB 4ICLA 4HTUA 2HHUA 5SZTA 2HHQA 1EP4A 2LSNA 5KTQA 2FC0A 1RILA 3QNOA 4DG1A 4C8KA 3KLEA 1HNIA 4M3XA 2X6NA 3S3NA 3LAKA 2R7YA 4H4OA 3ITHA 4M41A 2XRIA 3M8QA 4FW2A 1FKPA 1G15A 3K2PA 1SKSA 2KW4A 2KTQA 4F2SA 4HHTA 3V4IA 3OYKA 2DFHA 4Z4HA 1VSHA 3NF7A 2X74A 2XO7A 1VSJA 4E89A 3CFRA 5HLFA 4LD0A 1Q9XA 1Z25A 3V6DA 2Y1IA 4BE1A 4CFDA 4LSLA 1TAQA 3IG1A 3V1OA 4RW4A 3PY8A 3E01A 3ZT1A 3HP6A 1WLJA 4CEQA 2HHVA 1BHLA 3DI6A 2YNHA 4DTJA 1CZBA 4O4GA 3V81A 3AVFA 2KZZA 1IO2A 4CK1A 1RT7A 4DQQA 3O3GA 2OPSA 1HRHA 5HRNA 1BCMA 4PY5A 4KHQA 4DSKA 1JLCA 1BIUA 2HNZA 1RT6A 2O4IA 4FJIA 2P1JA 3HPOA 4BDZA 4FLUA 4FK4A 3NH0A 4FJJA 4AHSA 3PV8A 3NFAA 1KRPA 1TKDA 1B9FA 1HQEA 2HHXA 2D5RA 4DTPA 3PUFA 1KFDA 4CEFA 3LZJA 4DU1A 3U3YA 4KHUA 3O4NA 3NH1A 4FLVA 4FJ9A 1TL3A 3VQPA 4FZZA 4PA1A 4N5SA 4LY7A 4GW6A 1VSKA 1XHXA 2A1SA 4UQGA 4DTXA 4DFMA 3OS2A 4QAGA 3LWMA 3U3GA 1QS4A 1RCHA 4I7FA 3S3MA 1XC9A 4FJXA 5FROA 3SUQA 3DLRA 4E1MA 4C8MA 4CHQA 3OYAA 1WSHA 4CJUA 3MECA 3DRSA 3LPTA 3I8DA 3V1RA 4BWJA 3VA3A 1JLGA 1S1VA 3OYLA 4I2PA 1WAFA 3RMAA 5SWMA 4JRPA 1RDCA 4M3RA 1NK8A 4FJLA 1VSFA 3ZT4A 3NF6A 4E7IA 4AILC 3AVBA 1RTIA 1UAXA 4N41A 1ZBIA 1WSJA 4FJKA 4M3YA 4CF9A 3VA0A 3KK2A 3L2WA 3RRHA 4KRFA 4ZHRA 2XY8A 4LH4A 1WN7A 1R0AA 4F2RA 4PUOA 2Z1JA 1D8YA 1ASUA 3IRXA 3NF8A 4RW6A 4N56A 2VWJA 2YHAA 4Y1CA 2GV9A 3B6OA 1VK0A 4HUGA 4FM0A 3AO5A 2KFNA 3AA3A 2BDPA 1J54A 3CM6A 1Z26A 3TAMA 4KB0A 1DLOA 2A1RA 4Z4CA 3HYFA 3SQ1A 1JL1A 1XHZA 2QKBA 2YHBA 4FJMA 4IG3A 1F21A 3QETA 3OYDA 1S1WA 1Q9YA 3KLIA 2ETJA 2OPPA 3AV9A 3DLGA 5CYMA 3NH2A 3RMDA 3OYMA 3OYJA 2FBTA 1IH7A 3P5JA 1CXUA 1TL1A 4IG0A 3T1AA 4CJEA 4FLWA 2ITGA 4CJRA 1RTHA 4F3OA 3HPHA 4ELVA 4YNQA 4OPJA 3O3HA 1JL2A 1KTQA 3EYZA 2Y1JA 3VQCA 1SKRA 2PYJA 1RDBA 3VQAA 2KZMA 3AVKA 4RW8A 1BQMA 4CEZA 4DTSA 1QSSA 4FZYA 3CYMA 3V9ZA 5DK5A 5EU7A 4F8RA 4KKOA 5DMRA 4ELUA 3RR7A 1S5JA 1CLQA 2VG6A 3AVMA 4BACA 4DU4A 3O3FA 4M3WA 2BGGA 1VSLA 3DRRA 1BL3A 3T19A 5C42A 3SUPA 1RTDA 4DQIA 2HMIA 4CGHA 3WNFA 4GMJB 3SNNA 3AVGA 4CIGA 4RG8A 4O0JA 1XI1A 4FK0A 3HJFA 2GUIA 3LP3A 3TAPA 3QEIA 1TKZA 1BCOA 1JLEA 1GOBA 4O5BA 5J2NA 3TI0A 1NJWA 4N76A 1HYVA 3F73A 3DOKA 3P83D 4OKJA 3TANA 3QESA 1D9FA 1SUQA 1QSLA 1KVBA 4I9LA 4MFBA 4DLGA 3K5OA 1TGOA 3PX6A 4B9NA 1EXQA 4OKEA 1L3TA 3KKSA 4Y1DA 4DTNA 3SV3A 1J9AA 4CGDA 3PX0A 4ZTFA 1U47A 1NK4A 1RT2A 4E3SA 1WNSA 3H08A 1S1XA 3CG7A 3RMBA 3HVRA 2QK9A 1RBTA 3AO3A 3THVA 4CERA 2EHGA 3C95A 5JS2A 2VG5A 4OLBA 5JS1A 1S9GA 5KI6A 4IBNA 2IC3A 3SQ4A 3LP1A 2YKMA 3M8PA 3TARA 2VWKA 3IAYA 4CJLA 1NK7A 1X9SA 1EETA 2OPRA 1L3SA 1NK0A 2GBZA 2YNGA 1XWLA 2F96A 2I5JA 2O4GA 3CFPA 5K14A 1IKXA 4C8OA 2DTUA 4DLEA 5HRSA 2EX3A 4EZ6A 1UOCA 3TAGA 1T8EA 3ZSYA 4CHPA 3SQ0A 4DSIA 4NYFA 3RTVA 4DFJA 1BQNA 1C1CA 1HMVA 1JXBA 1CXQA 4M45A 4KHYA 3DLKA 3DLEA 4LSNA 1A5XA 3K58A 4O55A 4DF8A 1EKEA 3JYTA 4FJHA 4KI6A 3K59A 1N6QA 2OZMA 3ZSZA 3S3OA 4Z4FA 4FM2A 3KLHA 3TWHA 5CY4A 1C1BA 3AVHA 4CFCA 1NK5A 4FYDA 1QSYA 3SUOA 2D0BA 2IGIA 1SKWA 4F4KA 5KGXA 4E7LA 1YT3A 1ASWA 4CCHA 2PZSA 5KRTA 1D9DA 1TV6A 4K8XA 4KAZA 1A5VA 2YV0X 4CE9A 4E7HA 1FXXA 4KPYA 3C6TA 4HUFA 1VSMA 4KHSA 1YVUA 4DQPA 2D0CA 4CGFA 4EP4A 3V9WA 3VQ4A 4Q5VA 3KTQA 1B92A 4C8NA 1UA1A 4CJKA 5FDLA 3OYEA 3OYHA 4ZTJA 4FJ7A 4F3TA 2BANA 3ZSRA 4B8AB 3NGIA 3MXIA 2G8WA 4GVMA 4DSFA 3TABA 2BE2A 3QEXA 4FK2A 5CYQA 4CF1A 3S9HA 2DFEA 4DF4A 3VQ5A 1NJXA 4KTWA 3MEDA 2XHBA 2PY5A 2DY4A 5HP1A 2VG7A 4FXDA 1EX4A 1HQUA 5KGWA 1HYZA 2JGUA 3QLHA 4OVLA 3CFOA 1RDAA 3L2UA 1U04A 5HROA 1NJZA 3HP9A 4FJGA 3NDKA 2B5JA 4IDKA 4CHZA 5I3UA 4DSJA 3C6UA 4FJ5A 1QTMA 3QIPA 1VSDA 3ISNC 2XY7A 4OLAA 1J53A 2G8VA 1B9DA 3WNHA 3HK2A 4CK2A 3SPZA 4AHTA 4CF0A 1NKEA 3AO2A 3ULDA 3AVLA 1S6PA 2E4LA 3ZSOA 3RR8A 4KHWA 2HHWA 2FBYA 3AA2A 2IOCA 3VN5A 1ZYQA 3WNGA 5J2PA 3NGZA 4CJVA 4B9LA 2Z1GA 3NE6A 4CFAA 1A5WA 1RBUA 4CJQA 1U45A 3G10A 3DLBA 1I3AA 3HXMA 1TK0A 4DTRA 3M8RA 4CEEA 2JLEA 3ASMA 3WNEA 3QEVA 4FCYA 1TKTA 1QE1A 3MEEA 4W5RA
chains in the Genus database with same CATH superfamily
4M7XA 1HR0K 1HJRA 5HRRA 4JK9A 4CZIA 1TAUA 2QWQA 4CZHA 4XIUA 3THWB 3D2EB 4R5PA 1VQ4N 4O8KA 2E88A 4L8RB 4DR2K 3IDHA 3AVAA 4NCBA 3AAQA 3KKRA 2FBVA 1X9JA 3WXKA 4BR5A 2PYLA 3ZSVA 1VRUA 3V9UA 3T69A 1OH6A 2Q31A 2E2NA 4FVMA 2O8DA 1RBSA 4NCAA 1JCFA 1VQPN 2OTJN 1LAWA 5C0YA 3R3LA 4J2DA 4JI3K 5T7BA 1S1UA 3B6PA 3FGUA 4FW1A 4W5QA 4FJGA 4CZEA 3SV4A 3QEPA 5AR0A 4O0IA 2OPQA 2KFZA 4I2QA 3QEWA 3P31A 4CEBA 4HWIA 3KWIA 2HHSA 3C94A 4JV5K 2G8UA 2AJQA 3ZX2A 1NJYA 1UWBA 2IDOA 1XC3A 4H0YB 1MA9B 4DV6K 2V51B 1EQYA 1Y64A 3H3OB 3ZT3A 1NOYA 3P1GA 2JWKA 4M3UA 1WOQA 2DPNA 2YNFA 2PBDA 2QXFA 4CEAA 3J7ZO 2Q3SA 4CJ3A 2E20A 1MDUB 3AA5X 1S9EA 5CE3A 4JKAA 4IJNA 4KB1A 2ZF5O 1HYSA 2XY6A 4DTMA 3H1VX 3I0SA 3ZSQA 3KJVA 4J2AA 2E6LA 4BRQA 1HKGA 4HCBA 1MWMA 4EZ9A 1SL2A 4KTZA 2NUBA 3LP0A 1FW6A 3MXMA 3ULEA 4DSLA 4BRFA 4CEOA 3IUCA 4WYBA 1GOAA 3Q7BA 4PKIA 3ZCMA 3F9KA 5E41A 5AZJB 3RRGA 3BZKA 5AQVA 1NLVA 4CJTA 2NRZA 2P9PA 4O44A 4CJFA 2RHKA 2KQ2A 3I0RA 3O9RA 2Z1HA 4FJNA 4O8UA 2ZE2A 3L4IA 3K5LA 1X9WA 1RNHA 5LMUK 3DM2A 1GLJO 4BWMA 3HM9A 3AVCA 3K9JA 4JEPA 5JVGL 5AQFA 4JS5A 3THXA 1C0UA 1C6VA 3CCUN 5CR4A 1YUWA 3NF9A 1HKBA 4DSEA 4B9UA 5AQKA 1GLAG 1SAZA 1T44A 4E1NA 3PX4A 3SZ2A 3F9MA 2CGJA 1J5OA 1ILYA 1JLAA 1RT1A 4JK7A 3PO5A 4CIEA 3DRPA 5TKWA 2NRVA 3SUNA 3ENBA 5EXWA 1GLBG 2HBMA 4J8FA 4WE1A 2HB5A 4CESA 1MU2A 4CECA 3TSQA 4B1WB 4GKKK 2F9TA 1WAJA 4IFYA 4E19A 4JAXA 5E84A 3UIQA 3DYAA 3A5OC 3ENHA 4DR1K 3HSTB 4DQSA 5C24A 3ZT2A 5BR9A 4BDPA 3QERA 4H4MA 3AY9A 2Z1IA 4CZLA 4DQRA 4MO4A 3A2FA 4KH5A 1TK5A 3G71N 1IKWA 2P9UA 4NCGA 4BREA 2FSJA 2QXLA 3F5TA 4NLBA 2VQEK 3EZ5A 4BR0A 4JNEA 4M3TA 3GL1A 3MN6A 3WEEA 3SI6A 3SYZA 2QTDA 3CJAA 3DMJA 5GAGP 4C23A 4JI1K 1DT9A 2IIRA 3HRGA 4ICLA 1OH5A 4LF9K 3CPWM 3WQTA 5SZTA 2LSNA 5KTQA 4NXMK 3QNOA 4C8KA 1DEJA 4H4OA 4FW2A 5CHIA 1FKPA 1G15A 5LY3A 3DXMB 4CD3A 4HHTA 1HNXK 3AARA 3QMLA 2Q36A 2X74A 2XO7A 3THWA 1YF5L 3CFRA 5HLFA 1Z25A 3CCSN 3CQYA 4LSLA 3V1OA 3E01A 3ZT1A 2NRRA 1CZBA 4O4GA 4CK1A 3WXIA 3CPEA 2OPSA 3CC2N 4DSKA 3EKSA 2UXCK 1BIUA 2HNZA 2O8BA 3HPOA 4BDZA 3D2FA 2H3GX 5IT9O 3CJ9A 1NBWA 2V52B 1HQEA 2UXDK 4I6MB 1VQON 3HSCA 4OX9K 3W0LA 4BC3A 4LY7A 2Q0UA 4DFMA 2IVPA 3OS2A 2GWJA 2HBLA 4I7FA 4FJXA 5KPRA 2V7YA 4OPAA 3VERA 4IO9L 5LL6Z 3LPTA 2WC9A 4JKGA 3SMPA 3OYLA 2Q0RA 4I2PA 3CETA 3RMAA 1GLFO 1RDCA 4M3RA 5M1PA 5GINA 3M5RA 4C1NI 2ZJQL 5DM6L 4M3YA 4CF9A 3VA0A 5GIPA 3FZHA 4ZHRA 1R0AA 1ATNA 2O8CA 2Z1JA 1ZC6A 3NF8A 4RW6A 4N56A 4Y1CA 2GV9A 4HUGA 1VQ6N 1J54A 4ISEA 3CM6A 3TAMA 5AZJA 4DKWA 1DLOA 4KB0A 4Z4CA 1HJOA 1JL1A 4DB3A 3BEXA 2OPPA 3OYJA 4CW7B 4YY3K 1TL1A 3OBWA 4JI6K 1W7AA 4JHDB 2ITGA 1P90A 4ELVA 4YNQA 4JD2A 3MWTA 4CEZA 1BQMA 4KH6A 2YHXA 3V9ZA 5DK5A 5EU7A 4BG8A 3VTIA 1VSLA 3GG4A 1BL3A 4CBWA 1J5EK 2HMIA 3BF1A 3JXUA 2GUPA 4RG8A 4BRCA 5TKYA 4FL9A 4FK0A 2GUIA 3TAPA 4NB4A 4O5BA 5LJWA 4N76A 3ID8A 4OKJA 1SUQA 3VETA 3DXKB 3K5OA 4B9NA 1EWQA 4YORA 1KD1O 4Y1DA 4DTNA 2HBKA 1NK4A 3EZWA 4E3SA 4LF4K 3CIPA 2FLOA 3VEWA 4FWLA 4JKFA 4AM7A 4CERA 4IJAA 1U2VA 1Z05A 3IMXA 5JS1A 5DM7L 5JVHL 4B9QA 5FLXO 1L3SA 1EETA 1NK0A 3MX2A 1XWLA 3CFPA 2DTUA 1NGGA 1IKXA 4CHPA 4DFJA 4FWMA 1BQNA 3O5BA 4O55A 3MMVA 4FJHA 3K59A 5AQUA 4Z4FA 3VGLA 4BRLA 4IOCL 1NJIO 3O6WA 3AVHA 1I94K 4FYDA 4BROA 4H5RA 2D0BA 3SAFA 3LDLA 4CCHA 4A2BA 2PZSA 1D9DA 4K8XA 4E7HA 1YJNN 2O8FB 4EP4A 4Q5VA 1HUXA 4FJ7A 3VESA 1P8ZA 3OYHA 3BY5A 2BANA 2G8WA 3R9PA 4H5NA 3S9HA 1SS6A 4DF4A 1NJXA 3N4PA 3A5NC 3C7NA 4CZGA 2WBNA 3L2UA 1U04A 3HP9A 2YJEA 3VOVA 2B5JA 3A8YA 1VSDA 3ISNC 3BP8A 2P9LB 4YDUA 3O8MA 3AO2A 3RR8A 1S6PA 1YHQN 2YHYA 3WNGA 3NGZA 4B9LA 2Z1GA 2F4VK 3J7YP 4NO7A 2D0PA 3B8AX 1RBUA 4CJQA 3G10A 3DJCA 1TK0A 3ASMA 3QEVA 3SJHA 3O4WA 3U8XA 5F0XA 3FR0A 4BRIA 3OS1A 4KO0A 3BDPA 1GOCA 3L2QA 1RT5A 3CHWA 3QFUA 2OZSA 3PIPL 4CJ5A 5LJVA 4CJ4A 3BZCA 3U9DA 4DMNA 4PQUA 2QWMA 2QA4N 1BIZA 3E66A 1N36K 4EHUA 4M3ZA 3LAMA 4ELTA 4DS4A 1HNWK 5EVZA 1E3MA 5EX5A 1JXEA 2YKNA 3MEGA 4BGAA 3OVNA 3HZ6A 5AZIB 3OYNA 1CZ9A 5B8HA 4W5NA 3NAEA 4IFVA 1FK9A 5KQ8A 1KVCA 3QO9A 2VCPA 2A42A 1R59O 3AO4A 1IJJA 2PFUA 4CZFA 1T6DA 5KRSA 4IWVA 4JLHA 3O9TA 2HNDA 1SQKA 1U49A 4N47A 4HCCA 4YDUC 1KAZA 3SPYA 1ZBFA 4MDBA 4RW7A 3L8BA 4RTFD 3U4LA 4OKKA 1QVFM 4MLHA 4PL7A 1BI4A 2DFFA 4UQGA 2RKIA 3CMEN 3ZETB 5BR8K 4YFUA 1JJ2M 4DUYK 1YTUA 1ITGA 1T05A 3CJ1A 1T7PA 4DUZK 2HMPA 3I8BA 2AP1A 3MDQA 4BR9A 4BY9C 5JLFA 3VQDA 3KVGA 5FRMA 1ZBHA 4DU3A 1XMOK 3D6RA 3CJCA 4C8LA 3LPUA 5BRHA 1BGXT 3CJBA 3K5NA 4CGJA 1DTTA 5FPNA 2E6MA 4J2BA 3KK1A 3K57A 1K8KB 4FM1A 5JICA 3CCEN 2IS3A 1SV5A 3EO3A 1RDDA 4JS4A 3DXKA 1I39A 4YOYA 1IG8A 4B9VA 3VGKA 4F9OA 4JKEA 4DTUA 3K0SA 3MAQA 4E7JA 3QINA 3LDSA 2VGMA 4DTOA 3VQEA 4KBOA 3VQQA 3V1QA 4BVPA 2FBXA 1K6YA 1Q8IA 3CD6N 2VYPA 4W5OA 3Q7CA 4RW9A 4PWDA 1C1AA 4CGIA 4YHHK 4CJPA 2WUSA 1K73O 3DLHA 3ID6A 2ZJRL 4GVEA 1Q18A 1WSFA 1N5YA 3DOLA 1YJ9N 4B9TA 2B4JA 1DTQA 3HVTA 4AHVA 5JMVA 1OH8A 2HHTA 2UUBK 1GLLO 3P4IA 3L2RA 1X9MA 3H6EA 1HLUA 1KVAA 1NK9A 5CZ2A 1RTJA 4BQLA 4FWPA 4BRMA 3THYB 1NKBA 4FWNA 1Q81O 3DWLA 3CCLN 3OJSA 3U6FA 2PAVA 2QWLA 3KK3A 4EP5A 4B08A 1RDWX 4CEDA 4BE2A 1KCFA 3MN9A 4CJSA 1TK8A 3V9SA 5I42A 3SJJA 1SL0A 1IG9A 2P9IB 3SAGA 3RSEA 2FXUA 3K9KA 4CHOA 2G8KA 3OYIA 1N32K 5BRFA 5AQLA 3ZSWA 1U4BA 2G8IA 3K5MA 2G8HA 1IBLK 2P9LA 1IKVA 3FFIA 3SBTA 5AQNA 3VEZA 4K8ZA 1S6QA 3QICA 3CMAN 2QEXN 1J6ZA 3KK7A 3SMSA 3UKRA 2HHQA 4RWTA 1EP4A 2FC0A 1BA0A 3L0QA 4DG1A 1D4XA 3VEOA 5BPLA 2X6NA 3UE5A 1BOTO 4IEIA 2DFHA 4U7BA 4Z4HA 3KHYA 1ESVA 2ZM6K 1Q9XA 3HBTA 4LD0A 3O9QA 4BE1A 1WLJA 4CEQA 3QBXA 2KZZA 3DI6A 4YOTA 2YCHA 3O3GA 3S41A 3O9UA 1BCMA 4JN4A 4KHQA 1JLCA 3T1YK 1RT6A 2P1JA 1LOTB 4FJJA 5ELZA 4AHSA 3NFAA 5EY4A 1WBDA 3E1YA 1TKDA 2QI2A 2HHXA 3LM2A 4CEFA 3LZJA 3U3YA 4JI5K 4FLVA 4FJ9A 3VQPA 4LF5K 4FZZA 4N5SA 4BC2A 4GW6A 4DTXA 1GLCG 1RDUA 3R6MA 1QS4A 1QQMA 2ZJPL 5FROA 3DLRA 4E1MA 3OYAA 3NVMA 1YXQA 4PKHA 1JLGA 1S1VA 5C12A 5AQXA 5AJ3K 5SWMA 3AVBA 4N41A 1ZBIA 5AQOA 3KK2A 2A3ZA 3L2WA 4JKHA 4KRFA 1WN7A 5I9EB 1XQSC 1D8YA 1ASUA 2V7ZA 2FF6A 2OCEA 2YHAA 3AO5A 4OO1J 4BRHA 5ADXA 3VENA 1XHZA 1F21A 1VQLN 1S1WA 3C6AA 3P39A 3NH2A 4BGBA 3OYMA 2CH6A 1K8KA 3A0IX 3P5JA 1CXUA 3T1AA 4KHPK 4CJRA 1RTHA 4B1VA 3ZLJA 3HPHA 3O3HA 1JL2A 1KTQA 2QWPA 2Y1JA 3VQCA 1SKRA 1RDBA 1QSSA 1YJWN 4F8RA 5FPDA 3L4QA 4WFAL 3RR7A 1S5JA 1CLQA 1YI2N 3KWGA 3T19A 4EIAA 5C42A 1RTDA 4GMJB 3AVGA 3O1BA 4O0JA 1NU0A 1TYQA 3LP3A 3VEXA 3J81O 4XH1A 1GOBA 3VF4A 1NJWA 4JI7K 2YI1A 1HYVA 3DOKA 3P83D 5AQZA 3TANA 3QESA 1D9FA 4GV6A 4JKDA 3PX6A 1K9MO 2QWNA 2P9NA 3OTOK 1L3TA 1U47A 1TUYA 3H08A 3CG7A 4ISGA 3RMBA 3HVRA 4FWKA 1RBTA 2RE2A 3C95A 1JCEA 4OLBA 3D2EA 3CXCM 2IC3A 3SQ4A 3LP1A 2GELA 3M8PA 3TARA 4BG9A 1NK7A 1X9SA 2O4GA 2W40A 4DLEA 4EZ6A 1YIJN 4WQ5A 1T8EA 3ZSYA 3SQ0A 1G99A 3CCMN 1C1CA 1CXQA 4M45A 3DLKA 1NGIA 1EKEA 4LF6K 3JYTA 4L3QA 1C0FA 4IOXA 3KLHA 5CY4A 1VQNN 4CFCA 1H1VA 1QSYA 2IGIA 3TU5A 2E2OA 2Q97A 1QVGM 4F4KA 4E7LA 4H5TA 1ASWA 5KRTA 4KAZA 4CE9A 4KPYA 2A5XA 3C6TA 2HBJA 2W6LA 4KHSA 3VEYA 1YVUA 2D0CA 4CGFA 3V9WA 3VQ4A 4AF1A 3ZSRA 4B8AB 3M6GA 1EWRA 3TABA 3QEXA 4FK2A 4B3RK 2KHOA 5KQDA 3MEDA 2DY4A 2VG7A 4ILJA 5KGWA 4EAHD 4OVLA 2JGUA 5HROA 1NJZA 3PSIA 4FWQA 1BU6O 3NDKA 5I3UA 4CHZA 4DSJA 1Q7YO 4OLAA 4FVUA 1J53A 1NGHA 5ADXH 4K42A 1B9DA 2G8VA 3GOIA 4CK2A 4AHTA 3A5LC 4WQ4A 3ULDA 3NVKA 2KLAA 2GEMA 3DLBA 3C0BA 1U45A 4CEEA 4BQZA 3WNEA 1TKTA 1QE1A 4DFKA 2D1KA 1S3XA 4IO8A 4WQ5C 4B8CA 3JSMA 3T7ZA 1ATRA 2HF3A 4BRKA 3MXJA 1NOZA 4KHNA 1JLBA 4W5TA 4PL8A 4FLZA 4J2EA 4AHRA 3BGRA 2G8FA 3RWUA 3EE8A 3QDKA 4JKBA 3HO1A 2E8AA 1JKHA 2HVIA 2YNIA 1NG9A 5C10A 2QW9A 4DS5A 4NXNK 5CZ1A 1OH7A 2WOMA 3CF5L 1SL1A 1RBVA 2ZGZA 3FZFA 3OA9A 1QQCA 3RMCA 1UA0A 3QIOA 4DV4K 1LAVA 2RN2A 4CHNA 3VQ6A 4H0XB 3AVIA 4DWIA 4IKFA 2ATQA 3OJUA 1KLNA 4A5AA 2P5OA 3ZEUB 4BRNA 5J2QA 1VSEA 4GY2B 4A59A 2ASMA 4E0DA 4LH5A 5AQGA 4FZXC 2E2QA 4K43A 3NHGA 2HVHA 4WQ4C 4KV8A 4FLTA 3LDPA 1L3UA 4K0KK 3L3VA 2P51A 1TKXA 1D5AA 1N8RO 2D0AA 4ID5A 1BO5O 2QKKA 4JI0K 1KFSA 3TAFA 5GAHP 3MCPA 3ZT0A 3VQ8A 4IFEA 3IS9A 1LW0A 4AHCA 1QQNA 4TSXA 5GAEP 1NK6A 2ITMA 1LWFA 1KLMA 1LV5A 4I9QA 4OPKA 1RT3A 3UKUB 4M7YA 1RBRA 5H1SQ 4B9MA 4BE0A 3SK3A 3LWLA 2B6AA 4B3OA 1QQOA 1HPZA 3R8EA 4BR7A 1QZ6A 4MDAA 4M42A 3LDOA 2RF2A 1REVA 2ZWHA 3DXMA 5M1NA 3ZX3A 3ZSXA 1GLDG 4NYNA 3VQ9A 3HM8A 1QHTA 3OHRA 5FRNA 3FZLA 4Z4IA 5A2QO 3LANA 1WSIA 4BC5A 3LALA 1BISA 2HW3A 4AH9A 1RT4A 1VQ7N 3OBYA 5KPZA 3CI5A 4CIFA 4I6MA 4C1NK 3AO1A 4ISFA 5D3GA 1LW2A 1ATSA 4LC9B 1O1WA 5BN9A 1NKCA 2ZQBA 4HVJA 1HX1A 1YTAA 4BR4A 3NCIA 4DR4K 1LWCA 3OY9A 4DV7K 4LF7K 3EEQA 1BDGA 2QM1A 3VF6A 3PIOL 1NGAA 1VHXA 2W42A 4X65K 3TPQA 4JI2K 4KTQA 1X3NA 3HT3A 3ULEB 1VSIA 1NM1A 4KFBA 2VWBA 4BRAA 4HUEA 4H0PA 4JRQA 4CGGA 4Q0BA 1V4SA 3ALYA 4CVNE 3E9OA 1IKYA 3J80O 2NRTA 3TTDA 4AHUA 3WT0A 3WXLA 1X1PA 3A5MC 4QOZB 4YOVA 4HTUA 3M1FA 4H5VA 5KPTA 1RILA 4IXCA 2UXBK 3KLEA 1HNIA 4M3XA 3PLAA 1ZXOA 3S3NA 3LAKA 3FE1A 3ITHA 2XRIA 3N4QA 4JHDA 1QZ5A 1SKSA 4F2SA 3V4IA 3E9PA 1V4TA 1VSHA 3NF7A 4CJ7A 4DHYA 3W3DA 4A2AA 4CFDA 1T3VA 1TAQA 3IG1A 1KAXA 4A61A 3VF2A 3HP6A 1BHLA 2YNHA 3WXJA 2UUCK 1T6CA 1RT7A 4QS7A 4DV2K 1HRHA 5HRNA 4PY5A 4H03B 3NH0A 2YHWA 4K25A 1O13A 3IKMA 3CJ7A 3FZKA 1B9FA 2D5RA 4DTPA 3PUFA 1KFDA 1WB9A 1VQKN 4H0OA 1TL3A 4PA1A 4QAGA 5JLHA 1HPMA 1XC9A 3H46O 5C2DA 4CHQA 4C8MA 1WSHA 3I8DA 3V1RA 3VA3A 5EOYA 1WAFA 5C2FA 1S72N 4JRPA 2NLXA 4FJLA 2FSNA 4E7IA 4AILC 3WXMB 4FJKA 1CZAN 1IBKK 1YAGA 3E9LA 3RRHA 4B1XB 3M3ZA 3I33A 2P9UB 2XY8A 5C15A 4F2RA 3EE9A 3U9ZA 4JYAK 2EWSA 3B6OA 1VK0A 3WEEB 3WUHA 1FJGK 3AA3A 4WFBL 2BDPA 1Z26A 2UYTA 2CGLA 2A1RA 3HYFA 4FWRA 3SQ1A 4B3TK 2QKBA 2YHBA 4FJMA 4IG3A 4FSVA 3PSFA 3C65A 2ETJA 4WCEL 5CYMA 1BUPA 3DLGA 1XNQK 3RMDA 5AQSA 4DR6K 3G4SN 2FBTA 2O8FA 4F3OA 4OPJA 5FPEA 3EYZA 5M1QA 3AVKA 4RW8A 2A41A 1NMDA 4DR5K 4FPAA 3CYMA 5DMRA 4ELUA 2VG6A 3F2KA 3AVMA 4BACA 4DU4A 3G6EN 4DQIA 3SLCA 3WNFA 2E2PA 1DGKN 3QEIA 4MLEA 5GADP 4BC4A 2O8BB 1BCOA 3D2FB 5BPNA 3TI0A 1WBBA 5AQIA 2NNWA 1QSLA 4EFHA 4ILGB 5AQJA 4I9LA 4MFBA 4DLGA 3HOTA 2W41A 1W2BM 3MN5A 1W97L 3KKSA 4ZTFA 4FO0A 1NMNA 1S1XA 3AO3A 4RCHA 4CI6A 3THVA 3R1XA 4YOXA 5JS2A 2VG5A 3QFPA 1S9GA 5KI6A 3J7AP 1OVYA 1VQ8N 4JKGB 5MLCQ 1XNRK 2O8EB 3ATUA 4BRGA 2EX3A 2CGKA 2P9SB 4NYFA 1JXBA 4YOWA 4KHYA 4A57A 2O8CB 3DLEA 1BWFO 4LSNA 1A5XA 5IWAK 4DF8A 5AZIA 4KI6A 3O08A 1N6QA 4E1JA 5AQRA 2HOEA 4YOUA 4FM2A 3VGMA 3TWHA 2BTFA 4LF8K 3AAPA 3SUOA 5KGXA 2E1ZA 1A5VA 4AM6A 4HUFA 1VSMA 1Q82O 3KTQA 3FFKB 1UA1A 2HHVA 5FDLA 3OYEA 3H3NO 4JD2B 5F2RA 4GVMA 3ENOA 4PKGA 2BE2A 5BPMA 4HTLA 5CYQA 4CF1A 2DFEA 3VQ5A 2XHBA 2PY5A 5HP1A 3VPZA 4FXDA 1HQUA 3ZETA 1RDAA 2F7TA 4JKCA 3H45C 3QIPA 3EN9A 2HSTA 4CZJA 3WNHA 1VQ5N 3HK2A 1NKEA 4CF0A 2VGNA 3AVLA 2E4LA 4KHWA 2WFBA 4K41A 2HHWA 4CBXA 2FBYA 3AA2A 4CJVA 2AA4A 3NE6A 1A5WA 2P9KB 4DTRA 3M8RA 1N34K 5E26A 2NRHA 4DV3K 5HL7L 4GV9A 3HL8A 4QS9A 3NGYA 3D45A 1KAYA 1U2VB 2W6KA 3AVNA 4DFPA 2J4RA 3OW2M 3JAMO 1T03A 1L3VA 3OYBA 3OYFA 3FZMA 1M1KO 4OGEA 3OYGA 4FJ8A 4O5FA 5AQHA 4OGCA 2ZD1A 4FLXA 4JI8K 3TTCA 2ZGYA 4E7KA 3KLFA 5HBMA 2GX9A 4Z0UA 3CCQN 4MQ3A 1C0TA 1SZ2A 3O4QA 1S1TA 1MWKA 3V9XA 3ZYYX 3J8AA 3LDNA 3NBPA 3OS0A 4Z94A 3CQ8A 1Q86O 4ILHA 3KIOA 5M1OA 1RGIA 3PO4A 5AQWA 1OKJA 3HPGA 3MX5A 3MCAB 3QB0A 4B3MK 4IEEA 3THYA 4BDYA 5GIOA 2OA8A 4Z4EA 5LMNK 1JLQA 5AFUA 4DR3K 3C7NB 1ZBUA 1WUAA 3CERA 3VQBA 1ASVA 5J1EA 1NGBA 4MO5A 1YVNA 4ID1A 2P9IA 3M8SA 1VRTA 1NGDA 3CQXA 3RVCA 1DKGD 3KD5E 4FOEA 3L3UA 3LL3A 4IOAL 3TAQA 3EL2A 3KD1E 1KSPA 5J2MA 4CHYA 1BG3A 1LWEA 4A5BA 4CZKA 2RPIA 2D0OA 1U48A 3KLGA 2JWLA 2ASPA 2NRXA 2IAJA 4X64K 1WSEA 3QBWA 2Q1NA 3VQ7A 2P5GA 3LZIA 2F8SA 4CF8A 3AA4A 3G25A 4CF2A 3IFRA 1ZBLA 4UY8O 3D0PA 1M90O 2O8EA 2GTDA 4NLCA 5AQYA 2HNYA 2F9WA 2BUPA 1W0HA 3CM5A 2P9SA 1XMQK 4KREA 1Z6RA 3TSPA 1HNZK 5AQPA 1K8AO 2F8TA 4CFBA 1TVRA 4WFNL 4CD1A 4B1YB 4FLYA 2X78A 3VEVA 2HF4A 4B3SK 4GNIA 1FKOA 3LP2A 3SCXA 1L5UA 3QNNA 3T3FA 3AVJA 5C25A 4H8KA 5HRPA 2OYQA 4G1QA 3SQ2A 4KI4A 3VMFB 2WONA 4Z4GA 1NGJA 4DR7K 1BI4B 2FF3B 2I7PA 4OJRA 1VQ9N 5AQMA 3MK6A 2OTLN 1Y97A 1IBMK 4G9ZA 1HNVA 1NWKA 1JLFA 3OYCA 2XY5A 2X6SA 2IVNA 3L2VA 3EY1A 3WQUA 4JI4K 1C0MA 3TR8A 3TAEA 3BUZB 4B9SA 4CJWA 4XH5A 4JK8A 3G0ZA 4CK3A 1WSGA 4LFCK 4QCLA 5HOOA 1S22A 1W9HA 3AGRA 4IDHA 1N33K 2HHUA 2P9KA 5AFUH 4A62A 2R7YA 3KZBA 4M41A 3M8QA 3K2PA 5AQTA 4PHTX 3CCJN 2KW4A 2KTQA 1VQMN 3MN7A 3C6HA 4BVOA 3OYKA 1HKCA 1VSJA 4E89A 4XH4A 3V6DA 2Y1IA 2YX6A 4RW4A 3PY8A 2CH5A 4DTJA 3V81A 3AVFA 1IO2A 1TUUA 5BN8A 4DQQA 2NZTA 2O4IA 4FJIA 4FLUA 4CBUA 4LFAK 4FK4A 3PV8A 1KRPA 4QS8A 1JCGA 3P38A 2IVOA 4DU1A 4KHUA 2FSKA 3O4NA 3UB5A 3NH1A 2NRWA 4DV5K 1VSKA 1XHXA 2A1SA 3LWMA 3U3GA 3S3MA 1RCHA 4V19S 3SUQA 2E5LK 5M1FA 4CJUA 3GBTA 3MECA 3DRSA 3CC4N 4BWJA 2O8DB 2YJFA 4GV3A 3T1HK 1NK8A 4R79A 1VSFA 3BF3A 3ZT4A 3NF6A 3DAWA 1RTIA 1UAXA 1WSJA 4Y0WA 4BRPA 3SBGA 3O1WA 3RSEB 4LH4A 3I56N 4FOIA 4PUOA 3SAHA 3IRXA 2VWJA 3MWPA 1VAZA 4FM0A 2KFNA 3O9SA 1GLEG 3QETA 3OYDA 3UKRB 3O80A 1U6ZA 1Q9YA 4CZMA 3KLIA 1ZBSA 3AV9A 3D7EO 4OPHA 2KKZA 4H5WA 1E4FT 1KQSM 4IG0A 1IH7A 1X3MA 2ASOA 4CJEA 4X62K 4FLWA 4B1UB 2KZMA 1XUPO 2PYJA 3VQAA 3HI0A 4DTSA 4FZYA 4KKOA 4FPBA 3O3FA 4M3WA 3HOSA 2BGGA 1OVQA 3DRRA 3ATVA 1EO1A 3TSUA 3SUPA 5F1XA 4CGHA 2P9PB 3SNNA 2E1YA 4CIGA 1XI1A 3HJFA 2Q2RA 1TKZA 1JLEA 5J2NA 3F73A 3CCVN 1NGEA 1KVBA 3NMUA 1TGOA 1EXQA 4OKEA 2WTUA 3SV3A 1J9AA 4CGDA 3PX0A 1RT2A 1WNSA 3DLLL 2QK9A 3CC7N 2EHGA 3THXB 4X66K 2HHHK 4BR2A 4DQ8A 3I55N 4B1ZA 4IBNA 5FPMA 2YKMA 2VWKA 3IAYA 4CJLA 2OPRA 4FWOA 4WF9L 4FWSA 2GBZA 2YNGA 3H1QA 1KC8O 2F96A 2I5JA 5K14A 4C8OA 5HRSA 5M1KA 1NGCA 1UOCA 3TAGA 4DSIA 1NNEA 3RTVA 1HMVA 1BA1A 3ZX0A 3K58A 4AQYK 4U67L 2OZMA 4M63C 3ZSZA 3S3OA 1IV0A 4H0VB 4IZ9A 2D4WA 1C1BA 1NK5A 4KH4A 1SKWA 4EHTA 1YT3A 2QWOA 1E4GT 3FLCO 4GKJK 1C0GA 1TV6A 2A40A 4BRDA 2YV0X 3EKUA 1FXXA 3JS6A 3CCRN 2OANA 2UUAK 1YITN 3ZEUA 4XEIA 4DQPA 2VQFK 3L6QA 5BRDA 1B92A 4C8NA 4F3TA 4CJKA 4ZTJA 3GDQA 3NGIA 2UU9K 3MXIA 4H0TB 4DSFA 2I7NA 1RFQA 3LM9A 3TTFA 4KTWA 2BH1A 2QWRA 1EX4A 1HYZA 3QLHA 1QHAA 3CFOA 4LFBK 4DCHA 1NGFA 4IDKA 3C6UA 4FJ5A 1QTMA 2XY7A 1TYQB 3HTVA 1LCUA 3GE1A 3SPZA 4DV0K 3ZSOA 2GWKA 2IOCA 3VN5A 1ZYQA 5J2PA 5BREA 5AQQA 3AGKA 4CFAA 2A6AA 2P9NB 1I3AA 1KXPA 3LDQA 3HXMA 4DV1K 2JLEA 3UKUA 4FCYA 3VTHA 3MEEA 4W5RA
chains in the Genus database with same CATH topology
3OS1A 4B8CA 1HJRA 4KO0A 3HL8A 5HRRA 3BDPA 1GOCA 3JSMA 3NGYA 3L2QA 3D45A 1RT5A 1TAUA 4XIUA 2OZSA 3AVNA 4R5PA 4CJ5A 3MXJA 4DFPA 4CJ4A 1T03A 1L3VA 1NOZA 4L8RB 3OYBA 4KHNA 1JLBA 3AVAA 4NCBA 4W5TA 3KKRA 4DMNA 2FBVA 3OYFA 4OGEA 4FLZA 3OYGA 2PYLA 4J2EA 3ZSVA 4FJ8A 4PQUA 1VRUA 3V9UA 1BIZA 4AHRA 3BGRA 4OGCA 2G8FA 3LAMA 3RWUA 4M3ZA 2ZD1A 4FLXA 4DS4A 4ELTA 3HO1A 1JKHA 4FVMA 2HVIA 2YNIA 1RBSA 4NCAA 1LAWA 4DS5A 4J2DA 5CZ1A 5T7BA 4E7KA 2WOMA 1S1UA 1JXEA 2YKNA 3B6PA 3MEGA 4FW1A 5HBMA 4W5QA 1RBVA 3KLFA 3OVNA 3SV4A 3RMCA 4Z0UA 1QQCA 4O0IA 2OPQA 3QEPA 4MQ3A 3OYNA 1UA0A 2KFZA 3QIOA 1C0TA 3O4QA 1S1TA 1CZ9A 4I2QA 3V9XA 3QEWA 1LAVA 2RN2A 4CEBA 4W5NA 2HHSA 3NBPA 3C94A 3NAEA 2G8UA 4CHNA 3OS0A 4IFVA 3VQ6A 3AVIA 1FK9A 4DWIA 3CQ8A 2AJQA 4IKFA 1NJYA 1KVCA 3QO9A 1UWBA 2ATQA 3KIOA 2IDOA 3OJUA 3PO4A 3AO4A 3HPGA 1KLNA 2P5OA 5KRSA 3ZT3A 1NOYA 5J2QA 3P1GA 1VSEA 4JLHA 4M3UA 2YNFA 2HNDA 2QXFA 4LH5A 4CEAA 4E0DA 4BDYA 2Q3SA 4CJ3A 1U49A 4N47A 3AA5X 4FZXC 4HCCA 1S9EA 3NHGA 3SPYA 1ZBFA 4RW7A 2OA8A 4Z4EA 3L8BA 1JLQA 4KV8A 4KB1A 2HVHA 1HYSA 2XY6A 1ZBUA 4DTMA 4OKKA 4FLTA 3ZSQA 3I0SA 1L3UA 3KJVA 1BI4A 4J2AA 2DFFA 2E6LA 2RKIA 3L3VA 2P51A 1ASVA 1D5AA 1TKXA 2D0AA 3VQBA 4ID5A 4YFUA 1ITGA 1T05A 2QKKA 4HCBA 4EZ9A 1SL2A 4KTZA 2NUBA 3LP0A 5J1EA 1KFSA 4DFKA 3TAFA 3MXMA 1T7PA 4DSLA 4ID1A 4CEOA 3ZT0A 1GOAA 3VQDA 3VQ8A 3ZCMA 3F9KA 5E41A 3IS9A 3M8SA 5FRMA 1ZBHA 3RRGA 4DU3A 1LW0A 1VRTA 4TSXA 4AHCA 1NK6A 4C8LA 3LPUA 4CJTA 4O44A 3K5NA 1BGXT 4CJFA 4CGJA 1DTTA 1LWFA 1KLMA 3KD5E 3L3UA 2KQ2A 3I0RA 3TAQA 2E6MA 3KD1E 3KK1A 1KSPA 4J2BA 2Z1HA 5J2MA 1LV5A 4CHYA 3K57A 4OPKA 1RT3A 4I9QA 4FJNA 1LWEA 2ZE2A 4FM1A 3K5LA 1X9WA 1RBRA 2IS3A 1RNHA 4B9MA 1SV5A 2RPIA 4BE0A 3LWLA 1RDDA 2B6AA 4JS4A 1U48A 3DM2A 3KLGA 4B3OA 1HPZA 4BWMA 2IAJA 1I39A 4B9VA 3HM9A 4M42A 3AVCA 4DTUA 1WSEA 3VQ7A 3MAQA 2RF2A 1REVA 2P5GA 4E7JA 3QINA 3LDSA 3ZSXA 3LZIA 4NYNA 4JS5A 4DTOA 3VQ9A 2F8SA 1C0UA 1C6VA 1QHTA 3VQEA 4CF8A 3NF9A 3AA4A 3VQQA 3V1QA 4CF2A 4DSEA 4B9UA 2FBXA 1K6YA 1Q8IA 1ZBLA 4E1NA 4W5OA 5FRNA 3PX4A 4Z4IA 3SZ2A 4RW9A 3D0PA 4PWDA 2HW3A 1C1AA 3LANA 4CGIA 1J5OA 1JLAA 1RT1A 4CJPA 1WSIA 3LALA 3DLHA 1BISA 3PO5A 1WSFA 2HNYA 1RT4A 4AH9A 3DRPA 1W0HA 3CM5A 3DOLA 4CIEA 1N5YA 3SUNA 4KREA 4B9TA 2B4JA 4CIFA 1DTQA 1YTUA 3HVTA 4AHVA 2F8TA 4CFBA 1TVRA 2HHTA 3AO1A 3L2RA 1X9MA 5D3GA 4WE1A 2HB5A 1KVAA 4FLYA 1LW2A 2X78A 5CZ2A 4CESA 1NK9A 1RTJA 1MU2A 1O1WA 4CECA 1NKCA 2ZQBA 1FKOA 4HVJA 1NKBA 3LP2A 3SCXA 1YTAA 3NCIA 3QNNA 1L5UA 1WAJA 3T3FA 3AVJA 5C25A 4H8KA 5HRPA 4IFYA 2OYQA 4G1QA 1LWCA 4E19A 3OY9A 3OJSA 3U6FA 3SQ2A 3UIQA 3DYAA 3KK3A 4EP5A 4KI4A 4B08A 2WONA 3HSTB 4CEDA 4Z4GA 4DQSA 4BE2A 1KCFA 1BI4B 4OJRA 5C24A 3ZT2A 4CJSA 2W42A 4BDPA 3QERA 1Y97A 1TK8A 1HNVA 4H4MA 3V9SA 4KTQA 5I42A 2Z1IA 1JLFA 3HT3A 4DQRA 1VSIA 3SJJA 4KFBA 1SL1A 1SL0A 1IG9A 3A2FA 3OYCA 1TK5A 2XY5A 1IKWA 2X6SA 4NCGA 3L2VA 4CHOA 2G8KA 4HUEA 3EY1A 3OYIA 4JRQA 1C0MA 3TR8A 4CGGA 1U4BA 3ZSWA 3TAEA 3EZ5A 4Q0BA 2G8IA 3ALYA 3K5MA 2G8HA 4B9SA 4CJWA 4M3TA 1IKYA 3G0ZA 4CK3A 1WSGA 3SI6A 1IKVA 3FFIA 3SYZA 4QCLA 3DMJA 4AHUA 4K8ZA 1S6QA 1W9HA 1X1PA 4QOZB 4ICLA 4HTUA 2HHUA 5SZTA 2HHQA 1EP4A 2LSNA 5KTQA 2FC0A 1RILA 3QNOA 4DG1A 4C8KA 3KLEA 1HNIA 4M3XA 2X6NA 3S3NA 3LAKA 2R7YA 4H4OA 3ITHA 4M41A 2XRIA 3M8QA 4FW2A 1FKPA 1G15A 3K2PA 1SKSA 2KW4A 2KTQA 4F2SA 4HHTA 3V4IA 3OYKA 2DFHA 4Z4HA 1VSHA 3NF7A 2X74A 2XO7A 1VSJA 4E89A 3CFRA 5HLFA 4LD0A 1Q9XA 1Z25A 3V6DA 2Y1IA 4BE1A 4CFDA 4LSLA 1TAQA 3IG1A 3V1OA 4RW4A 3PY8A 3E01A 3ZT1A 3HP6A 1WLJA 4CEQA 2HHVA 1BHLA 3DI6A 2YNHA 4DTJA 1CZBA 4O4GA 3V81A 3AVFA 2KZZA 1IO2A 4CK1A 1RT7A 4DQQA 3O3GA 2OPSA 1HRHA 5HRNA 1BCMA 4PY5A 4KHQA 4DSKA 1JLCA 1BIUA 2HNZA 1RT6A 2O4IA 4FJIA 2P1JA 3HPOA 4BDZA 4FLUA 4FK4A 3NH0A 4FJJA 4AHSA 3PV8A 3NFAA 1KRPA 1TKDA 1B9FA 1HQEA 2HHXA 2D5RA 4DTPA 3PUFA 1KFDA 4CEFA 3LZJA 4DU1A 3U3YA 4KHUA 3O4NA 3NH1A 4FLVA 4FJ9A 1TL3A 3VQPA 4FZZA 4PA1A 4N5SA 4LY7A 4GW6A 1VSKA 1XHXA 2A1SA 4UQGA 4DTXA 4DFMA 3OS2A 4QAGA 3LWMA 3U3GA 1QS4A 1RCHA 4I7FA 3S3MA 1XC9A 4FJXA 5FROA 3SUQA 3DLRA 4E1MA 4C8MA 4CHQA 3OYAA 1WSHA 4CJUA 3MECA 3DRSA 3LPTA 3I8DA 3V1RA 4BWJA 3VA3A 1JLGA 1S1VA 3OYLA 4I2PA 1WAFA 3RMAA 5SWMA 4JRPA 1RDCA 4M3RA 1NK8A 4FJLA 1VSFA 3ZT4A 3NF6A 4E7IA 4AILC 3AVBA 1RTIA 1UAXA 4N41A 1ZBIA 1WSJA 4FJKA 4M3YA 4CF9A 3VA0A 3KK2A 3L2WA 3RRHA 4KRFA 4ZHRA 2XY8A 4LH4A 1WN7A 1R0AA 4F2RA 4PUOA 2Z1JA 1D8YA 1ASUA 3IRXA 3NF8A 4RW6A 4N56A 2VWJA 2YHAA 4Y1CA 2GV9A 3B6OA 1VK0A 4HUGA 4FM0A 3AO5A 2KFNA 3AA3A 2BDPA 1J54A 3CM6A 1Z26A 3TAMA 4KB0A 1DLOA 2A1RA 4Z4CA 3HYFA 3SQ1A 1JL1A 1XHZA 2QKBA 2YHBA 4FJMA 4IG3A 1F21A 3QETA 3OYDA 1S1WA 1Q9YA 3KLIA 2ETJA 2OPPA 3AV9A 3DLGA 5CYMA 3NH2A 3RMDA 3OYMA 3OYJA 2FBTA 1IH7A 3P5JA 1CXUA 1TL1A 4IG0A 3T1AA 4CJEA 4FLWA 2ITGA 4CJRA 1RTHA 4F3OA 3HPHA 4ELVA 4YNQA 4OPJA 3O3HA 1JL2A 1KTQA 3EYZA 2Y1JA 3VQCA 1SKRA 2PYJA 1RDBA 3VQAA 2KZMA 3AVKA 4RW8A 1BQMA 4CEZA 4DTSA 1QSSA 4FZYA 3CYMA 3V9ZA 5DK5A 5EU7A 4F8RA 4KKOA 5DMRA 4ELUA 3RR7A 1S5JA 1CLQA 2VG6A 3AVMA 4BACA 4DU4A 3O3FA 4M3WA 2BGGA 1VSLA 3DRRA 1BL3A 3T19A 5C42A 3SUPA 1RTDA 4DQIA 2HMIA 4CGHA 3WNFA 4GMJB 3SNNA 3AVGA 4CIGA 4RG8A 4O0JA 1XI1A 4FK0A 3HJFA 2GUIA 3LP3A 3TAPA 3QEIA 1TKZA 1BCOA 1JLEA 1GOBA 4O5BA 5J2NA 3TI0A 1NJWA 4N76A 1HYVA 3F73A 3DOKA 3P83D 4OKJA 3TANA 3QESA 1D9FA 1SUQA 1QSLA 1KVBA 4I9LA 4MFBA 4DLGA 3K5OA 1TGOA 3PX6A 4B9NA 1EXQA 4OKEA 1L3TA 3KKSA 4Y1DA 4DTNA 3SV3A 1J9AA 4CGDA 3PX0A 4ZTFA 1U47A 1NK4A 1RT2A 4E3SA 1WNSA 3H08A 1S1XA 3CG7A 3RMBA 3HVRA 2QK9A 1RBTA 3AO3A 3THVA 4CERA 2EHGA 3C95A 5JS2A 2VG5A 4OLBA 5JS1A 1S9GA 5KI6A 4IBNA 2IC3A 3SQ4A 3LP1A 2YKMA 3M8PA 3TARA 2VWKA 3IAYA 4CJLA 1NK7A 1X9SA 1EETA 2OPRA 1L3SA 1NK0A 2GBZA 2YNGA 1XWLA 2F96A 2I5JA 2O4GA 3CFPA 5K14A 1IKXA 4C8OA 2DTUA 4DLEA 5HRSA 2EX3A 4EZ6A 1UOCA 3TAGA 1T8EA 3ZSYA 4CHPA 3SQ0A 4DSIA 4NYFA 3RTVA 4DFJA 1BQNA 1C1CA 1HMVA 1JXBA 1CXQA 4M45A 4KHYA 3DLKA 3DLEA 4LSNA 1A5XA 3K58A 4O55A 4DF8A 1EKEA 3JYTA 4FJHA 4KI6A 3K59A 1N6QA 2OZMA 3ZSZA 3S3OA 4Z4FA 4FM2A 3KLHA 3TWHA 5CY4A 1C1BA 3AVHA 4CFCA 1NK5A 4FYDA 1QSYA 3SUOA 2D0BA 2IGIA 1SKWA 4F4KA 5KGXA 4E7LA 1YT3A 1ASWA 4CCHA 2PZSA 5KRTA 1D9DA 1TV6A 4K8XA 4KAZA 1A5VA 2YV0X 4CE9A 4E7HA 1FXXA 4KPYA 3C6TA 4HUFA 1VSMA 4KHSA 1YVUA 4DQPA 2D0CA 4CGFA 4EP4A 3V9WA 3VQ4A 4Q5VA 3KTQA 1B92A 4C8NA 1UA1A 4CJKA 5FDLA 3OYEA 3OYHA 4ZTJA 4FJ7A 4F3TA 2BANA 3ZSRA 4B8AB 3NGIA 3MXIA 2G8WA 4GVMA 4DSFA 3TABA 2BE2A 3QEXA 4FK2A 5CYQA 4CF1A 3S9HA 2DFEA 4DF4A 3VQ5A 1NJXA 4KTWA 3MEDA 2XHBA 2PY5A 2DY4A 5HP1A 2VG7A 4FXDA 1EX4A 1HQUA 5KGWA 1HYZA 2JGUA 3QLHA 4OVLA 3CFOA 1RDAA 3L2UA 1U04A 5HROA 1NJZA 3HP9A 4FJGA 3NDKA 2B5JA 4IDKA 4CHZA 5I3UA 4DSJA 3C6UA 4FJ5A 1QTMA 3QIPA 1VSDA 3ISNC 2XY7A 4OLAA 1J53A 2G8VA 1B9DA 3WNHA 3HK2A 4CK2A 3SPZA 4AHTA 4CF0A 1NKEA 3AO2A 3ULDA 3AVLA 1S6PA 2E4LA 3ZSOA 3RR8A 4KHWA 2HHWA 2FBYA 3AA2A 2IOCA 3VN5A 1ZYQA 3WNGA 5J2PA 3NGZA 4CJVA 4B9LA 2Z1GA 3NE6A 4CFAA 1A5WA 1RBUA 4CJQA 1U45A 3G10A 3DLBA 1I3AA 3HXMA 1TK0A 4DTRA 3M8RA 4CEEA 2JLEA 3ASMA 3WNEA 3QEVA 4FCYA 1TKTA 1QE1A 3MEEA 4W5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OS1 A;  4B8C A;  1HJR A;  4KO0 A;  3HL8 A;  5HRR A;  3BDP A;  1GOC A;  3JSM A;  3NGY A;  3L2Q A;  3D45 A;  1RT5 A;  1TAU A;  4XIU A;  2OZS A;  3AVN A;  4R5P A;  4CJ5 A;  3MXJ A;  4DFP A;  4CJ4 A;  1T03 A;  1L3V A;  1NOZ A;  4L8R B;  3OYB A;  4KHN A;  1JLB A;  3AVA A;  4NCB A;  4W5T A;  3KKR A;  4DMN A;  2FBV A;  3OYF A;  4OGE A;  4FLZ A;  3OYG A;  2PYL A;  4J2E A;  3ZSV A;  4FJ8 A;  4PQU A;  1VRU A;  3V9U A;  1BIZ A;  4AHR A;  3BGR A;  4OGC A;  2G8F A;  3LAM A;  3RWU A;  4M3Z A;  2ZD1 A;  4FLX A;  4DS4 A;  4ELT A;  3HO1 A;  1JKH A;  4FVM A;  2HVI A;  2YNI A;  1RBS A;  4NCA A;  1LAW A;  4DS5 A;  4J2D A;  5CZ1 A;  5T7B A;  4E7K A;  2WOM A;  1S1U A;  1JXE A;  2YKN A;  3B6P A;  3MEG A;  4FW1 A;  5HBM A;  4W5Q A;  1RBV A;  3KLF A;  3OVN A;  3SV4 A;  3RMC A;  4Z0U A;  1QQC A;  4O0I A;  2OPQ A;  3QEP A;  4MQ3 A;  3OYN A;  1UA0 A;  2KFZ A;  3QIO A;  1C0T A;  3O4Q A;  1S1T A;  1CZ9 A;  4I2Q A;  3V9X A;  3QEW A;  1LAV A;  2RN2 A;  4CEB A;  4W5N A;  2HHS A;  3NBP A;  3C94 A;  3NAE A;  2G8U A;  4CHN A;  3OS0 A;  4IFV A;  3VQ6 A;  3AVI A;  1FK9 A;  4DWI A;  3CQ8 A;  2AJQ A;  4IKF A;  1NJY A;  1KVC A;  3QO9 A;  1UWB A;  2ATQ A;  3KIO A;  2IDO A;  3OJU A;  3PO4 A;  3AO4 A;  3HPG A;  1KLN A;  2P5O A;  5KRS A;  3ZT3 A;  1NOY A;  5J2Q A;  3P1G A;  1VSE A;  4JLH A;  4M3U A;  2YNF A;  2HND A;  2QXF A;  4LH5 A;  4CEA A;  4E0D A;  4BDY A;  2Q3S A;  4CJ3 A;  1U49 A;  4N47 A;  3AA5 X;  4FZX C;  4HCC A;  1S9E A;  3NHG A;  3SPY A;  1ZBF A;  4RW7 A;  2OA8 A;  4Z4E A;  3L8B A;  1JLQ A;  4KV8 A;  4KB1 A;  2HVH A;  1HYS A;  2XY6 A;  1ZBU A;  4DTM A;  4OKK A;  4FLT A;  3ZSQ A;  3I0S A;  1L3U A;  3KJV A;  1BI4 A;  4J2A A;  2DFF A;  2E6L A;  2RKI A;  3L3V A;  2P51 A;  1ASV A;  1D5A A;  1TKX A;  2D0A A;  3VQB A;  4ID5 A;  4YFU A;  1ITG A;  1T05 A;  2QKK A;  4HCB A;  4EZ9 A;  1SL2 A;  4KTZ A;  2NUB A;  3LP0 A;  5J1E A;  1KFS A;  4DFK A;  3TAF A;  3MXM A;  1T7P A;  4DSL A;  4ID1 A;  4CEO A;  3ZT0 A;  1GOA A;  3VQD A;  3VQ8 A;  3ZCM A;  3F9K A;  5E41 A;  3IS9 A;  3M8S A;  5FRM A;  1ZBH A;  3RRG A;  4DU3 A;  1LW0 A;  1VRT A;  4TSX A;  4AHC A;  1NK6 A;  4C8L A;  3LPU A;  4CJT A;  4O44 A;  3K5N A;  1BGX T;  4CJF A;  4CGJ A;  1DTT A;  1LWF A;  1KLM A;  3KD5 E;  3L3U A;  2KQ2 A;  3I0R A;  3TAQ A;  2E6M A;  3KD1 E;  3KK1 A;  1KSP A;  4J2B A;  2Z1H A;  5J2M A;  1LV5 A;  4CHY A;  3K57 A;  4OPK A;  1RT3 A;  4I9Q A;  4FJN A;  1LWE A;  2ZE2 A;  4FM1 A;  3K5L A;  1X9W A;  1RBR A;  2IS3 A;  1RNH A;  4B9M A;  1SV5 A;  2RPI A;  4BE0 A;  3LWL A;  1RDD A;  2B6A A;  4JS4 A;  1U48 A;  3DM2 A;  3KLG A;  4B3O A;  1HPZ A;  4BWM A;  2IAJ A;  1I39 A;  4B9V A;  3HM9 A;  4M42 A;  3AVC A;  4DTU A;  1WSE A;  3VQ7 A;  3MAQ A;  2RF2 A;  1REV A;  2P5G A;  4E7J A;  3QIN A;  3LDS A;  3ZSX A;  3LZI A;  4NYN A;  4JS5 A;  4DTO A;  3VQ9 A;  2F8S A;  1C0U A;  1C6V A;  1QHT A;  3VQE A;  4CF8 A;  3NF9 A;  3AA4 A;  3VQQ A;  3V1Q A;  4CF2 A;  4DSE A;  4B9U A;  2FBX A;  1K6Y A;  1Q8I A;  1ZBL A;  4E1N A;  4W5O A;  5FRN A;  3PX4 A;  4Z4I A;  3SZ2 A;  4RW9 A;  3D0P A;  4PWD A;  2HW3 A;  1C1A A;  3LAN A;  4CGI A;  1J5O A;  1JLA A;  1RT1 A;  4CJP A;  1WSI A;  3LAL A;  3DLH A;  1BIS A;  3PO5 A;  1WSF A;  2HNY A;  1RT4 A;  4AH9 A;  3DRP A;  1W0H A;  3CM5 A;  3DOL A;  4CIE A;  1N5Y A;  3SUN A;  4KRE A;  4B9T A;  2B4J A;  4CIF A;  1DTQ A;  1YTU A;  3HVT A;  4AHV A;  2F8T A;  4CFB A;  1TVR A;  2HHT A;  3AO1 A;  3L2R A;  1X9M A;  5D3G A;  4WE1 A;  2HB5 A;  1KVA A;  4FLY A;  1LW2 A;  2X78 A;  5CZ2 A;  4CES A;  1NK9 A;  1RTJ A;  1MU2 A;  1O1W A;  4CEC A;  1NKC A;  2ZQB A;  1FKO A;  4HVJ A;  1NKB A;  3LP2 A;  3SCX A;  1YTA A;  3NCI A;  3QNN A;  1L5U A;  1WAJ A;  3T3F A;  3AVJ A;  5C25 A;  4H8K A;  5HRP A;  4IFY A;  2OYQ A;  4G1Q A;  1LWC A;  4E19 A;  3OY9 A;  3OJS A;  3U6F A;  3SQ2 A;  3UIQ A;  3DYA A;  3KK3 A;  4EP5 A;  4KI4 A;  4B08 A;  2WON A;  3HST B;  4CED A;  4Z4G A;  4DQS A;  4BE2 A;  1KCF A;  1BI4 B;  4OJR A;  5C24 A;  3ZT2 A;  4CJS A;  2W42 A;  4BDP A;  3QER A;  1Y97 A;  1TK8 A;  1HNV A;  4H4M A;  3V9S A;  4KTQ A;  5I42 A;  2Z1I A;  1JLF A;  3HT3 A;  4DQR A;  1VSI A;  3SJJ A;  4KFB A;  1SL1 A;  1SL0 A;  1IG9 A;  3A2F A;  3OYC A;  1TK5 A;  2XY5 A;  1IKW A;  2X6S A;  4NCG A;  3L2V A;  4CHO A;  2G8K A;  4HUE A;  3EY1 A;  3OYI A;  4JRQ A;  1C0M A;  3TR8 A;  4CGG A;  1U4B A;  3ZSW A;  3TAE A;  3EZ5 A;  4Q0B A;  2G8I A;  3ALY A;  3K5M A;  2G8H A;  4B9S A;  4CJW A;  4M3T A;  1IKY A;  3G0Z A;  4CK3 A;  1WSG A;  3SI6 A;  1IKV A;  3FFI A;  3SYZ A;  4QCL A;  3DMJ A;  4AHU A;  4K8Z A;  1S6Q A;  1W9H A;  1X1P A;  4QOZ B;  4ICL A;  4HTU A;  2HHU A;  5SZT A;  2HHQ A;  1EP4 A;  2LSN A;  5KTQ A;  2FC0 A;  1RIL A;  3QNO A;  4DG1 A;  4C8K A;  3KLE A;  1HNI A;  4M3X A;  2X6N A;  3S3N A;  3LAK A;  2R7Y A;  4H4O A;  3ITH A;  4M41 A;  2XRI A;  3M8Q A;  4FW2 A;  1FKP A;  1G15 A;  3K2P A;  1SKS A;  2KW4 A;  2KTQ A;  4F2S A;  4HHT A;  3V4I A;  3OYK A;  2DFH A;  4Z4H A;  1VSH A;  3NF7 A;  2X74 A;  2XO7 A;  1VSJ A;  4E89 A;  3CFR A;  5HLF A;  4LD0 A;  1Q9X A;  1Z25 A;  3V6D A;  2Y1I A;  4BE1 A;  4CFD A;  4LSL A;  1TAQ A;  3IG1 A;  3V1O A;  4RW4 A;  3PY8 A;  3E01 A;  3ZT1 A;  3HP6 A;  1WLJ A;  4CEQ A;  2HHV A;  1BHL A;  3DI6 A;  2YNH A;  4DTJ A;  1CZB A;  4O4G A;  3V81 A;  3AVF A;  2KZZ A;  1IO2 A;  4CK1 A;  1RT7 A;  4DQQ A;  3O3G A;  2OPS A;  1HRH A;  5HRN A;  1BCM A;  4PY5 A;  4KHQ A;  4DSK A;  1JLC A;  1BIU A;  2HNZ A;  1RT6 A;  2O4I A;  4FJI A;  2P1J A;  3HPO A;  4BDZ A;  4FLU A;  4FK4 A;  3NH0 A;  4FJJ A;  4AHS A;  3PV8 A;  3NFA A;  1KRP A;  1TKD A;  1B9F A;  1HQE A;  2HHX A;  2D5R A;  4DTP A;  3PUF A;  1KFD A;  4CEF A;  3LZJ A;  4DU1 A;  3U3Y A;  4KHU A;  3O4N A;  3NH1 A;  4FLV A;  4FJ9 A;  1TL3 A;  3VQP A;  4FZZ A;  4PA1 A;  4N5S A;  4LY7 A;  4GW6 A;  1VSK A;  1XHX A;  2A1S A;  4UQG A;  4DTX A;  4DFM A;  3OS2 A;  4QAG A;  3LWM A;  3U3G A;  1QS4 A;  1RCH A;  4I7F A;  3S3M A;  1XC9 A;  4FJX A;  5FRO A;  3SUQ A;  3DLR A;  4E1M A;  4C8M A;  4CHQ A;  3OYA A;  1WSH A;  4CJU A;  3MEC A;  3DRS A;  3LPT A;  3I8D A;  3V1R A;  4BWJ A;  3VA3 A;  1JLG A;  1S1V A;  3OYL A;  4I2P A;  1WAF A;  3RMA A;  5SWM A;  4JRP A;  1RDC A;  4M3R A;  1NK8 A;  4FJL A;  1VSF A;  3ZT4 A;  3NF6 A;  4E7I A;  4AIL C;  3AVB A;  1RTI A;  1UAX A;  4N41 A;  1ZBI A;  1WSJ A;  4FJK A;  4M3Y A;  4CF9 A;  3VA0 A;  3KK2 A;  3L2W A;  3RRH A;  4KRF A;  4ZHR A;  2XY8 A;  4LH4 A;  1WN7 A;  1R0A A;  4F2R A;  4PUO A;  2Z1J A;  1D8Y A;  1ASU A;  3IRX A;  3NF8 A;  4RW6 A;  4N56 A;  2VWJ A;  2YHA A;  4Y1C A;  2GV9 A;  3B6O A;  1VK0 A;  4HUG A;  4FM0 A;  3AO5 A;  2KFN A;  3AA3 A;  2BDP A;  1J54 A;  3CM6 A;  1Z26 A;  3TAM A;  4KB0 A;  1DLO A;  2A1R A;  4Z4C A;  3HYF A;  3SQ1 A;  1JL1 A;  1XHZ A;  2QKB A;  2YHB A;  4FJM A;  4IG3 A;  1F21 A;  3QET A;  3OYD A;  1S1W A;  1Q9Y A;  3KLI A;  2ETJ A;  2OPP A;  3AV9 A;  3DLG A;  5CYM A;  3NH2 A;  3RMD A;  3OYM A;  3OYJ A;  2FBT A;  1IH7 A;  3P5J A;  1CXU A;  1TL1 A;  4IG0 A;  3T1A A;  4CJE A;  4FLW A;  2ITG A;  4CJR A;  1RTH A;  4F3O A;  3HPH A;  4ELV A;  4YNQ A;  4OPJ A;  3O3H A;  1JL2 A;  1KTQ A;  3EYZ A;  2Y1J A;  3VQC A;  1SKR A;  2PYJ A;  1RDB A;  3VQA A;  2KZM A;  3AVK A;  4RW8 A;  1BQM A;  4CEZ A;  4DTS A;  1QSS A;  4FZY A;  3CYM A;  3V9Z A;  5DK5 A;  5EU7 A;  4F8R A;  4KKO A;  5DMR A;  4ELU A;  3RR7 A;  1S5J A;  1CLQ A;  2VG6 A;  3AVM A;  4BAC A;  4DU4 A;  3O3F A;  4M3W A;  2BGG A;  1VSL A;  3DRR A;  1BL3 A;  3T19 A;  5C42 A;  3SUP A;  1RTD A;  4DQI A;  2HMI A;  4CGH A;  3WNF A;  4GMJ B;  3SNN A;  3AVG A;  4CIG A;  4RG8 A;  4O0J A;  1XI1 A;  4FK0 A;  3HJF A;  2GUI A;  3LP3 A;  3TAP A;  3QEI A;  1TKZ A;  1BCO A;  1JLE A;  1GOB A;  4O5B A;  5J2N A;  3TI0 A;  1NJW A;  4N76 A;  1HYV A;  3F73 A;  3DOK A;  3P83 D;  4OKJ A;  3TAN A;  3QES A;  1D9F A;  1SUQ A;  1QSL A;  1KVB A;  4I9L A;  4MFB A;  4DLG A;  3K5O A;  1TGO A;  3PX6 A;  4B9N A;  1EXQ A;  4OKE A;  1L3T A;  3KKS A;  4Y1D A;  4DTN A;  3SV3 A;  1J9A A;  4CGD A;  3PX0 A;  4ZTF A;  1U47 A;  1NK4 A;  1RT2 A;  4E3S A;  1WNS A;  3H08 A;  1S1X A;  3CG7 A;  3RMB A;  3HVR A;  2QK9 A;  1RBT A;  3AO3 A;  3THV A;  4CER A;  2EHG A;  3C95 A;  5JS2 A;  2VG5 A;  4OLB A;  5JS1 A;  1S9G A;  5KI6 A;  4IBN A;  2IC3 A;  3SQ4 A;  3LP1 A;  2YKM A;  3M8P A;  3TAR A;  2VWK A;  3IAY A;  4CJL A;  1NK7 A;  1X9S A;  1EET A;  2OPR A;  1L3S A;  1NK0 A;  2GBZ A;  2YNG A;  1XWL A;  2F96 A;  2I5J A;  2O4G A;  3CFP A;  5K14 A;  1IKX A;  4C8O A;  2DTU A;  4DLE A;  5HRS A;  2EX3 A;  4EZ6 A;  1UOC A;  3TAG A;  1T8E A;  3ZSY A;  4CHP A;  3SQ0 A;  4DSI A;  4NYF A;  3RTV A;  4DFJ A;  1BQN A;  1C1C A;  1HMV A;  1JXB A;  1CXQ A;  4M45 A;  4KHY A;  3DLK A;  3DLE A;  4LSN A;  1A5X A;  3K58 A;  4O55 A;  4DF8 A;  1EKE A;  3JYT A;  4FJH A;  4KI6 A;  3K59 A;  1N6Q A;  2OZM A;  3ZSZ A;  3S3O A;  4Z4F A;  4FM2 A;  3KLH A;  3TWH A;  5CY4 A;  1C1B A;  3AVH A;  4CFC A;  1NK5 A;  4FYD A;  1QSY A;  3SUO A;  2D0B A;  2IGI A;  1SKW A;  4F4K A;  5KGX A;  4E7L A;  1YT3 A;  1ASW A;  4CCH A;  2PZS A;  5KRT A;  1D9D A;  1TV6 A;  4K8X A;  4KAZ A;  1A5V A;  2YV0 X;  4CE9 A;  4E7H A;  1FXX A;  4KPY A;  3C6T A;  4HUF A;  1VSM A;  4KHS A;  1YVU A;  4DQP A;  2D0C A;  4CGF A;  4EP4 A;  3V9W A;  3VQ4 A;  4Q5V A;  3KTQ A;  1B92 A;  4C8N A;  1UA1 A;  4CJK A;  5FDL A;  3OYE A;  3OYH A;  4ZTJ A;  4FJ7 A;  4F3T A;  2BAN A;  3ZSR A;  4B8A B;  3NGI A;  3MXI A;  2G8W A;  4GVM A;  4DSF A;  3TAB A;  2BE2 A;  3QEX A;  4FK2 A;  5CYQ A;  4CF1 A;  3S9H A;  2DFE A;  4DF4 A;  3VQ5 A;  1NJX A;  4KTW A;  3MED A;  2XHB A;  2PY5 A;  2DY4 A;  5HP1 A;  2VG7 A;  4FXD A;  1EX4 A;  1HQU A;  5KGW A;  1HYZ A;  2JGU A;  3QLH A;  4OVL A;  3CFO A;  1RDA A;  3L2U A;  1U04 A;  5HRO A;  1NJZ A;  3HP9 A;  4FJG A;  3NDK A;  2B5J A;  4IDK A;  4CHZ A;  5I3U A;  4DSJ A;  3C6U A;  4FJ5 A;  1QTM A;  3QIP A;  1VSD A;  3ISN C;  2XY7 A;  4OLA A;  1J53 A;  2G8V A;  1B9D A;  3WNH A;  3HK2 A;  4CK2 A;  3SPZ A;  4AHT A;  4CF0 A;  1NKE A;  3AO2 A;  3ULD A;  3AVL A;  1S6P A;  2E4L A;  3ZSO A;  3RR8 A;  4KHW A;  2HHW A;  2FBY A;  3AA2 A;  2IOC A;  3VN5 A;  1ZYQ A;  3WNG A;  5J2P A;  3NGZ A;  4CJV A;  4B9L A;  2Z1G A;  3NE6 A;  4CFA A;  1A5W A;  1RBU A;  4CJQ A;  1U45 A;  3G10 A;  3DLB A;  1I3A A;  3HXM A;  1TK0 A;  4DTR A;  3M8R A;  4CEE A;  2JLE A;  3ASM A;  3WNE A;  3QEV A;  4FCY A;  1TKT A;  1QE1 A;  3MEE A;  4W5R A; 
#chains in the Genus database with same CATH topology
 4M7X A;  1HR0 K;  1HJR A;  5HRR A;  4JK9 A;  4CZI A;  1TAU A;  2QWQ A;  4CZH A;  4XIU A;  3THW B;  3D2E B;  4R5P A;  1VQ4 N;  4O8K A;  2E88 A;  4L8R B;  4DR2 K;  3IDH A;  3AVA A;  4NCB A;  3AAQ A;  3KKR A;  2FBV A;  1X9J A;  3WXK A;  4BR5 A;  2PYL A;  3ZSV A;  1VRU A;  3V9U A;  3T69 A;  1OH6 A;  2Q31 A;  2E2N A;  4FVM A;  2O8D A;  1RBS A;  4NCA A;  1JCF A;  1VQP N;  2OTJ N;  1LAW A;  5C0Y A;  3R3L A;  4J2D A;  4JI3 K;  5T7B A;  1S1U A;  3B6P A;  3FGU A;  4FW1 A;  4W5Q A;  4FJG A;  4CZE A;  3SV4 A;  3QEP A;  5AR0 A;  4O0I A;  2OPQ A;  2KFZ A;  4I2Q A;  3QEW A;  3P31 A;  4CEB A;  4HWI A;  3KWI A;  2HHS A;  3C94 A;  4JV5 K;  2G8U A;  2AJQ A;  3ZX2 A;  1NJY A;  1UWB A;  2IDO A;  1XC3 A;  4H0Y B;  1MA9 B;  4DV6 K;  2V51 B;  1EQY A;  1Y64 A;  3H3O B;  3ZT3 A;  1NOY A;  3P1G A;  2JWK A;  4M3U A;  1WOQ A;  2DPN A;  2YNF A;  2PBD A;  2QXF A;  4CEA A;  3J7Z O;  2Q3S A;  4CJ3 A;  2E20 A;  1MDU B;  3AA5 X;  1S9E A;  5CE3 A;  4JKA A;  4IJN A;  4KB1 A;  2ZF5 O;  1HYS A;  2XY6 A;  4DTM A;  3H1V X;  3I0S A;  3ZSQ A;  3KJV A;  4J2A A;  2E6L A;  4BRQ A;  1HKG A;  4HCB A;  1MWM A;  4EZ9 A;  1SL2 A;  4KTZ A;  2NUB A;  3LP0 A;  1FW6 A;  3MXM A;  3ULE A;  4DSL A;  4BRF A;  4CEO A;  3IUC A;  4WYB A;  1GOA A;  3Q7B A;  4PKI A;  3ZCM A;  3F9K A;  5E41 A;  5AZJ B;  3RRG A;  3BZK A;  5AQV A;  1NLV A;  4CJT A;  2NRZ A;  2P9P A;  4O44 A;  4CJF A;  2RHK A;  2KQ2 A;  3I0R A;  3O9R A;  2Z1H A;  4FJN A;  4O8U A;  2ZE2 A;  3L4I A;  3K5L A;  1X9W A;  1RNH A;  5LMU K;  3DM2 A;  1GLJ O;  4BWM A;  3HM9 A;  3AVC A;  3K9J A;  4JEP A;  5JVG L;  5AQF A;  4JS5 A;  3THX A;  1C0U A;  1C6V A;  3CCU N;  5CR4 A;  1YUW A;  3NF9 A;  1HKB A;  4DSE A;  4B9U A;  5AQK A;  1GLA G;  1SAZ A;  1T44 A;  4E1N A;  3PX4 A;  3SZ2 A;  3F9M A;  2CGJ A;  1J5O A;  1ILY A;  1JLA A;  1RT1 A;  4JK7 A;  3PO5 A;  4CIE A;  3DRP A;  5TKW A;  2NRV A;  3SUN A;  3ENB A;  5EXW A;  1GLB G;  2HBM A;  4J8F A;  4WE1 A;  2HB5 A;  4CES A;  1MU2 A;  4CEC A;  3TSQ A;  4B1W B;  4GKK K;  2F9T A;  1WAJ A;  4IFY A;  4E19 A;  4JAX A;  5E84 A;  3UIQ A;  3DYA A;  3A5O C;  3ENH A;  4DR1 K;  3HST B;  4DQS A;  5C24 A;  3ZT2 A;  5BR9 A;  4BDP A;  3QER A;  4H4M A;  3AY9 A;  2Z1I A;  4CZL A;  4DQR A;  4MO4 A;  3A2F A;  4KH5 A;  1TK5 A;  3G71 N;  1IKW A;  2P9U A;  4NCG A;  4BRE A;  2FSJ A;  2QXL A;  3F5T A;  4NLB A;  2VQE K;  3EZ5 A;  4BR0 A;  4JNE A;  4M3T A;  3GL1 A;  3MN6 A;  3WEE A;  3SI6 A;  3SYZ A;  2QTD A;  3CJA A;  3DMJ A;  5GAG P;  4C23 A;  4JI1 K;  1DT9 A;  2IIR A;  3HRG A;  4ICL A;  1OH5 A;  4LF9 K;  3CPW M;  3WQT A;  5SZT A;  2LSN A;  5KTQ A;  4NXM K;  3QNO A;  4C8K A;  1DEJ A;  4H4O A;  4FW2 A;  5CHI A;  1FKP A;  1G15 A;  5LY3 A;  3DXM B;  4CD3 A;  4HHT A;  1HNX K;  3AAR A;  3QML A;  2Q36 A;  2X74 A;  2XO7 A;  3THW A;  1YF5 L;  3CFR A;  5HLF A;  1Z25 A;  3CCS N;  3CQY A;  4LSL A;  3V1O A;  3E01 A;  3ZT1 A;  2NRR A;  1CZB A;  4O4G A;  4CK1 A;  3WXI A;  3CPE A;  2OPS A;  3CC2 N;  4DSK A;  3EKS A;  2UXC K;  1BIU A;  2HNZ A;  2O8B A;  3HPO A;  4BDZ A;  3D2F A;  2H3G X;  5IT9 O;  3CJ9 A;  1NBW A;  2V52 B;  1HQE A;  2UXD K;  4I6M B;  1VQO N;  3HSC A;  4OX9 K;  3W0L A;  4BC3 A;  4LY7 A;  2Q0U A;  4DFM A;  2IVP A;  3OS2 A;  2GWJ A;  2HBL A;  4I7F A;  4FJX A;  5KPR A;  2V7Y A;  4OPA A;  3VER A;  4IO9 L;  5LL6 Z;  3LPT A;  2WC9 A;  4JKG A;  3SMP A;  3OYL A;  2Q0R A;  4I2P A;  3CET A;  3RMA A;  1GLF O;  1RDC A;  4M3R A;  5M1P A;  5GIN A;  3M5R A;  4C1N I;  2ZJQ L;  5DM6 L;  4M3Y A;  4CF9 A;  3VA0 A;  5GIP A;  3FZH A;  4ZHR A;  1R0A A;  1ATN A;  2O8C A;  2Z1J A;  1ZC6 A;  3NF8 A;  4RW6 A;  4N56 A;  4Y1C A;  2GV9 A;  4HUG A;  1VQ6 N;  1J54 A;  4ISE A;  3CM6 A;  3TAM A;  5AZJ A;  4DKW A;  1DLO A;  4KB0 A;  4Z4C A;  1HJO A;  1JL1 A;  4DB3 A;  3BEX A;  2OPP A;  3OYJ A;  4CW7 B;  4YY3 K;  1TL1 A;  3OBW A;  4JI6 K;  1W7A A;  4JHD B;  2ITG A;  1P90 A;  4ELV A;  4YNQ A;  4JD2 A;  3MWT A;  4CEZ A;  1BQM A;  4KH6 A;  2YHX A;  3V9Z A;  5DK5 A;  5EU7 A;  4BG8 A;  3VTI A;  1VSL A;  3GG4 A;  1BL3 A;  4CBW A;  1J5E K;  2HMI A;  3BF1 A;  3JXU A;  2GUP A;  4RG8 A;  4BRC A;  5TKY A;  4FL9 A;  4FK0 A;  2GUI A;  3TAP A;  4NB4 A;  4O5B A;  5LJW A;  4N76 A;  3ID8 A;  4OKJ A;  1SUQ A;  3VET A;  3DXK B;  3K5O A;  4B9N A;  1EWQ A;  4YOR A;  1KD1 O;  4Y1D A;  4DTN A;  2HBK A;  1NK4 A;  3EZW A;  4E3S A;  4LF4 K;  3CIP A;  2FLO A;  3VEW A;  4FWL A;  4JKF A;  4AM7 A;  4CER A;  4IJA A;  1U2V A;  1Z05 A;  3IMX A;  5JS1 A;  5DM7 L;  5JVH L;  4B9Q A;  5FLX O;  1L3S A;  1EET A;  1NK0 A;  3MX2 A;  1XWL A;  3CFP A;  2DTU A;  1NGG A;  1IKX A;  4CHP A;  4DFJ A;  4FWM A;  1BQN A;  3O5B A;  4O55 A;  3MMV A;  4FJH A;  3K59 A;  5AQU A;  4Z4F A;  3VGL A;  4BRL A;  4IOC L;  1NJI O;  3O6W A;  3AVH A;  1I94 K;  4FYD A;  4BRO A;  4H5R A;  2D0B A;  3SAF A;  3LDL A;  4CCH A;  4A2B A;  2PZS A;  1D9D A;  4K8X A;  4E7H A;  1YJN N;  2O8F B;  4EP4 A;  4Q5V A;  1HUX A;  4FJ7 A;  3VES A;  1P8Z A;  3OYH A;  3BY5 A;  2BAN A;  2G8W A;  3R9P A;  4H5N A;  3S9H A;  1SS6 A;  4DF4 A;  1NJX A;  3N4P A;  3A5N C;  3C7N A;  4CZG A;  2WBN A;  3L2U A;  1U04 A;  3HP9 A;  2YJE A;  3VOV A;  2B5J A;  3A8Y A;  1VSD A;  3ISN C;  3BP8 A;  2P9L B;  4YDU A;  3O8M A;  3AO2 A;  3RR8 A;  1S6P A;  1YHQ N;  2YHY A;  3WNG A;  3NGZ A;  4B9L A;  2Z1G A;  2F4V K;  3J7Y P;  4NO7 A;  2D0P A;  3B8A X;  1RBU A;  4CJQ A;  3G10 A;  3DJC A;  1TK0 A;  3ASM A;  3QEV A;  3SJH A;  3O4W A;  3U8X A;  5F0X A;  3FR0 A;  4BRI A;  3OS1 A;  4KO0 A;  3BDP A;  1GOC A;  3L2Q A;  1RT5 A;  3CHW A;  3QFU A;  2OZS A;  3PIP L;  4CJ5 A;  5LJV A;  4CJ4 A;  3BZC A;  3U9D A;  4DMN A;  4PQU A;  2QWM A;  2QA4 N;  1BIZ A;  3E66 A;  1N36 K;  4EHU A;  4M3Z A;  3LAM A;  4ELT A;  4DS4 A;  1HNW K;  5EVZ A;  1E3M A;  5EX5 A;  1JXE A;  2YKN A;  3MEG A;  4BGA A;  3OVN A;  3HZ6 A;  5AZI B;  3OYN A;  1CZ9 A;  5B8H A;  4W5N A;  3NAE A;  4IFV A;  1FK9 A;  5KQ8 A;  1KVC A;  3QO9 A;  2VCP A;  2A42 A;  1R59 O;  3AO4 A;  1IJJ A;  2PFU A;  4CZF A;  1T6D A;  5KRS A;  4IWV A;  4JLH A;  3O9T A;  2HND A;  1SQK A;  1U49 A;  4N47 A;  4HCC A;  4YDU C;  1KAZ A;  3SPY A;  1ZBF A;  4MDB A;  4RW7 A;  3L8B A;  4RTF D;  3U4L A;  4OKK A;  1QVF M;  4MLH A;  4PL7 A;  1BI4 A;  2DFF A;  4UQG A;  2RKI A;  3CME N;  3ZET B;  5BR8 K;  4YFU A;  1JJ2 M;  4DUY K;  1YTU A;  1ITG A;  1T05 A;  3CJ1 A;  1T7P A;  4DUZ K;  2HMP A;  3I8B A;  2AP1 A;  3MDQ A;  4BR9 A;  4BY9 C;  5JLF A;  3VQD A;  3KVG A;  5FRM A;  1ZBH A;  4DU3 A;  1XMO K;  3D6R A;  3CJC A;  4C8L A;  3LPU A;  5BRH A;  1BGX T;  3CJB A;  3K5N A;  4CGJ A;  1DTT A;  5FPN A;  2E6M A;  4J2B A;  3KK1 A;  3K57 A;  1K8K B;  4FM1 A;  5JIC A;  3CCE N;  2IS3 A;  1SV5 A;  3EO3 A;  1RDD A;  4JS4 A;  3DXK A;  1I39 A;  4YOY A;  1IG8 A;  4B9V A;  3VGK A;  4F9O A;  4JKE A;  4DTU A;  3K0S A;  3MAQ A;  4E7J A;  3QIN A;  3LDS A;  2VGM A;  4DTO A;  3VQE A;  4KBO A;  3VQQ A;  3V1Q A;  4BVP A;  2FBX A;  1K6Y A;  1Q8I A;  3CD6 N;  2VYP A;  4W5O A;  3Q7C A;  4RW9 A;  4PWD A;  1C1A A;  4CGI A;  4YHH K;  4CJP A;  2WUS A;  1K73 O;  3DLH A;  3ID6 A;  2ZJR L;  4GVE A;  1Q18 A;  1WSF A;  1N5Y A;  3DOL A;  1YJ9 N;  4B9T A;  2B4J A;  1DTQ A;  3HVT A;  4AHV A;  5JMV A;  1OH8 A;  2HHT A;  2UUB K;  1GLL O;  3P4I A;  3L2R A;  1X9M A;  3H6E A;  1HLU A;  1KVA A;  1NK9 A;  5CZ2 A;  1RTJ A;  4BQL A;  4FWP A;  4BRM A;  3THY B;  1NKB A;  4FWN A;  1Q81 O;  3DWL A;  3CCL N;  3OJS A;  3U6F A;  2PAV A;  2QWL A;  3KK3 A;  4EP5 A;  4B08 A;  1RDW X;  4CED A;  4BE2 A;  1KCF A;  3MN9 A;  4CJS A;  1TK8 A;  3V9S A;  5I42 A;  3SJJ A;  1SL0 A;  1IG9 A;  2P9I B;  3SAG A;  3RSE A;  2FXU A;  3K9K A;  4CHO A;  2G8K A;  3OYI A;  1N32 K;  5BRF A;  5AQL A;  3ZSW A;  1U4B A;  2G8I A;  3K5M A;  2G8H A;  1IBL K;  2P9L A;  1IKV A;  3FFI A;  3SBT A;  5AQN A;  3VEZ A;  4K8Z A;  1S6Q A;  3QIC A;  3CMA N;  2QEX N;  1J6Z A;  3KK7 A;  3SMS A;  3UKR A;  2HHQ A;  4RWT A;  1EP4 A;  2FC0 A;  1BA0 A;  3L0Q A;  4DG1 A;  1D4X A;  3VEO A;  5BPL A;  2X6N A;  3UE5 A;  1BOT O;  4IEI A;  2DFH A;  4U7B A;  4Z4H A;  3KHY A;  1ESV A;  2ZM6 K;  1Q9X A;  3HBT A;  4LD0 A;  3O9Q A;  4BE1 A;  1WLJ A;  4CEQ A;  3QBX A;  2KZZ A;  3DI6 A;  4YOT A;  2YCH A;  3O3G A;  3S41 A;  3O9U A;  1BCM A;  4JN4 A;  4KHQ A;  1JLC A;  3T1Y K;  1RT6 A;  2P1J A;  1LOT B;  4FJJ A;  5ELZ A;  4AHS A;  3NFA A;  5EY4 A;  1WBD A;  3E1Y A;  1TKD A;  2QI2 A;  2HHX A;  3LM2 A;  4CEF A;  3LZJ A;  3U3Y A;  4JI5 K;  4FLV A;  4FJ9 A;  3VQP A;  4LF5 K;  4FZZ A;  4N5S A;  4BC2 A;  4GW6 A;  4DTX A;  1GLC G;  1RDU A;  3R6M A;  1QS4 A;  1QQM A;  2ZJP L;  5FRO A;  3DLR A;  4E1M A;  3OYA A;  3NVM A;  1YXQ A;  4PKH A;  1JLG A;  1S1V A;  5C12 A;  5AQX A;  5AJ3 K;  5SWM A;  3AVB A;  4N41 A;  1ZBI A;  5AQO A;  3KK2 A;  2A3Z A;  3L2W A;  4JKH A;  4KRF A;  1WN7 A;  5I9E B;  1XQS C;  1D8Y A;  1ASU A;  2V7Z A;  2FF6 A;  2OCE A;  2YHA A;  3AO5 A;  4OO1 J;  4BRH A;  5ADX A;  3VEN A;  1XHZ A;  1F21 A;  1VQL N;  1S1W A;  3C6A A;  3P39 A;  3NH2 A;  4BGB A;  3OYM A;  2CH6 A;  1K8K A;  3A0I X;  3P5J A;  1CXU A;  3T1A A;  4KHP K;  4CJR A;  1RTH A;  4B1V A;  3ZLJ A;  3HPH A;  3O3H A;  1JL2 A;  1KTQ A;  2QWP A;  2Y1J A;  3VQC A;  1SKR A;  1RDB A;  1QSS A;  1YJW N;  4F8R A;  5FPD A;  3L4Q A;  4WFA L;  3RR7 A;  1S5J A;  1CLQ A;  1YI2 N;  3KWG A;  3T19 A;  4EIA A;  5C42 A;  1RTD A;  4GMJ B;  3AVG A;  3O1B A;  4O0J A;  1NU0 A;  1TYQ A;  3LP3 A;  3VEX A;  3J81 O;  4XH1 A;  1GOB A;  3VF4 A;  1NJW A;  4JI7 K;  2YI1 A;  1HYV A;  3DOK A;  3P83 D;  5AQZ A;  3TAN A;  3QES A;  1D9F A;  4GV6 A;  4JKD A;  3PX6 A;  1K9M O;  2QWN A;  2P9N A;  3OTO K;  1L3T A;  1U47 A;  1TUY A;  3H08 A;  3CG7 A;  4ISG A;  3RMB A;  3HVR A;  4FWK A;  1RBT A;  2RE2 A;  3C95 A;  1JCE A;  4OLB A;  3D2E A;  3CXC M;  2IC3 A;  3SQ4 A;  3LP1 A;  2GEL A;  3M8P A;  3TAR A;  4BG9 A;  1NK7 A;  1X9S A;  2O4G A;  2W40 A;  4DLE A;  4EZ6 A;  1YIJ N;  4WQ5 A;  1T8E A;  3ZSY A;  3SQ0 A;  1G99 A;  3CCM N;  1C1C A;  1CXQ A;  4M45 A;  3DLK A;  1NGI A;  1EKE A;  4LF6 K;  3JYT A;  4L3Q A;  1C0F A;  4IOX A;  3KLH A;  5CY4 A;  1VQN N;  4CFC A;  1H1V A;  1QSY A;  2IGI A;  3TU5 A;  2E2O A;  2Q97 A;  1QVG M;  4F4K A;  4E7L A;  4H5T A;  1ASW A;  5KRT A;  4KAZ A;  4CE9 A;  4KPY A;  2A5X A;  3C6T A;  2HBJ A;  2W6L A;  4KHS A;  3VEY A;  1YVU A;  2D0C A;  4CGF A;  3V9W A;  3VQ4 A;  4AF1 A;  3ZSR A;  4B8A B;  3M6G A;  1EWR A;  3TAB A;  3QEX A;  4FK2 A;  4B3R K;  2KHO A;  5KQD A;  3MED A;  2DY4 A;  2VG7 A;  4ILJ A;  5KGW A;  4EAH D;  4OVL A;  2JGU A;  5HRO A;  1NJZ A;  3PSI A;  4FWQ A;  1BU6 O;  3NDK A;  5I3U A;  4CHZ A;  4DSJ A;  1Q7Y O;  4OLA A;  4FVU A;  1J53 A;  1NGH A;  5ADX H;  4K42 A;  1B9D A;  2G8V A;  3GOI A;  4CK2 A;  4AHT A;  3A5L C;  4WQ4 A;  3ULD A;  3NVK A;  2KLA A;  2GEM A;  3DLB A;  3C0B A;  1U45 A;  4CEE A;  4BQZ A;  3WNE A;  1TKT A;  1QE1 A;  4DFK A;  2D1K A;  1S3X A;  4IO8 A;  4WQ5 C;  4B8C A;  3JSM A;  3T7Z A;  1ATR A;  2HF3 A;  4BRK A;  3MXJ A;  1NOZ A;  4KHN A;  1JLB A;  4W5T A;  4PL8 A;  4FLZ A;  4J2E A;  4AHR A;  3BGR A;  2G8F A;  3RWU A;  3EE8 A;  3QDK A;  4JKB A;  3HO1 A;  2E8A A;  1JKH A;  2HVI A;  2YNI A;  1NG9 A;  5C10 A;  2QW9 A;  4DS5 A;  4NXN K;  5CZ1 A;  1OH7 A;  2WOM A;  3CF5 L;  1SL1 A;  1RBV A;  2ZGZ A;  3FZF A;  3OA9 A;  1QQC A;  3RMC A;  1UA0 A;  3QIO A;  4DV4 K;  1LAV A;  2RN2 A;  4CHN A;  3VQ6 A;  4H0X B;  3AVI A;  4DWI A;  4IKF A;  2ATQ A;  3OJU A;  1KLN A;  4A5A A;  2P5O A;  3ZEU B;  4BRN A;  5J2Q A;  1VSE A;  4GY2 B;  4A59 A;  2ASM A;  4E0D A;  4LH5 A;  5AQG A;  4FZX C;  2E2Q A;  4K43 A;  3NHG A;  2HVH A;  4WQ4 C;  4KV8 A;  4FLT A;  3LDP A;  1L3U A;  4K0K K;  3L3V A;  2P51 A;  1TKX A;  1D5A A;  1N8R O;  2D0A A;  4ID5 A;  1BO5 O;  2QKK A;  4JI0 K;  1KFS A;  3TAF A;  5GAH P;  3MCP A;  3ZT0 A;  3VQ8 A;  4IFE A;  3IS9 A;  1LW0 A;  4AHC A;  1QQN A;  4TSX A;  5GAE P;  1NK6 A;  2ITM A;  1LWF A;  1KLM A;  1LV5 A;  4I9Q A;  4OPK A;  1RT3 A;  3UKU B;  4M7Y A;  1RBR A;  5H1S Q;  4B9M A;  4BE0 A;  3SK3 A;  3LWL A;  2B6A A;  4B3O A;  1QQO A;  1HPZ A;  3R8E A;  4BR7 A;  1QZ6 A;  4MDA A;  4M42 A;  3LDO A;  2RF2 A;  1REV A;  2ZWH A;  3DXM A;  5M1N A;  3ZX3 A;  3ZSX A;  1GLD G;  4NYN A;  3VQ9 A;  3HM8 A;  1QHT A;  3OHR A;  5FRN A;  3FZL A;  4Z4I A;  5A2Q O;  3LAN A;  1WSI A;  4BC5 A;  3LAL A;  1BIS A;  2HW3 A;  4AH9 A;  1RT4 A;  1VQ7 N;  3OBY A;  5KPZ A;  3CI5 A;  4CIF A;  4I6M A;  4C1N K;  3AO1 A;  4ISF A;  5D3G A;  1LW2 A;  1ATS A;  4LC9 B;  1O1W A;  5BN9 A;  1NKC A;  2ZQB A;  4HVJ A;  1HX1 A;  1YTA A;  4BR4 A;  3NCI A;  4DR4 K;  1LWC A;  3OY9 A;  4DV7 K;  4LF7 K;  3EEQ A;  1BDG A;  2QM1 A;  3VF6 A;  3PIO L;  1NGA A;  1VHX A;  2W42 A;  4X65 K;  3TPQ A;  4JI2 K;  4KTQ A;  1X3N A;  3HT3 A;  3ULE B;  1VSI A;  1NM1 A;  4KFB A;  2VWB A;  4BRA A;  4HUE A;  4H0P A;  4JRQ A;  4CGG A;  4Q0B A;  1V4S A;  3ALY A;  4CVN E;  3E9O A;  1IKY A;  3J80 O;  2NRT A;  3TTD A;  4AHU A;  3WT0 A;  3WXL A;  1X1P A;  3A5M C;  4QOZ B;  4YOV A;  4HTU A;  3M1F A;  4H5V A;  5KPT A;  1RIL A;  4IXC A;  2UXB K;  3KLE A;  1HNI A;  4M3X A;  3PLA A;  1ZXO A;  3S3N A;  3LAK A;  3FE1 A;  3ITH A;  2XRI A;  3N4Q A;  4JHD A;  1QZ5 A;  1SKS A;  4F2S A;  3V4I A;  3E9P A;  1V4T A;  1VSH A;  3NF7 A;  4CJ7 A;  4DHY A;  3W3D A;  4A2A A;  4CFD A;  1T3V A;  1TAQ A;  3IG1 A;  1KAX A;  4A61 A;  3VF2 A;  3HP6 A;  1BHL A;  2YNH A;  3WXJ A;  2UUC K;  1T6C A;  1RT7 A;  4QS7 A;  4DV2 K;  1HRH A;  5HRN A;  4PY5 A;  4H03 B;  3NH0 A;  2YHW A;  4K25 A;  1O13 A;  3IKM A;  3CJ7 A;  3FZK A;  1B9F A;  2D5R A;  4DTP A;  3PUF A;  1KFD A;  1WB9 A;  1VQK N;  4H0O A;  1TL3 A;  4PA1 A;  4QAG A;  5JLH A;  1HPM A;  1XC9 A;  3H46 O;  5C2D A;  4CHQ A;  4C8M A;  1WSH A;  3I8D A;  3V1R A;  3VA3 A;  5EOY A;  1WAF A;  5C2F A;  1S72 N;  4JRP A;  2NLX A;  4FJL A;  2FSN A;  4E7I A;  4AIL C;  3WXM B;  4FJK A;  1CZA N;  1IBK K;  1YAG A;  3E9L A;  3RRH A;  4B1X B;  3M3Z A;  3I33 A;  2P9U B;  2XY8 A;  5C15 A;  4F2R A;  3EE9 A;  3U9Z A;  4JYA K;  2EWS A;  3B6O A;  1VK0 A;  3WEE B;  3WUH A;  1FJG K;  3AA3 A;  4WFB L;  2BDP A;  1Z26 A;  2UYT A;  2CGL A;  2A1R A;  3HYF A;  4FWR A;  3SQ1 A;  4B3T K;  2QKB A;  2YHB A;  4FJM A;  4IG3 A;  4FSV A;  3PSF A;  3C65 A;  2ETJ A;  4WCE L;  5CYM A;  1BUP A;  3DLG A;  1XNQ K;  3RMD A;  5AQS A;  4DR6 K;  3G4S N;  2FBT A;  2O8F A;  4F3O A;  4OPJ A;  5FPE A;  3EYZ A;  5M1Q A;  3AVK A;  4RW8 A;  2A41 A;  1NMD A;  4DR5 K;  4FPA A;  3CYM A;  5DMR A;  4ELU A;  2VG6 A;  3F2K A;  3AVM A;  4BAC A;  4DU4 A;  3G6E N;  4DQI A;  3SLC A;  3WNF A;  2E2P A;  1DGK N;  3QEI A;  4MLE A;  5GAD P;  4BC4 A;  2O8B B;  1BCO A;  3D2F B;  5BPN A;  3TI0 A;  1WBB A;  5AQI A;  2NNW A;  1QSL A;  4EFH A;  4ILG B;  5AQJ A;  4I9L A;  4MFB A;  4DLG A;  3HOT A;  2W41 A;  1W2B M;  3MN5 A;  1W97 L;  3KKS A;  4ZTF A;  4FO0 A;  1NMN A;  1S1X A;  3AO3 A;  4RCH A;  4CI6 A;  3THV A;  3R1X A;  4YOX A;  5JS2 A;  2VG5 A;  3QFP A;  1S9G A;  5KI6 A;  3J7A P;  1OVY A;  1VQ8 N;  4JKG B;  5MLC Q;  1XNR K;  2O8E B;  3ATU A;  4BRG A;  2EX3 A;  2CGK A;  2P9S B;  4NYF A;  1JXB A;  4YOW A;  4KHY A;  4A57 A;  2O8C B;  3DLE A;  1BWF O;  4LSN A;  1A5X A;  5IWA K;  4DF8 A;  5AZI A;  4KI6 A;  3O08 A;  1N6Q A;  4E1J A;  5AQR A;  2HOE A;  4YOU A;  4FM2 A;  3VGM A;  3TWH A;  2BTF A;  4LF8 K;  3AAP A;  3SUO A;  5KGX A;  2E1Z A;  1A5V A;  4AM6 A;  4HUF A;  1VSM A;  1Q82 O;  3KTQ A;  3FFK B;  1UA1 A;  2HHV A;  5FDL A;  3OYE A;  3H3N O;  4JD2 B;  5F2R A;  4GVM A;  3ENO A;  4PKG A;  2BE2 A;  5BPM A;  4HTL A;  5CYQ A;  4CF1 A;  2DFE A;  3VQ5 A;  2XHB A;  2PY5 A;  5HP1 A;  3VPZ A;  4FXD A;  1HQU A;  3ZET A;  1RDA A;  2F7T A;  4JKC A;  3H45 C;  3QIP A;  3EN9 A;  2HST A;  4CZJ A;  3WNH A;  1VQ5 N;  3HK2 A;  1NKE A;  4CF0 A;  2VGN A;  3AVL A;  2E4L A;  4KHW A;  2WFB A;  4K41 A;  2HHW A;  4CBX A;  2FBY A;  3AA2 A;  4CJV A;  2AA4 A;  3NE6 A;  1A5W A;  2P9K B;  4DTR A;  3M8R A;  1N34 K;  5E26 A;  2NRH A;  4DV3 K;  5HL7 L;  4GV9 A;  3HL8 A;  4QS9 A;  3NGY A;  3D45 A;  1KAY A;  1U2V B;  2W6K A;  3AVN A;  4DFP A;  2J4R A;  3OW2 M;  3JAM O;  1T03 A;  1L3V A;  3OYB A;  3OYF A;  3FZM A;  1M1K O;  4OGE A;  3OYG A;  4FJ8 A;  4O5F A;  5AQH A;  4OGC A;  2ZD1 A;  4FLX A;  4JI8 K;  3TTC A;  2ZGY A;  4E7K A;  3KLF A;  5HBM A;  2GX9 A;  4Z0U A;  3CCQ N;  4MQ3 A;  1C0T A;  1SZ2 A;  3O4Q A;  1S1T A;  1MWK A;  3V9X A;  3ZYY X;  3J8A A;  3LDN A;  3NBP A;  3OS0 A;  4Z94 A;  3CQ8 A;  1Q86 O;  4ILH A;  3KIO A;  5M1O A;  1RGI A;  3PO4 A;  5AQW A;  1OKJ A;  3HPG A;  3MX5 A;  3MCA B;  3QB0 A;  4B3M K;  4IEE A;  3THY A;  4BDY A;  5GIO A;  2OA8 A;  4Z4E A;  5LMN K;  1JLQ A;  5AFU A;  4DR3 K;  3C7N B;  1ZBU A;  1WUA A;  3CER A;  3VQB A;  1ASV A;  5J1E A;  1NGB A;  4MO5 A;  1YVN A;  4ID1 A;  2P9I A;  3M8S A;  1VRT A;  1NGD A;  3CQX A;  3RVC A;  1DKG D;  3KD5 E;  4FOE A;  3L3U A;  3LL3 A;  4IOA L;  3TAQ A;  3EL2 A;  3KD1 E;  1KSP A;  5J2M A;  4CHY A;  1BG3 A;  1LWE A;  4A5B A;  4CZK A;  2RPI A;  2D0O A;  1U48 A;  3KLG A;  2JWL A;  2ASP A;  2NRX A;  2IAJ A;  4X64 K;  1WSE A;  3QBW A;  2Q1N A;  3VQ7 A;  2P5G A;  3LZI A;  2F8S A;  4CF8 A;  3AA4 A;  3G25 A;  4CF2 A;  3IFR A;  1ZBL A;  4UY8 O;  3D0P A;  1M90 O;  2O8E A;  2GTD A;  4NLC A;  5AQY A;  2HNY A;  2F9W A;  2BUP A;  1W0H A;  3CM5 A;  2P9S A;  1XMQ K;  4KRE A;  1Z6R A;  3TSP A;  1HNZ K;  5AQP A;  1K8A O;  2F8T A;  4CFB A;  1TVR A;  4WFN L;  4CD1 A;  4B1Y B;  4FLY A;  2X78 A;  3VEV A;  2HF4 A;  4B3S K;  4GNI A;  1FKO A;  3LP2 A;  3SCX A;  1L5U A;  3QNN A;  3T3F A;  3AVJ A;  5C25 A;  4H8K A;  5HRP A;  2OYQ A;  4G1Q A;  3SQ2 A;  4KI4 A;  3VMF B;  2WON A;  4Z4G A;  1NGJ A;  4DR7 K;  1BI4 B;  2FF3 B;  2I7P A;  4OJR A;  1VQ9 N;  5AQM A;  3MK6 A;  2OTL N;  1Y97 A;  1IBM K;  4G9Z A;  1HNV A;  1NWK A;  1JLF A;  3OYC A;  2XY5 A;  2X6S A;  2IVN A;  3L2V A;  3EY1 A;  3WQU A;  4JI4 K;  1C0M A;  3TR8 A;  3TAE A;  3BUZ B;  4B9S A;  4CJW A;  4XH5 A;  4JK8 A;  3G0Z A;  4CK3 A;  1WSG A;  4LFC K;  4QCL A;  5HOO A;  1S22 A;  1W9H A;  3AGR A;  4IDH A;  1N33 K;  2HHU A;  2P9K A;  5AFU H;  4A62 A;  2R7Y A;  3KZB A;  4M41 A;  3M8Q A;  3K2P A;  5AQT A;  4PHT X;  3CCJ N;  2KW4 A;  2KTQ A;  1VQM N;  3MN7 A;  3C6H A;  4BVO A;  3OYK A;  1HKC A;  1VSJ A;  4E89 A;  4XH4 A;  3V6D A;  2Y1I A;  2YX6 A;  4RW4 A;  3PY8 A;  2CH5 A;  4DTJ A;  3V81 A;  3AVF A;  1IO2 A;  1TUU A;  5BN8 A;  4DQQ A;  2NZT A;  2O4I A;  4FJI A;  4FLU A;  4CBU A;  4LFA K;  4FK4 A;  3PV8 A;  1KRP A;  4QS8 A;  1JCG A;  3P38 A;  2IVO A;  4DU1 A;  4KHU A;  2FSK A;  3O4N A;  3UB5 A;  3NH1 A;  2NRW A;  4DV5 K;  1VSK A;  1XHX A;  2A1S A;  3LWM A;  3U3G A;  3S3M A;  1RCH A;  4V19 S;  3SUQ A;  2E5L K;  5M1F A;  4CJU A;  3GBT A;  3MEC A;  3DRS A;  3CC4 N;  4BWJ A;  2O8D B;  2YJF A;  4GV3 A;  3T1H K;  1NK8 A;  4R79 A;  1VSF A;  3BF3 A;  3ZT4 A;  3NF6 A;  3DAW A;  1RTI A;  1UAX A;  1WSJ A;  4Y0W A;  4BRP A;  3SBG A;  3O1W A;  3RSE B;  4LH4 A;  3I56 N;  4FOI A;  4PUO A;  3SAH A;  3IRX A;  2VWJ A;  3MWP A;  1VAZ A;  4FM0 A;  2KFN A;  3O9S A;  1GLE G;  3QET A;  3OYD A;  3UKR B;  3O80 A;  1U6Z A;  1Q9Y A;  4CZM A;  3KLI A;  1ZBS A;  3AV9 A;  3D7E O;  4OPH A;  2KKZ A;  4H5W A;  1E4F T;  1KQS M;  4IG0 A;  1IH7 A;  1X3M A;  2ASO A;  4CJE A;  4X62 K;  4FLW A;  4B1U B;  2KZM A;  1XUP O;  2PYJ A;  3VQA A;  3HI0 A;  4DTS A;  4FZY A;  4KKO A;  4FPB A;  3O3F A;  4M3W A;  3HOS A;  2BGG A;  1OVQ A;  3DRR A;  3ATV A;  1EO1 A;  3TSU A;  3SUP A;  5F1X A;  4CGH A;  2P9P B;  3SNN A;  2E1Y A;  4CIG A;  1XI1 A;  3HJF A;  2Q2R A;  1TKZ A;  1JLE A;  5J2N A;  3F73 A;  3CCV N;  1NGE A;  1KVB A;  3NMU A;  1TGO A;  1EXQ A;  4OKE A;  2WTU A;  3SV3 A;  1J9A A;  4CGD A;  3PX0 A;  1RT2 A;  1WNS A;  3DLL L;  2QK9 A;  3CC7 N;  2EHG A;  3THX B;  4X66 K;  2HHH K;  4BR2 A;  4DQ8 A;  3I55 N;  4B1Z A;  4IBN A;  5FPM A;  2YKM A;  2VWK A;  3IAY A;  4CJL A;  2OPR A;  4FWO A;  4WF9 L;  4FWS A;  2GBZ A;  2YNG A;  3H1Q A;  1KC8 O;  2F96 A;  2I5J A;  5K14 A;  4C8O A;  5HRS A;  5M1K A;  1NGC A;  1UOC A;  3TAG A;  4DSI A;  1NNE A;  3RTV A;  1HMV A;  1BA1 A;  3ZX0 A;  3K58 A;  4AQY K;  4U67 L;  2OZM A;  4M63 C;  3ZSZ A;  3S3O A;  1IV0 A;  4H0V B;  4IZ9 A;  2D4W A;  1C1B A;  1NK5 A;  4KH4 A;  1SKW A;  4EHT A;  1YT3 A;  2QWO A;  1E4G T;  3FLC O;  4GKJ K;  1C0G A;  1TV6 A;  2A40 A;  4BRD A;  2YV0 X;  3EKU A;  1FXX A;  3JS6 A;  3CCR N;  2OAN A;  2UUA K;  1YIT N;  3ZEU A;  4XEI A;  4DQP A;  2VQF K;  3L6Q A;  5BRD A;  1B92 A;  4C8N A;  4F3T A;  4CJK A;  4ZTJ A;  3GDQ A;  3NGI A;  2UU9 K;  3MXI A;  4H0T B;  4DSF A;  2I7N A;  1RFQ A;  3LM9 A;  3TTF A;  4KTW A;  2BH1 A;  2QWR A;  1EX4 A;  1HYZ A;  3QLH A;  1QHA A;  3CFO A;  4LFB K;  4DCH A;  1NGF A;  4IDK A;  3C6U A;  4FJ5 A;  1QTM A;  2XY7 A;  1TYQ B;  3HTV A;  1LCU A;  3GE1 A;  3SPZ A;  4DV0 K;  3ZSO A;  2GWK A;  2IOC A;  3VN5 A;  1ZYQ A;  5J2P A;  5BRE A;  5AQQ A;  3AGK A;  4CFA A;  2A6A A;  2P9N B;  1I3A A;  1KXP A;  3LDQ A;  3HXM A;  4DV1 K;  2JLE A;  3UKU A;  4FCY A;  3VTH A;  3MEE A;  4W5R A; 
#chains in the Genus database with same CATH homology
 3OS1 A;  4B8C A;  1HJR A;  4KO0 A;  3HL8 A;  5HRR A;  3BDP A;  1GOC A;  3JSM A;  3NGY A;  3L2Q A;  3D45 A;  1RT5 A;  1TAU A;  4XIU A;  2OZS A;  3AVN A;  4R5P A;  4CJ5 A;  3MXJ A;  4DFP A;  4CJ4 A;  1T03 A;  1L3V A;  1NOZ A;  4L8R B;  3OYB A;  4KHN A;  1JLB A;  3AVA A;  4NCB A;  4W5T A;  3KKR A;  4DMN A;  2FBV A;  3OYF A;  4OGE A;  4FLZ A;  3OYG A;  2PYL A;  4J2E A;  3ZSV A;  4FJ8 A;  4PQU A;  1VRU A;  3V9U A;  1BIZ A;  4AHR A;  3BGR A;  4OGC A;  2G8F A;  3LAM A;  3RWU A;  4M3Z A;  2ZD1 A;  4FLX A;  4DS4 A;  4ELT A;  3HO1 A;  1JKH A;  4FVM A;  2HVI A;  2YNI A;  1RBS A;  4NCA A;  1LAW A;  4DS5 A;  4J2D A;  5CZ1 A;  5T7B A;  4E7K A;  2WOM A;  1S1U A;  1JXE A;  2YKN A;  3B6P A;  3MEG A;  4FW1 A;  5HBM A;  4W5Q A;  1RBV A;  3KLF A;  3OVN A;  3SV4 A;  3RMC A;  4Z0U A;  1QQC A;  4O0I A;  2OPQ A;  3QEP A;  4MQ3 A;  3OYN A;  1UA0 A;  2KFZ A;  3QIO A;  1C0T A;  3O4Q A;  1S1T A;  1CZ9 A;  4I2Q A;  3V9X A;  3QEW A;  1LAV A;  2RN2 A;  4CEB A;  4W5N A;  2HHS A;  3NBP A;  3C94 A;  3NAE A;  2G8U A;  4CHN A;  3OS0 A;  4IFV A;  3VQ6 A;  3AVI A;  1FK9 A;  4DWI A;  3CQ8 A;  2AJQ A;  4IKF A;  1NJY A;  1KVC A;  3QO9 A;  1UWB A;  2ATQ A;  3KIO A;  2IDO A;  3OJU A;  3PO4 A;  3AO4 A;  3HPG A;  1KLN A;  2P5O A;  5KRS A;  3ZT3 A;  1NOY A;  5J2Q A;  3P1G A;  1VSE A;  4JLH A;  4M3U A;  2YNF A;  2HND A;  2QXF A;  4LH5 A;  4CEA A;  4E0D A;  4BDY A;  2Q3S A;  4CJ3 A;  1U49 A;  4N47 A;  3AA5 X;  4FZX C;  4HCC A;  1S9E A;  3NHG A;  3SPY A;  1ZBF A;  4RW7 A;  2OA8 A;  4Z4E A;  3L8B A;  1JLQ A;  4KV8 A;  4KB1 A;  2HVH A;  1HYS A;  2XY6 A;  1ZBU A;  4DTM A;  4OKK A;  4FLT A;  3ZSQ A;  3I0S A;  1L3U A;  3KJV A;  1BI4 A;  4J2A A;  2DFF A;  2E6L A;  2RKI A;  3L3V A;  2P51 A;  1ASV A;  1D5A A;  1TKX A;  2D0A A;  3VQB A;  4ID5 A;  4YFU A;  1ITG A;  1T05 A;  2QKK A;  4HCB A;  4EZ9 A;  1SL2 A;  4KTZ A;  2NUB A;  3LP0 A;  5J1E A;  1KFS A;  4DFK A;  3TAF A;  3MXM A;  1T7P A;  4DSL A;  4ID1 A;  4CEO A;  3ZT0 A;  1GOA A;  3VQD A;  3VQ8 A;  3ZCM A;  3F9K A;  5E41 A;  3IS9 A;  3M8S A;  5FRM A;  1ZBH A;  3RRG A;  4DU3 A;  1LW0 A;  1VRT A;  4TSX A;  4AHC A;  1NK6 A;  4C8L A;  3LPU A;  4CJT A;  4O44 A;  3K5N A;  1BGX T;  4CJF A;  4CGJ A;  1DTT A;  1LWF A;  1KLM A;  3KD5 E;  3L3U A;  2KQ2 A;  3I0R A;  3TAQ A;  2E6M A;  3KD1 E;  3KK1 A;  1KSP A;  4J2B A;  2Z1H A;  5J2M A;  1LV5 A;  4CHY A;  3K57 A;  4OPK A;  1RT3 A;  4I9Q A;  4FJN A;  1LWE A;  2ZE2 A;  4FM1 A;  3K5L A;  1X9W A;  1RBR A;  2IS3 A;  1RNH A;  4B9M A;  1SV5 A;  2RPI A;  4BE0 A;  3LWL A;  1RDD A;  2B6A A;  4JS4 A;  1U48 A;  3DM2 A;  3KLG A;  4B3O A;  1HPZ A;  4BWM A;  2IAJ A;  1I39 A;  4B9V A;  3HM9 A;  4M42 A;  3AVC A;  4DTU A;  1WSE A;  3VQ7 A;  3MAQ A;  2RF2 A;  1REV A;  2P5G A;  4E7J A;  3QIN A;  3LDS A;  3ZSX A;  3LZI A;  4NYN A;  4JS5 A;  4DTO A;  3VQ9 A;  2F8S A;  1C0U A;  1C6V A;  1QHT A;  3VQE A;  4CF8 A;  3NF9 A;  3AA4 A;  3VQQ A;  3V1Q A;  4CF2 A;  4DSE A;  4B9U A;  2FBX A;  1K6Y A;  1Q8I A;  1ZBL A;  4E1N A;  4W5O A;  5FRN A;  3PX4 A;  4Z4I A;  3SZ2 A;  4RW9 A;  3D0P A;  4PWD A;  2HW3 A;  1C1A A;  3LAN A;  4CGI A;  1J5O A;  1JLA A;  1RT1 A;  4CJP A;  1WSI A;  3LAL A;  3DLH A;  1BIS A;  3PO5 A;  1WSF A;  2HNY A;  1RT4 A;  4AH9 A;  3DRP A;  1W0H A;  3CM5 A;  3DOL A;  4CIE A;  1N5Y A;  3SUN A;  4KRE A;  4B9T A;  2B4J A;  4CIF A;  1DTQ A;  1YTU A;  3HVT A;  4AHV A;  2F8T A;  4CFB A;  1TVR A;  2HHT A;  3AO1 A;  3L2R A;  1X9M A;  5D3G A;  4WE1 A;  2HB5 A;  1KVA A;  4FLY A;  1LW2 A;  2X78 A;  5CZ2 A;  4CES A;  1NK9 A;  1RTJ A;  1MU2 A;  1O1W A;  4CEC A;  1NKC A;  2ZQB A;  1FKO A;  4HVJ A;  1NKB A;  3LP2 A;  3SCX A;  1YTA A;  3NCI A;  3QNN A;  1L5U A;  1WAJ A;  3T3F A;  3AVJ A;  5C25 A;  4H8K A;  5HRP A;  4IFY A;  2OYQ A;  4G1Q A;  1LWC A;  4E19 A;  3OY9 A;  3OJS A;  3U6F A;  3SQ2 A;  3UIQ A;  3DYA A;  3KK3 A;  4EP5 A;  4KI4 A;  4B08 A;  2WON A;  3HST B;  4CED A;  4Z4G A;  4DQS A;  4BE2 A;  1KCF A;  1BI4 B;  4OJR A;  5C24 A;  3ZT2 A;  4CJS A;  2W42 A;  4BDP A;  3QER A;  1Y97 A;  1TK8 A;  1HNV A;  4H4M A;  3V9S A;  4KTQ A;  5I42 A;  2Z1I A;  1JLF A;  3HT3 A;  4DQR A;  1VSI A;  3SJJ A;  4KFB A;  1SL1 A;  1SL0 A;  1IG9 A;  3A2F A;  3OYC A;  1TK5 A;  2XY5 A;  1IKW A;  2X6S A;  4NCG A;  3L2V A;  4CHO A;  2G8K A;  4HUE A;  3EY1 A;  3OYI A;  4JRQ A;  1C0M A;  3TR8 A;  4CGG A;  1U4B A;  3ZSW A;  3TAE A;  3EZ5 A;  4Q0B A;  2G8I A;  3ALY A;  3K5M A;  2G8H A;  4B9S A;  4CJW A;  4M3T A;  1IKY A;  3G0Z A;  4CK3 A;  1WSG A;  3SI6 A;  1IKV A;  3FFI A;  3SYZ A;  4QCL A;  3DMJ A;  4AHU A;  4K8Z A;  1S6Q A;  1W9H A;  1X1P A;  4QOZ B;  4ICL A;  4HTU A;  2HHU A;  5SZT A;  2HHQ A;  1EP4 A;  2LSN A;  5KTQ A;  2FC0 A;  1RIL A;  3QNO A;  4DG1 A;  4C8K A;  3KLE A;  1HNI A;  4M3X A;  2X6N A;  3S3N A;  3LAK A;  2R7Y A;  4H4O A;  3ITH A;  4M41 A;  2XRI A;  3M8Q A;  4FW2 A;  1FKP A;  1G15 A;  3K2P A;  1SKS A;  2KW4 A;  2KTQ A;  4F2S A;  4HHT A;  3V4I A;  3OYK A;  2DFH A;  4Z4H A;  1VSH A;  3NF7 A;  2X74 A;  2XO7 A;  1VSJ A;  4E89 A;  3CFR A;  5HLF A;  4LD0 A;  1Q9X A;  1Z25 A;  3V6D A;  2Y1I A;  4BE1 A;  4CFD A;  4LSL A;  1TAQ A;  3IG1 A;  3V1O A;  4RW4 A;  3PY8 A;  3E01 A;  3ZT1 A;  3HP6 A;  1WLJ A;  4CEQ A;  2HHV A;  1BHL A;  3DI6 A;  2YNH A;  4DTJ A;  1CZB A;  4O4G A;  3V81 A;  3AVF A;  2KZZ A;  1IO2 A;  4CK1 A;  1RT7 A;  4DQQ A;  3O3G A;  2OPS A;  1HRH A;  5HRN A;  1BCM A;  4PY5 A;  4KHQ A;  4DSK A;  1JLC A;  1BIU A;  2HNZ A;  1RT6 A;  2O4I A;  4FJI A;  2P1J A;  3HPO A;  4BDZ A;  4FLU A;  4FK4 A;  3NH0 A;  4FJJ A;  4AHS A;  3PV8 A;  3NFA A;  1KRP A;  1TKD A;  1B9F A;  1HQE A;  2HHX A;  2D5R A;  4DTP A;  3PUF A;  1KFD A;  4CEF A;  3LZJ A;  4DU1 A;  3U3Y A;  4KHU A;  3O4N A;  3NH1 A;  4FLV A;  4FJ9 A;  1TL3 A;  3VQP A;  4FZZ A;  4PA1 A;  4N5S A;  4LY7 A;  4GW6 A;  1VSK A;  1XHX A;  2A1S A;  4UQG A;  4DTX A;  4DFM A;  3OS2 A;  4QAG A;  3LWM A;  3U3G A;  1QS4 A;  1RCH A;  4I7F A;  3S3M A;  1XC9 A;  4FJX A;  5FRO A;  3SUQ A;  3DLR A;  4E1M A;  4C8M A;  4CHQ A;  3OYA A;  1WSH A;  4CJU A;  3MEC A;  3DRS A;  3LPT A;  3I8D A;  3V1R A;  4BWJ A;  3VA3 A;  1JLG A;  1S1V A;  3OYL A;  4I2P A;  1WAF A;  3RMA A;  5SWM A;  4JRP A;  1RDC A;  4M3R A;  1NK8 A;  4FJL A;  1VSF A;  3ZT4 A;  3NF6 A;  4E7I A;  4AIL C;  3AVB A;  1RTI A;  1UAX A;  4N41 A;  1ZBI A;  1WSJ A;  4FJK A;  4M3Y A;  4CF9 A;  3VA0 A;  3KK2 A;  3L2W A;  3RRH A;  4KRF A;  4ZHR A;  2XY8 A;  4LH4 A;  1WN7 A;  1R0A A;  4F2R A;  4PUO A;  2Z1J A;  1D8Y A;  1ASU A;  3IRX A;  3NF8 A;  4RW6 A;  4N56 A;  2VWJ A;  2YHA A;  4Y1C A;  2GV9 A;  3B6O A;  1VK0 A;  4HUG A;  4FM0 A;  3AO5 A;  2KFN A;  3AA3 A;  2BDP A;  1J54 A;  3CM6 A;  1Z26 A;  3TAM A;  4KB0 A;  1DLO A;  2A1R A;  4Z4C A;  3HYF A;  3SQ1 A;  1JL1 A;  1XHZ A;  2QKB A;  2YHB A;  4FJM A;  4IG3 A;  1F21 A;  3QET A;  3OYD A;  1S1W A;  1Q9Y A;  3KLI A;  2ETJ A;  2OPP A;  3AV9 A;  3DLG A;  5CYM A;  3NH2 A;  3RMD A;  3OYM A;  3OYJ A;  2FBT A;  1IH7 A;  3P5J A;  1CXU A;  1TL1 A;  4IG0 A;  3T1A A;  4CJE A;  4FLW A;  2ITG A;  4CJR A;  1RTH A;  4F3O A;  3HPH A;  4ELV A;  4YNQ A;  4OPJ A;  3O3H A;  1JL2 A;  1KTQ A;  3EYZ A;  2Y1J A;  3VQC A;  1SKR A;  2PYJ A;  1RDB A;  3VQA A;  2KZM A;  3AVK A;  4RW8 A;  1BQM A;  4CEZ A;  4DTS A;  1QSS A;  4FZY A;  3CYM A;  3V9Z A;  5DK5 A;  5EU7 A;  4F8R A;  4KKO A;  5DMR A;  4ELU A;  3RR7 A;  1S5J A;  1CLQ A;  2VG6 A;  3AVM A;  4BAC A;  4DU4 A;  3O3F A;  4M3W A;  2BGG A;  1VSL A;  3DRR A;  1BL3 A;  3T19 A;  5C42 A;  3SUP A;  1RTD A;  4DQI A;  2HMI A;  4CGH A;  3WNF A;  4GMJ B;  3SNN A;  3AVG A;  4CIG A;  4RG8 A;  4O0J A;  1XI1 A;  4FK0 A;  3HJF A;  2GUI A;  3LP3 A;  3TAP A;  3QEI A;  1TKZ A;  1BCO A;  1JLE A;  1GOB A;  4O5B A;  5J2N A;  3TI0 A;  1NJW A;  4N76 A;  1HYV A;  3F73 A;  3DOK A;  3P83 D;  4OKJ A;  3TAN A;  3QES A;  1D9F A;  1SUQ A;  1QSL A;  1KVB A;  4I9L A;  4MFB A;  4DLG A;  3K5O A;  1TGO A;  3PX6 A;  4B9N A;  1EXQ A;  4OKE A;  1L3T A;  3KKS A;  4Y1D A;  4DTN A;  3SV3 A;  1J9A A;  4CGD A;  3PX0 A;  4ZTF A;  1U47 A;  1NK4 A;  1RT2 A;  4E3S A;  1WNS A;  3H08 A;  1S1X A;  3CG7 A;  3RMB A;  3HVR A;  2QK9 A;  1RBT A;  3AO3 A;  3THV A;  4CER A;  2EHG A;  3C95 A;  5JS2 A;  2VG5 A;  4OLB A;  5JS1 A;  1S9G A;  5KI6 A;  4IBN A;  2IC3 A;  3SQ4 A;  3LP1 A;  2YKM A;  3M8P A;  3TAR A;  2VWK A;  3IAY A;  4CJL A;  1NK7 A;  1X9S A;  1EET A;  2OPR A;  1L3S A;  1NK0 A;  2GBZ A;  2YNG A;  1XWL A;  2F96 A;  2I5J A;  2O4G A;  3CFP A;  5K14 A;  1IKX A;  4C8O A;  2DTU A;  4DLE A;  5HRS A;  2EX3 A;  4EZ6 A;  1UOC A;  3TAG A;  1T8E A;  3ZSY A;  4CHP A;  3SQ0 A;  4DSI A;  4NYF A;  3RTV A;  4DFJ A;  1BQN A;  1C1C A;  1HMV A;  1JXB A;  1CXQ A;  4M45 A;  4KHY A;  3DLK A;  3DLE A;  4LSN A;  1A5X A;  3K58 A;  4O55 A;  4DF8 A;  1EKE A;  3JYT A;  4FJH A;  4KI6 A;  3K59 A;  1N6Q A;  2OZM A;  3ZSZ A;  3S3O A;  4Z4F A;  4FM2 A;  3KLH A;  3TWH A;  5CY4 A;  1C1B A;  3AVH A;  4CFC A;  1NK5 A;  4FYD A;  1QSY A;  3SUO A;  2D0B A;  2IGI A;  1SKW A;  4F4K A;  5KGX A;  4E7L A;  1YT3 A;  1ASW A;  4CCH A;  2PZS A;  5KRT A;  1D9D A;  1TV6 A;  4K8X A;  4KAZ A;  1A5V A;  2YV0 X;  4CE9 A;  4E7H A;  1FXX A;  4KPY A;  3C6T A;  4HUF A;  1VSM A;  4KHS A;  1YVU A;  4DQP A;  2D0C A;  4CGF A;  4EP4 A;  3V9W A;  3VQ4 A;  4Q5V A;  3KTQ A;  1B92 A;  4C8N A;  1UA1 A;  4CJK A;  5FDL A;  3OYE A;  3OYH A;  4ZTJ A;  4FJ7 A;  4F3T A;  2BAN A;  3ZSR A;  4B8A B;  3NGI A;  3MXI A;  2G8W A;  4GVM A;  4DSF A;  3TAB A;  2BE2 A;  3QEX A;  4FK2 A;  5CYQ A;  4CF1 A;  3S9H A;  2DFE A;  4DF4 A;  3VQ5 A;  1NJX A;  4KTW A;  3MED A;  2XHB A;  2PY5 A;  2DY4 A;  5HP1 A;  2VG7 A;  4FXD A;  1EX4 A;  1HQU A;  5KGW A;  1HYZ A;  2JGU A;  3QLH A;  4OVL A;  3CFO A;  1RDA A;  3L2U A;  1U04 A;  5HRO A;  1NJZ A;  3HP9 A;  4FJG A;  3NDK A;  2B5J A;  4IDK A;  4CHZ A;  5I3U A;  4DSJ A;  3C6U A;  4FJ5 A;  1QTM A;  3QIP A;  1VSD A;  3ISN C;  2XY7 A;  4OLA A;  1J53 A;  2G8V A;  1B9D A;  3WNH A;  3HK2 A;  4CK2 A;  3SPZ A;  4AHT A;  4CF0 A;  1NKE A;  3AO2 A;  3ULD A;  3AVL A;  1S6P A;  2E4L A;  3ZSO A;  3RR8 A;  4KHW A;  2HHW A;  2FBY A;  3AA2 A;  2IOC A;  3VN5 A;  1ZYQ A;  3WNG A;  5J2P A;  3NGZ A;  4CJV A;  4B9L A;  2Z1G A;  3NE6 A;  4CFA A;  1A5W A;  1RBU A;  4CJQ A;  1U45 A;  3G10 A;  3DLB A;  1I3A A;  3HXM A;  1TK0 A;  4DTR A;  3M8R A;  4CEE A;  2JLE A;  3ASM A;  3WNE A;  3QEV A;  4FCY A;  1TKT A;  1QE1 A;  3MEE A;  4W5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...