2A1WH

Anti-cocaine antibody 7.5.21, crystal form i
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
225
structure length
225
Chain Sequence
DVKLVESGGGLVKPGGSLRLSCAASGFTFRNYGMSWVRQTPEKRLEWVAAISGNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARHDDYYGKSPYFFDVWGAGTTVTASSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexibility Of Packing: Four Crystal Forms Of An Anti-Cocaine Antibody 7.5.21
rcsb
molecule tags Immune system
molecule keywords immunoglobulin light chain kappa
total genus 45
structure length 225
sequence length 225
chains with identical sequence I
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a1wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a1wH01
5DI8B 3ARWA 4LRNL 1QR4A 5I18H 3IFLH 2AQ1A 4LVHB 3Q1SH 3JWDH 1BOGA 2NY0D 4LSRH 4XGZA 1VFAA 5CP3A 2HAZA 1FO0H 2PO6B 3OKKB 5C07E 4EN3A 3WD5L 3RHWK 4X6CA 3E8UL 4YHLL 3GSNB 4NQDA 2DL9A 5T1MA 1XZ0B 4M6AA 5CSZB 1ZHBA 2V9QA 1KN2L 3MROB 4XPGH 1A7NH 1G9MH 1HI6B 3N1QC 1EO5A 1EAPA 4JFXA 5T5FL 1HWHB 4A6YB 4NQVA 1SQ2N 4JFPB 3MCKA 1F3RB 2Y06L 4UOW0 5AAWA 1EO8H 3HAEA 3V0WL 2BSED 3EYVB 2G9HB 3D3VB 1NFDF 3IDMA 4OKDA 4OFVA 4HV8A 1ORSB 1YEIH 2Q1EA 5HJ3B 3PP3K 4I48B 4OV6F 1EVTC 1U8IA 5EZLA 2MWCA 3MRNA 3HS0A 1A1NB 3HB3C 1SYVB 5EC2B 3MLPA 5I73B 2FO1A 3O81A 4K8RL 4JFFB 4L4TB 4K3GA 5IIEA 5E6ID 4LCIL 2B5IB 8CGTA 3PDDA 4JFDD 3IVKA 1PSKH 2HKFH 1EHLH 1LHZA 3WD5H 4K3EH 5GZOD 3HZVB 2E9BA 1AD0A 1FSKB 4YHLH 2IFFL 2XKSA 5BZDB 5DRZB 1K4DA 2AK4A 3AMKA 5T3ZD 5C0BE 1IGTA 1OSPH 4OJFH 4APQC 4HBCL 4N90E 4HDIA 4HIHA 5IVNA 4JANB 3RVTC 2O5YH 2AJSL 5DEGA 1JPGB 1CBVL 1YN7A 2CLRA 2X4OA 5DQJB 3MRLA 3VFOB 3ROLB 5SWZB 1QR1A 3V4VH 2PCPA 3BZEB 3WHXB 1KJMA 1DQDH 3V5HB 3G6DL 4Q7DA 2VZ3A 1OT2A 1O0VA 1RV6X 1TPXC 3DYOA 5F3HA 2WP3T 1ZTXL 4XNZC 4ODBD 5C0CD 1F3JA 1V5JA 3GRWA 4XPAH 2Z93A 4N8VG 1MCOH 4W4OA 3MRQA 1F5WA 3LVEA 2ZOKA 2HVKA 1GIGH 5IROA 3MLWH 3CFEB 5HPOA 1DQDL 4MAYA 5IW6B 1U41A 4MLSA 2XQBL 4JKPL 4WV1C 2PKDA 3RJQB 3ZKMC 1N64H 1J8HB 3IFNH 1SBBA 4LCWD 5A2FA 4L3EB 3F8UB 3QUXB 3IDXL 5EIIB 3HI1A 3WFZA 5TE7L 4HLJA 4NT6B 4D9RE 2LVEA 2DD8L 3QG6B 5F7DA 4ONOA 1YMMD 4TUKL 5EU5A 4G8FB 5GGUA 4HJGB 1UJ3C 1YY8B 4AM0B 2FSEB 4CW1A 5DD5H 2CUHA 4H8WC 1XF4B 3QUYC 4GUPA 3H42H 4XHJD 2IEPA 5EU6E 3WUWG 4OI8A 4HK0A 1T0MB 3SE9H 2HJKA 3CH1B 1AC0A 2VDML 3DO7A 3M17B 3MLYH 4JKWA 3D39D 1KXQE 2HLFD 1XF3A 3QXDA 4GT7A 3WS3A 2D3VA 2ICWA 4I18B 5I17A 1N2RA 1F90H 2V5TA 3WIHA 1CL7L 1G1CA 3DO3A 3WLBB 5JNYB 1KJ3H 1FRGH 3BN3B 2C4FU 1TVHB 3SDDC 5A43C 4PJFE 5LBSL 1BJMA 1T03L 1J8HA 3BKCH 3PQYE 3VFSA 2A6KA 1ED3B 1Z5LA 2GJZB 2ZG1A 4NQCE 2QQNH 3LN4B 3V7AG 4OCSH 4JDVB 1FZJB 2IAND 1MAML 3S34H 3EGSB 4PRHA 2YA2A 3UJIL 5IFJA 2FBOJ 3GSNA 4NQDB 5JHLH 2R23A 3UTSD 2X2YA 3ROOB 3MRKB 1HI6A 1PDKA 4UTBH 4CN4A 3HPJB 2UZIL 5HYJB 4ODUB 5A1AA 4PJCE 3NCFB 4HJJL 4EOWL 1T66C 2BSRA 5TE6H 2L7JA 1BLNA 2F53E 2DKUA 2VRAA 3M07A 3MV9E 4X80L 1EDQA 2BRQA 1IKFH 2R4SH 1BQHA 5GRWA 3IYLW 5I8KL 5I8OH 3V6FA 3L3HB 1J5OL 4GRWB 3J8F7 3RWEA 4CADA 1KF9B 5ADOH 5DUPH 4Z7WB 1Z3GL 3P0YH 4RMWA 5I71B 3DTXA 5DD1L 1AE6L 3B6SA 3RFZC 1EFQA 1VGKA 3TBTA 3BIKB 4H26B 1L9MA 4WDIA 4ONGH 2HLAB 4LRIA 4M7KH 2GTZB 4F3FA 1HILA 2J6EH 3D85B 4LBEB 2BRRL 1JNLH 3WLBA 4WHDA 1MFBH 5FYJE 4XCNA 4UU9B 1IGIH 2VN4A 1CF8H 4HLZG 4U6HA 3PHQB 4OF7A 4ORGA 1YQVL 4ZYKA 5F88A 5C92A 1KPUB 2BY0A 5GGTH 4BH8B 3JWOH 1T80A 2N56A 4OZHB 1XR9B 1ACZA 5BQ7A 5ITFA 3HC0B 1JMZA 3BUYA 3SE3C 2QQKH 3TNNB 5CD3B 2BCKB 4JFPA 1OAQH 4JY5H 4D9RD 4GBXC 5T1KA 3I75A 2VDKH 1J0IA 5HHPA 3HG1E 4OF5A 3V6ZB 1BREA 4L3CB 4LLWB 5A2LH 4IIQB 4A2LA 1NJ9A 1AKJB 4XPHL 4PB9L 3H9SD 1YN6A 4ZS6C 1ZGLM 4RGMC 4Q6IA 3AY4C 5LVEA 1FNGB 1TETH 2OP4H 4UDTB 1D9KD 5ADPH 5GXBB 4DJMA 4H1LH 3WNKA 3F6IA 1NBQA 2BNQA 3D18B 5FA4B 1GGBL 1OSZA 5BW7A 1UENA 4JGUA 2FDBP 5DUBB 5E5MA 3N9GL 4PJ8C 3ZE2E 3HUJF 1HHGB 2FD6H 4HWNA 3EJYC 1P6AB 1BQSA 2APVA 3FQUA 1K4CA 1JPTL 4X6FB 2VLLA 1JGLH 2FBJH 3SGJC 4OLWL 1RUAH 5HYJA 3MRRA 4FQHA 1KCVL 1YNKL 3FT4B 3PGDA 1FYTE 4APQB 4F9PA 4DGIH 1QO3B 1YEHL 1N6UA 2F8OA 2VDRL 1SEBA 3DYPA 2XZCH 4PJAA 5E8NA 5HDQL 1JRHH 2ATKA 3JWDL 12E8H 1JNHB 1CR9H 4DKFH 2F5BH 4HUNB 2UVEA 3BEVB 3UYRH 2EEAA 5DYOB 4JHZA 3T09A 4Z78B 2YD3A 5FF6B 3SPVB 1T7WA 1WIPA 4EI5C 1IM9B 2J5LB 1F00I 2Q20A 3IRZA 2DJ4A 3GKZA 4OZ4A 2D7TH 3L1OL 1K6QL 4DGIL 4M02A 1K4DB 1SJVA 1ACYL 1QP1A 4QHLA 4HGKC 5LG1A 3WNOA 4Q6IC 5FUCE 1W72L 3NCYP 4CUCA 2UUDH 3QDMD 1FVEB 2I9TB 5CIPA 3SO3C 2FBJL 1DE4A 1UB6B 2YEZB 5DFWH 2XWTA 3VFVB 2O5XH 4PP1C 5E4EC 1I75A 4H8WL 3ALXA 1JFQL 3SOBL 1ORSA 5HSFA 5E08L 1DLHB 3Q2CA 3U9PH 2DIBA 2A77H 3TIEA 1T83A 1RK0A 1H3PH 1T4KA 2WINA 5IVZB 3V2AR 4KK9D 1V7ML 3RX5A 3GDBA 4JM2D 1VHPA 4Y19A 4PG2A 4PV8A 1ZHNB 3MJ8A 4S1DD 1HOCB 4AG4L 4GG6F 4UV4H 4U6YB 3S37H 5HYSB 4PJAB 5E8NB 4NNYB 1JGVL 5CEZH 1CXFA 4KY1H 4OLYH 5KS9F 2C7UB 5GSRA 3CFCH 3U0TB 5INDB 1DL7L 3L3GB 3HZKB 2BVOB 4RAHA 5HYIA 2G60L 1RIUL 4MA8H 3NBNA 3KPMA 1G7JA 3GJEA 2ITDA 4PTTB 4WEBH 1TQCB 3TH2T 4AK1A 1K8DB 5GS0H 2BNQD 5F1NB 3WJLC 2PXYC 1MIEL 4QHNA 3MQIA 1N6QH 3KPQA 4DGVL 2YR3A 5TFSH 1A0QL 1A14H 4NKDB 3AUVA 1NUFA 4K9EL 5BCAA 3RQ3A 5F1IB 2Q7YA 1RIUH 3CLEL 1G0DA 4MA8L 5B38B 3BGFB 3O2DH 1CU4H 3C5JA 2R2HA 4KI5E 5EO9B 4Y5XB 1QVOB 3VMNA 3ZE0F 1FO0L 4XT1C 3QEHA 3MGOA 2NYYC 2IG2H 4OGXH 4O2CB 4EDWL 1HH6B 3QRGL 3OKEB 1IT9H 4RIRB 4N1HB 5DSCB 4G6JH 3H3PH 1J11A 4F58L 5JXED 2ZG2A 5HVFB 1J5OH 2LV4A 1U8NB 3CLEH 1KIUA 2X4TA 1MCBA 1DSFH 4XMPH 4DN4H 1FZKB 2HKHL 1LGVA 3ARDD 5FYJD 4AL8L 3GEWB 3KYAA 4BSWA 1TNNA 4OQTA 5KVFH 1VFBB 2EYSB 2DM2A 3BXNA 4XAWL 5JW4M 5MEND 2FLBT 2KZWA 3EO0B 3I2CH 3BPNB 1A9BA 4OZFH 1RUAL 3BUTA 3UO1H 3EZ8A 4LPWA 4M93C 3HI5H 1U58B 1KBGH 1I8IB 3STZA 4F9LC 1HXYA 3SDYL 1DBAL 2WUCL 3K81A 3P11L 5K33A 1OQXA 4D0CB 2XA8H 4P9HH 5TF0A 3FFCB 4NO3A 4HUVA 1S7VB 4YK4C 2F5BL 3MBEA 2V2WA 4LDEB 3LH2L 3IFPB 4HK3N 2VO5A 2VXVH 2FEDD 3KXFA 1RUKH 2I07A 3KDMA 4XCYB 3BPLC 3ARXA 4GSDL 1MF2H 4U1GC 4Y8DC 4J3SA 3H9SE 1UWGL 3SKOB 5CJOL 2DKMA 3U7WL 1DQLL 4DVRH 5CGYC 5JDSA 1XAUA 2J88L 1KCVH 3GGWA 3ZYOA 1ZHKA 1DBBH 4HDIB 4HIHB 3U46B 5HHNA 3TF7C 3JTTB 4DWHA 2VC2H 4LLYB 1G7MB 4AYFA 3KYKH 4JFYA 2WP3O 1CI5A 4WI9A 3V6OA 3IETA 4KGJA 1IQDB 2HFEA 1YPZE 3O6FB 2Q76B 5BZWA 1P4IL 3VFRA 2CGRL 1X3DA 3O8XC 4RGMB 3T3PF 3EO0A 4P2OA 2Y1VA 3FQRB 3QEUB 3VE0B 5GGRA 1DE4B 1PQZA 3UTTA 2ZOLA 1IC7H 4RISL 2BNQE 1D6VH 3LEYL 4ZUUB 4P4KB 3PDGA 4D0BA 2W60A 3SCMC 4MZ3A 1R0AL 5EZIL 4ETQA 3MO1B 2QHLA 3QEQE 5T3XD 2OLDA 1XF3B 5L8LB 4W6WB 2Y5TB 5F21B 1YEHH 2WWMC 5TGBB 4P4KD 5AG9A 3V4UL 4XMKL 5FM5M 3R8QA 5I6XB 3V7MA 4L4VE 4XX1G 1A7RH 5I1CL 2W9EH 3CXDL 4YHOH 1FPTH 3ARDA 4I3RL 4NOBA 2DQCL 1VFAB 4JDZB 4GJTB 5CGMA 3MFFA 4ALAH 4QRTB 3OZ9L 5DUBA 8FABB 4YXKL 1NC2A 2ID5A 4LCWA 1RJLB 1DQML 1AHWA 3QA3B 5DWUL 2F8VA 3FT3B 1A7RL 2HJFA 4Y16C 2GFBB 1BHGA 2P8LB 1JP5A 2CIIA 4RRPA 4BFBD 4GLRI 3MLVL 3MLZH 5I19L 2E8ZA 3NIDE 3DARA 4I3SL 3LDBB 1S5IH 5C0FB 2WIMA 1WFUA 2VLME 1CD8A 3SO3B 1I8KB 2AK4E 4NN6B 1RZFL 1OGAA 3BWAA 3FZUC 2DMKA 4WW2F 4YUEL 3AY4A 1WZ1H 4AT6A 4MJ2A 1R3JB 4YDVA 2HA1A 1I9EA 1Q72L 3IAPA 4R7DA 1CE1L 1JI2A 5TGBA 1Z9SA 5FM8A 4P46A 4XRCA 3B5HA 5BJTB 3GUTB 3BO8B 5EBLB 2X4QB 3MRDB 2YPKA 4JHWH 4HBQA 5A16B 3GMLB 3BAEL 1QSFE 1E28A 1RZJH 5HHQA 3REVA 3EDFA 2MHAB 4XWOD 4LLAA 3LHPL 5D1XA 1UB6A 2YEZA 4GAFB 4P2OB 3IDNB 2WANA 4HG4K 1LVEA 1S5IL 4LSVH 4A6YL 3CX2A 2Q7YB 3DXAE 3NN8A 3IXTB 2A38A 3CFKB 5J8OA 4OF3A 1C5DB 4JZNB 4MGXA 1AGEB 5F3BA 1LEKA 2HLFC 2H9GB 1MRFH 3ARUA 3IAQA 2R29H 3CCHB 5F1SA 2F8XC 1C5CL 2NY7H 4NYLA 2PF6A 5IK3A 3T0EC 2FIKB 4R3SB 3U79A 3KJ4C 5HDLA 3PWPD 3QDMA 1MPAH 3S4SG 1U3HD 4ZMAT 1KJ2A 5C6WH 4L29B 4YDVB 5HI4C 2VOTA 1TVBA 2YD6A 5HGBA 4R2GB 1BVLB 4RGNC 5TDNA 2O26U 3FN3A 1M6OA 3U0PB 5IB3A 4ELMF 1MHPH 2D4DA 1OP3H 3JWDC 1VB9A 3C08L 1X7QA 3JV6B 1BZQK 1FCCA 2QBWA 1ED3A 1CD0A 1FDLL 3E3QE 1MHCA 1PG7H 3QDGA 2P5WB 4JDVA 2IH1B 4QEGA 4ZAKC 5FA3B 5GQBA 1ZXQA 1UH2A 3ZE2F 5CEZD 1A5FH 1U8JA 1YMHA 4JLRA 1MQKH 4OV5A 1XR8B 4XWOC 1NAMB 3DO7B 1S7XA 4U1HA 4MMXC 5IF0A 1MVFA 1CFTA 5FUOL 1KSRA 3RVWC 3CIQA 1UXSB 1JNJA 2PN5A 2VR5A 1OW0A 1U9KA 2IAMB 4DVBB 1JPTH 4L9DA 3MRDA 1D6EB 4P2RE 4Y5YC 4XBPB 4P48A 4Q2ZB 4HUUB 1U8HA 2VL5A 2DKSA 2QADB 1KENH 1U0QA 3U36A 5KVDL 3LKNA 3HLAA 4KVCH 1E27A 1DP0A 4GRLD 1VPOL 4D94A 3MROA 4YH6A 4I18C 5HGHB 1QVOA 4OFDA 4UBDD 3ZL4L 1DQJB 1T2QL 4HIIA 3E6HB 1L0XA 4WTXA 4JHAL 1UKTA 2YN3A 1D5BA 4LSSH 5GGRY 1XT5A 3NH7L 3VMOA 4S0TD 4D8PB 4IRSB 3T77A 1AGCA 4JY6A 5GRYA 1DQTA 4LCUA 4RBPH 1JI1A 5CLWA 3NA4A 3BH9A 4JPIB 3RY5A 2HYMA 1UWXK 3C6LC 1QUNA 4FMKA 4PJ5B 1BQHB 2DD8H 1FFNB 3LKRB 3UTTE 4LSUH 2WUBH 4JKKA 5IFHH 5HXMA 3Q0HA 2HT3D 4BYHA 5GGTA 3WIHH 1KYOK 2HH0H 2X42A 4AIZA 3O6MH 2Y36H 5C0BA 1HHJB 2XQBH 1ZVHA 5JQ6L 5L8JB 5IG7A 1IGYA 4ZPVB 4PRNB 1WC7A 1JNLL 3EHBC 2KH2B 1LMKA 4LFHD 4IHOA 4KV5F 4E42B 2X05A 4E0RA 4PP2A 1F4AA 1B2WL 2ICEA 3GMQA 1F3DH 1MCLA 1BP3B 4V1DB 1C7SA 1JUFB 3KPLA 2DQCH 2ZSVA 4PJBA 5KANI 3NN8B 5MENE 1I9RH 5EC2A 1C5DA 4IRSD 4LCWE 1S7XB 2AK1L 1NLDH 3RL1A 1CFSA 3HPLB 1UQSA 1WF5A 1ONQA 3P73B 5T5NF 4K94L 3IJHB 1JYVA 3U1SL 1G7MA 3QQ3B 1NC2D 1J1OH 2IANA 4KJWD 3LS5L 5KSUA 4PB0L 2NXZB 4WW1B 3GMRB 5D1QB 3GFUA 4MS8D 3C60A 5IV2A 2GW5A 3NZ8A 4YWGH 4AIZB 5J0BA 4NO2B 3PL6D 3M8OH 3OKDA 1I1YB 4WVRA 3UTQB 1V8HA 3WLWC 1MFEL 1X5XA 1T03H 3LSOA 1AXTH 3VW3H 1OTSD 4IRZH 3TBVA 5IWLA 4UIKL 5DJAB 4Q9QH 3S7GA 5JOFB 5T33L 3QHZH 2CDEA 4GKZA 2ZUXA 4C83B 3WHE1 3HPJA 5GRVL 5IFAL 3PIQA 5H94B 3SDCC 4OZIF 1BEYH 3QI9B 3MRKA 1S9YA 2BHZA 4HS3B 4OD3L 3M8OL 3TZVA 2ZOKB 4B7IA 3QI9C 3DOSA 4YGVB 3QCVH 3NTCH 3ARSA 3ZDXF 3QNXB 2H6PB 5FOBB 2YK1L 4IOIA 5CD5D 2ZUQB 5J13C 3LQAH 1NGZA 3U30C 3WUZA 4XI5C 2QSCH 1BZ7A 3WCYA 3ULVL 2D7QA 2JJWA 3FQNA 3GSUB 5HYJD 2XYCA 3S3PA 3G04B 5HVHC 3UZQA 4LLMB 1B9ZA 1QFWI 1DN0B 8FABA 5C1MB 2YHGA 4PJHB 4WRLA 4MJID 1ZSDA 4KK6C 4D0DB 5E2TL 4TSBH 4P2RA 3LS4H 2NY1C 4MXQC 5MP6H 4PRPB 4X98A 4OZIE 1S7RA 3IU4H 2R8SL 1IGTB 2HFGH 3HE6B 1SEQH 3OXRB 1TFHA 4GAYB 4LVNB 2LE9A 3PWPB 1QBMH 1FN4A 2VITB 3QFJA 2BCKA 5K9QG 2DQTH 2PXYD 3TBSA 3FO9B 4XNYH 2V5SA 3I75B 3MCLL 4QY8A 4JB9L 2HRPH 5J57B 4G3YH 5ISZB 1M7DA 1XR8A 1OT1A 1ORQB 5DEFB 5DTFB 3TC9A 4D9QE 2P46B 3X3GH 4GMTH 1OP9A 5LWYL 2RFXB 4XAKE 1CFTB 5EG6C 1T20B 1D5MB 4UIMA 3C9NB 4PJBF 2J8UA 4HSQA 4NOFA 2W0PA 3S36X 4NBYB 2HLAA 2YMXL 2OK0L 3U7YL 1RZ7H 1P69B 3O6FA 4P2RD 3T04D 4ELKB 5IR1B 2ED7A 1EHNA 3WNPA 2VXUL 2RBLA 3QQ4B 3HE7A 4X6CE 3ZE0E 3TJHD 1DLFH 1KLUA 4FG6C 5C0BB 1L7TH 5E8EA 4LASH 4K3EL 5DQDL 4YE4L 1CGUA 2FATH 3TO2A 4BUHA 3H7BB 4OCMC 5IB4A 4KDWA 3BZEA 2C1OB 3NFSL 4I0CC 2VLLB 3BP4A 4CDHA 4KI5D 3NA9H 3V0VB 2EC9T 4G8GE 1GC1C 1RIHH 4XB8A 1A6UL 4FQXC 4LLVB 5EC1B 4G42B 1OPGL 1MCPH 3D87B 1Q38A 4FXLA 1KENL 3AB0C 5F71A 4YXLH 1FFOA 4U0RB 1N6VA 4JJ5A 4KHTH 2FEDC 1I7UA 4EBQH 1FFRA 1HH9A 2UYLB 5D1ZB 5DGRA 4DZBA 5IEHB 1JN6A 5C08B 4BZ2L 5FUCC 5DD3L 3HPLA 2BVPA 4XMLH 5CGYD 1NFDE 3OG4B 4OUUA 4J8RB 1V3JA 2RFXA 3KPSE 1TVHA 5DVOA 4OLUH 4UIMB 3SQOL 1EBAA 1NAKL 5D1XC 1L7IH 2MHAA 4DCQB 4K3DH 2Q3AA 4IJ3C 3ARRA 4B50A 1R5IA 4HKJA 4AIXA 1LO3L 5IBTL 4YHML 3IDNA 3B2UC 5T1KB 1WEJL 4FFZH 1EGJL 4WU7B 3QHTC 4MJIE 3BP5B 5B3JF 1T0MA 3KPRD 2GJ6E 1FL6B 4CBPA 4PRIA 2QR0A 4LHUA 1BFVL 3L3IA 3I3EA 5SX4H 1YUHA 4NQVB 5IF0B 3HC3H 4NKOB 4P57B 1B2WH 4HMDA 4OD2A 3WL9B 1TPXB 2VQTA 1IARB 4Q58C 4PGJA 3REWB 1OGAD 3D39A 4M7KL 1CLOL 4L3AA 1ZMYA 1VENA 2R56L 3RGVA 2NPLX 2KPNA 3HHRB 2AJ3A 2H6PA 5MHSD 4F7TB 5IVXE 5JO5A 2WSKA 3BIAX 1BZ7B 3OF6D 5DMYA 1EAJA 5FCSH 5MP6L 3BP7A 3MRPA 5GJSL 4NRZA 5SX5H 2FLRT 3IU4L 3MRIB 5L2KE 3OTTA 4CAGA 4M62L 2AI0H 2CJUH 3QEQA 3NIGF 1CWVA 1G0YR 3JV6A 5FKAB 2ADGB 4QRPA 3CPLB 5IB4B 2CMRL 1KGCD 5FGRA 2Q8BL 4PRIE 2P8PA 3DVGA 4QOKE 1QFWH 4XCCL 3L5WB 4M1GH 5SWZA 4ELME 1QR1B 4GRMA 2FWOA 3W5NA 4G8IB 3O6KH 3NIFE 4NYLB 5DMIH 1GOFA 4NO0B 2APBA 3MV7B 2ADFH 2XN9A 4WO4D 1ZHNA 3LV3B 3MR9B 1IC7L 4RISH 2YWYA 3RTQA 3MUGA 4KUZL 2VLKA 2W60B 1VACB 4OD3H 5T3XL 1ZLWK 4UZGA 2DM7A 1FE8L 3QR2A 4JRXD 2CO7B 1FIGL 2YSSB 4K7PL 4JFFA 4UIKH 1CFNB 4M6NL 4POZC 2DWEA 2GSIA 2IAMA 4IDLA 4QXTA 1AGBB 4TUJA 1D5IH 4Y4HD 1P84K 5IHUL 5FB8B 3IDIB 5BV7C 3P4MB 4YFLI 3PQYA 5DFVD 1X5IA 2VDKL 4JRYD 4E0RB 4U6TA 4R0LC 1VADA 4YO0B 4MAYC 4KAQH 3O4OC 5KVMC 1FP5A 2DICA 2JJSC 4MA7H 3FT2B 3O9WC 4C56B 3ELAT 3OHXA 4PY8J 5EN2B 1ZHBB 1DEEB 1W0WB 3FRPG 32C2A 1NGXA 5EO0B 1HXMB 2C1OA 5L6YL 3ARVA 2EYRA 2NQCA 3L7EB 5HGGS 4LU5H 3FO1B 2WV3A 3DVGB 2C7UA 5GSRB 2K7QA 1X5KA 5I1KH 3BWAB 1PG7L 5GPRA 2VXSH 3L5WA 5D7IE 5D2NB 1NCAL 3GIZH 4G6FB 1T0NA 2IADA 2V6HA 1J9CT 3UROR 4P2QB 4G7VL 3RRQA 1ZE3C 5HTSA 3MRHB 5DS8B 1MCWW 2UV3A 1IMHC 5EUOF 2GUOB 2XQYK 4LCIH 1LEGA 4Y1AA 3TCXA 3E6HA 5I0DA 1S7UA 4XWGL 4GKZB 3CUPA 2A6JA 3P4MA 3ULUE 1T1ZB 2E7BA 1A9BB 2NY2B 1BEYL 3CZFA 5SWSE 4RAUA 4HIEB 2G75B 3UJIH 3TBSB 1FL3A 3K2UL 3UDWA 5IMLA 1V05A 4OCSL 5TJWK 3RWIA 2E8YA 2DBJA 3MLUL 1X4YA 3EIFA 4OD1L 4KHXL 3UPRA 1UA6L 1DUZB 4WWKC 2XTJB 3RBSA 4KJWC 4OLUL 3EFDH 1HH6A 1I9JL 1GGYA 1XGYH 1DLFL 4XNXH 5AYQA 1GPOL 5CFHA 4TVPL 3WDHA 2VYRE 4F7PA 3S5LA 2X4RB 1LE9A 3LD8B 4MNGB 2M26A 1BFOB 1T2JA 2F54D 2OTWB 3HCVB 3ZDZF 2QHRL 3O3BB 4X5XB 5JORB 3IFLL 4J8RA 1J8KA 5IBUB 4BZYA 1WK0A 1JGDB 1U92B 2VDMH 3OB0K 3UCRA 3CVHL 3T1WA 2WNGA 1AO7B 3UPAA 2B4CC 2GUOA 2NXZD 3DMMA 4ZD3H 5I1GH 5I8EB 2ITDB 5D71H 4C4KO 3MRHA 3MRIA 4FZEL 2ICEB 4K23L 4LBEA 1S7UB 4OCYL 3EJYD 3FB7B 3QUZA 4CNIA 1A3LH 5TDPB 1TIUA 1Y6NR 3MCKB 3SGKA 1UG9A 3FKUS 4OAWA 1G9EA 4XVUC 1MHCB 4M48H 4LMQI 4U1NB 4PJFF 4HGMA 4GFTB 1H3TA 4FTVD 43C9B 3FONA 4Z0BH 5T3ZE 4R26L 4QHMA 2YPLB 1IAII 4XX1E 4NZDA 3MRJB 2A77L 3WUWB 1T0NB 1MCHA 1P1ZA 3V6ZA 3RPIA 3ZT7A 4R9HA 4NM8L 4WHYH 5AWNH 3VA2C 3WFEL 2FIRT 3A67L 3U2SB 4JPIA 2PNDA 2IPUG 4LQFH 3GSVA 3MV8A 5E1HB 2Y72A 5I76B 2R1XB 3FN9A 3HZVA 1II4E 3OSKA 1KTDB 3W11D 3LKQA 1A3LL 2IBZX 2ERJB 2A1WL 5FGBA 2P5EA 3QCVL 3UTZB 4L4VB 1A6PA 5DC0A 3FQRA 4JGJA 3VXSB 3HRPA 5J9PB 2IJ0C 4JFHE 2AJSH 1LO0H 2FX9H 3I6KB 1IJ9A 1NMAL 2X7LB 4HC1A 2FH6A 2FWOB 4GS7B 1TCMA 1DQQB 2X10A 2WWMD 5B39B 4JQIL 3VFMA 3R4DA 3FT4A 3PGDB 3VXQB 2AXHA 3UTTD 2VLKB 5E9DB 5CINL 3TBWB 3C2AL 3D0VA 5JW5B 1MHHA 4CGTA 5F6IB 2IFFH 4XCYA 4F33B 5D93B 4Y7MA 2IG2L 4D0DA 3GBMH 4NKIL 2VDOL 2C4XA 4PYGA 2Z8VC 2OR9L 4OCWL 3VI3E 4N0CD 1N4XH 1QYGL 3EDKA 4L3EA 3QUKB 4KI5C 4KH2A 1EEZB 1QSEA 4MCYA 4O2FA 4ENED 2Q87A 3QT2A 2O61A 5DMKB 5ESVB 1D9KA 5C0FA 4M43H 2H3NA 3L5HA 1GH7A 3DI3B 1DANU 1X7QB 5D2LF 1I3GL 1WSST 4FQCH 1VERA 4LGRB 4O9HL 3GSOA 3ARYA 4G6AD 4BFEA 3WJJC 1A6ZB 5DJYB 1ZT4B 1OQOA 4X4XA 4IDJH 2X4UB 3FFCE 1K85A 5DJAA 4EXPX 5B8CC 3C2AH 2WUCH 4L5FH 4PLKC 1T89C 2MTPA 4WW2C 4Y19B 1R3HB 3QIBD 3TN0D 5IVZA 2Y5TA 1DVFD 1G7PB 4PJAF 5FUZH 4MB4A 1IAKA 4YHIB 4ZO7A 3P4NB 1MHHB 3AM8C 1G84A 1Q0XH 1G7QB 1CVSC 3L5IA 4XP9L 5L6YH 4ZFOA 4OBRA 1AQKL 4L1DA 5C0GA 1MREL 5HDBE 1QBLL 5IV2B 4HULB 1MNUH 4DFIA 2VDRH 5JOEA 2YD7A 4QF1B 5CEXA 1WAAE 3UTZA 1MAMH 4OCRH 3AREA 3TT1L 3E2HC 5FUZL 4MMZC 1CD1A 3QNZB 1GGIH 5CKAA 4Z7UB 4P23C 3TA3C 4GMSH 2XV6B 3RPKA 3NACL 5EZLB 3G5XB 5L2JB 1NBYA 3FFDB 4YFLF 4MB3A 1I1FB 1KN4H 1CXKA 1P4LA 2NX5B 1CL7H 5JQHC 4F2MA 5E24E 2X4SB 1C7TA 3F6LA 3OKOB 1IFHH 2C3WA 1QO3A 4JVUA 1FRGL 3DTXB 4OB5L 4LPYA 1IGFH 5F7EH 5T3ZH 3CVIL 4U7KA 1BIHA 4RZCB 4N0UE 3BD5A 3ZKXC 2EE2A 1IQWH 1IGCL 4X6BA 5AD0A 5IJVB 5E6IC 3RNKB 3LN4A 4ZUWB 1EXUB 2YD4A 3WFDL 1W0VA 4HZAA 1EJOH 4N8VB 4QRSB 1R5VA 3T65B 2VDOH 2CKNA 1OSZB 4GKNA 5KVEL 3CFJB 2BDNL 4C57C 4HUXA 1J8HD 3PWNB 4P5MA 4Z0XA 3MJ9A 5IQ9A 2P5EE 4ZS7H 4WTWA 5TDPA 4TSCH 4FZ8H 2HTKC 1EHAA 3VRIB 1MCKA 4PRBB 4MS8C 2WK2A 1ITCA 1CVRA 4TNVK 5I1IH 4UAOB 2R0ZL 3D5OF 3GMOA 3B8YA 4CRPA 3HMWH 3F12A 5F7FA 1BPVA 3EYSH 3O0RL 4D8PA 1I8IA 4OIIL 1UWEH 4PJ8B 5A2JH 2AKRA 1QFHA 2W1NA 3D25A 4HWZB 5EZOL 3VJ6A 2ESVB 4RIRA 3BP6A 2FGZA 4LCCC 3V6BR 4ONHB 1GGTA 1J12A 2W9EL 1TLKA 2YSSA 2VL5B 3SN6N 1U8NA 3BX7C 1FNEA 3DX7A 3GMLA 5L0QB 5CHNB 1A2YA 3HLAB 4YDIH 4X8JA 2CKBL 1VEOA 4LVEA 4K94H 5I6XC 1WWCA 2NYYD 2X4NB 5IB2A 3SJVD 2WM0A 1KPUA 1YEFH 3CGTA 4QHUB 5DK3A 3JWOL 4F7MA 3F7PC 1I7TA 3LKSB 1AXSA 2V2XA 2BZDA 3I50H 1YY8A 3ARPA 1GZQB 3WYRA 1KIRB 4EI5B 1AFVH 3F7RA 1LK2A 2YPVH 1K8DA 3SDXF 5B22A 4F58H 4NWUH 4JG1L 5I8CA 1MCNA 2CUMA 4M4RA 1IC5H 4EUPG 4HKXA 2HFEB 1PY9A 3MOAL 1B6UA 3A6BL 4Y4FA 4NKDA 4LVHC 5ALCL 3BGMA 4DZ8A 4C83A 4DTGL 2IADB 3D3VD 3P0VL 3BQUD 4ONFH 4XP6L 3TVMC 3ZYJA 4JREB 2MPAL 3H2WA 2D0HA 2XN9E 2ADJA 3LRSA 5ICXB 3QUMB 1LWRA 1YDPA 5C7XH 4I4WB 4JHWL 5ACZA 5INDA 1CK0L 4TVSa 1YC8A 3OBAA 4YQXL 2CDGB 4PJ7E 5JPMA 5JXEC 5DXWA 5DURB 2BOCB 1OM3L 2VE6A 3UBXI 2FATL 1KG0B 4OGYL 1DEEA 3ZLQC 5E5RB 1S8DA 4G7YH 3AB0B 5DA4A 5DEGB 1ZLUH 1XGRA 2BC4A 2QSQA 1A3QA 5ICZB 3CK0L 3FQWA 4NKIH 1PQZB 4FHBD 3WN5B 1F4XH 3LKOA 1C5BH 5LGKA 1I8LA 4WV1A 3DGGB 1BM3H 4R0LA 3U4EA 2A74B 1J8HE 2FH8A 4U1KB 1C8PA 1KCSL 3FFCD 1IZKA 3QIUD 3T0DA 4JGMA 4DGYL 1AI1H 4QTHB 4WDIB 3VFNB 1LP9E 3M1BB 3S35L 5C6TL 4O2EA 4HK0B 3S5LB 2PYEA 4JKPH 5EOCJ 5I76A 2J6EA 3VG0L 1AJ7L 3M17A 1RZFH 1IGMH 3PWUB 3CXDH 5ERWB 1JWSA 2HFFA 5GZNC 3D2UB 5EBMB 4FQXA 5GRUL 4WUUD 4LIQL 3WFDH 4UOW1 4MD0A 4UUJB 5BS0E 4KMLB 4XBEH 4ZFOB 1VFOA 1FH5H 1R3LB 3FN0H 1U8OA 3U7WH 1MI5D 4BH7B 2NX5D 5E2JA 3RA7H 3U7YH 4KZDL 2VISB 4TQEL 2DRUA 4PJEE 3PGCA 1HHGA 4EN3B 2IGFH 5T3ZL 3GSRB 5HGAB 2OJZH 2BSSA 3BKML 4P5KA 4NHCL 4RGND 3LEXB 3HMWL 1HHKA 1K5NB 1NC4D 4QXGH 4X4XB 3HNTH 1AFVL 1MCRA 3GSOB 4MDJB 3BE1L 1CT8B 1NGZB 1UM5H 3BOVA 3W0WA 5FYKH 3ULVD 2YZ8A 2NX5A 4TQEH 2QV2A 1OP5H 1U93A 3CZJA 4OLWH 3OJVC 3WEXA 1X9QA 4PJ5A 1VEPA 5E56A 3QDGD 3VXUA 5JORA 4N0RA 5GS1A 4AEHH 4JKMA 4YDIL 1KLFA 1T20A 4LSQH 4PJ9D 2X4TB 4DKEH 2EIDA 5C9JB 1H15A 5HVGB 4OFYD 3D3VE 1YEDB 2I5YH 1RVFL 1P53A 4YR6A 5IW1A 4QF1A 1KJ2H 1FGNH 1S7WB 4PBXA 2XN9D 3LCYA 3B83A 4WO4A 4YFEA 4G6ML 1RIVH 2YD8A 2ZNXA 3MA7B 3Q3GB 4QKXB 1AD0B 1MAKA 5IFAH 4XC3L 1F4WH 5HHOB 5FHBH 2Y23A 2AK4B 4HFWB 5ITBL 4M8QB 3MJ9H 4WU7A 4A6YH 3C09B 2R9HD 5MEPA 1LNUA 1XGUB 4GAGL 2DLGA 3S8WA 4ZG1A 4X83A 3T2OA 3GSXA 1DQQA 5B39A 4ZS7L 3WFCL 1PVHA 4KROB 4C56E 4NBZB 2JIXB 1UQSB 3P73A 5B3NA 4ZUUA 1NCUA 3EYUH 4LLQB 3ZDZE 4GW4A 2DLFH 2OYPA 5CJXC 3L3DB 2D2OA 3RY4A 3V5DB 4NQSB 1N6QL 2FHCA 4HMEA 1H3XA 1G7IA 1CDJA 3QDJA 4M7LT 2X89A 5EBWA 3U83A 1QBLH 1VGKB 2VXVL 3TBTB 5LQBH 5EA0L 4Y5XC 4I1NB 5DHVH 3PABA 1PD6A 3ARDC 1HKLH 2AJVL 1CF8L 3E3QC 3MJ7B 1S7QB 4U1IA 1HHHB 3A6CL 3NPSB 3CFJA 1DL7H 3SDYH 3BZDA 4S1SL 4PLJC 1TJGH 3VGHA 3GSQA 1INEH 1R3KA 3NACH 4N90D 4POZD 5AZ2H 2V2TB 1I9IH 2BSSB 2ADGA 4M03A 5F7UA 4X6EB 5DRXB 1KXVC 2NTFB 4Y2DD 1JPGA 1P4LB 4Y5YA 1S7VA 5KG9A 5FM4A 4MXWH 3DRQA 3BPCB 3QO1B 1UVQB 1MRCH 2EXYD 2ITCB 4DGVH 1CGXA 3RUGF 3D39E 3CFBA 1U3JA 2E7LA 4PY7B 1ULVA 4O00A 1A9EA 5ESQB 5IBLC 2JJSA 4WU5A 4YDKH 3EYQD 4KROD 3VFWA 2H9GA 2AVGA 4MQSB 4M1CC 5CJXA 3RWCB 4OGXL 3O3BA 1WWBX 2J8UB 3BKJL 4KV5E 4OCXH 1AGBA 1QNZL 3GHEH 1E6JL 2AK4D 4XNMB 1CFNA 1E4WL 4X5XA 5C0GB 1OF2B 3GMPB 5DD0L 3QFJE 4ZUVA 4FQPA 2XPGA 2XTJC 2EO9A 5D9SA 2VITA 3ZKXB 5HHOA 1F6FB 1WIUA 4L4TE 4ZS6D 1MCPL 2CXKA 2VLRA 4GBXB 1QSEE 2V9TA 5T1LD 3EYFA 4YXLL 5GRJH 4Z7NF 4Z6AT 3H0TB 5DO2D 4PRNA 3BMWA 1K4CB 1WV7T 4HCRL 1LP9B 4M61A 5F1OB 5D7LE 4GG8B 1PAMA 5FGBC 4QRRD 2FJHB 4QHMB 3KYKL 5LGHL 3INUH 1FZOB 1YEEL 4XVTL 3CFBB 1CIDA 2EDJA 1MQKL 2EEBA 5CEZL 1N0XH 2QQLH 5DK2A 3SKNA 4GQPH 4OLZH 2APFA 2FHBA 5HYQA 1Q1JL 4JVWA 1UXWA 4GSDH 5FIEA 4Z7NE 4MDIB 2YPVL 3I02A 3T4AB 5D70L 3GIVB 25C8L 5J6HA 2DQFA 1U8MB 2NY1B 3TYFB 3SOBH 4J3WA 4I77L 1JPST 5L0QC 5JR1L 2IWGA 4ZTPH 4WUUB 4U33A 4Z0BL 4XNYL 2VQ1B 4JZJC 3Q6GL 5F93C 4LARL 4X9GA 1N7ML 1UCBH 1UZ8A 3WIIL 2FX8L 4ETQB 5IQ7L 5CD3A 1NUDA 4HS6B 2FRGP 1S3KL 5DJ6A 1FNHA 2BY2A 4P5TC 5D71L 4NM8H 4PGCB 4P23A 3TA3A 4QNPF 3M1BA 3WFEH 2ESVA 5F6HJ 2Z31A 4UBDC 3THML 4HXBL 1EGJH 4R4NC 2IANB 5DMJB 4OUUB 1A6AB 1CR9L 3TZVC 4DKFL 2NTSP 3TWCL 3MV11 4F57H 1INDL 1HILB 3D85A 3R06A 4OF0A 3B9KD 1NGQL 5CZKA 1T2XA 4NZTL 5ICZA 3MRBA 3ABZA 1I7RB 3IF1B 2CLVB 4MA1C 3Q3GA 3GM0A 3LKOB 1P5VA 1Q0YL 2DDQL 1NGWA 1MQ8A 1UZ6F 4QRQB 5B38G 4G9FB 4G5ZH 4Z95L 3PP4L 1T1YB 4NC2B 4I0PC 1TJIH 3SDAA 1CU4L 2E27H 4K23H 1I3UA 3S37X 1HQRA 2YXMA 2WLYA 1WWAX 2VXQL 4LP5A 5DJYA 4U1NA 2JCCE 1I8KA 1MOEA 3V0WH 5TQ2H 1RZJL 3S97C 1KJVA 4KHTL 2IBZY 2QL1A 3MRRB 4U6XA 4ERSH 3T3PE 1J05B 4HHAA 2JELL 3CXHK 2VLJE 2ADJB 3F7YB 5I0ZA 1BIIA 3QIWC 1PGRB 3BHBA 4BFIB 3L9RB 1FFNA 4OFPA 1TQCC 4CU8A 3OKNB 3SDCD 5DK0A 4ZSOB 5TPWL 1ZLSH 5DD0H 1WZ1L 3EOAA 2B5IC 1Y18A 2BVEA 3SDDB 1GRWA 3DMMB 2H32B 2EYTA 4K7PX 5D1XB 1G9NH 1LNUB 1XGUA 2FGWH 4HKXB 1KELH 3OGCB 3S5LG 5KVDH 2NY4C 5M95B 2EXYC 1ZT7B 1CE6B 1DEDA 1JZ6A 1RZGA 5MERB 5TQ2L 3T0BA 3W2DL 1CK0H 5IB1A 4OFKA 4WWKA 2X4RA 5F7HA 5IHBA 2Q86B 4MQ7A 4Z7WF 2ZCKL 4PGEB 4NUGH 1V3KA 2LU3A 3QB7C 1NEZB 2IQAB 1UCBL 5EORL 2NZ9C 5CJQL 4KJYB 4YR6B 1TMCB 5I75B 1CFSB 5H37G 5F9OH 4L9LA 1KPVA 2XKNA 1TDQA 3DETD 3DV6B 3FRUB 3RWCA 1ROWA 3X14A 3WIHL 4Z7UE 3KLHD 3MRMB 3TJEL 3BHBB 3GSVB 5D1ZA 3VWJB 1XCTA 5L2KA 1JZ7A 3PWVB 3PNWA 3DUUB 2APWA 4FABH 5IVXF 1I85C 4K7PY 3U7AA 4HUXB 4P5MB 4PJXF 4Y4KC 5IQ9B 3RAJL 1CFVL 5TDOB 1VA9A 1MFNA 1PJ9A 5HGAA 3L7EA 1RIHL 5H37H 4WFGE 1L0YA 3TYGL 5J89A 1A6TB 4V1DE 2FX8H 2YUWA 1JJUA 2EE3A 2ILLA 4FRWA 3NIGE 5GRUH 3FO1A 3H3BC 5ESAA 1KB9K 2YOCA 3LQAC 1RK1A 4OUOA 2AQ3A 5HI5D 4HH9A 5C09B 1T5XB 5SWQA 3D9AH 3QCUL 4R4FH 3BPLB 2R0ZH 2SEBA 5C0AA 3WFHA 5LXGH 2KL6A 4UUJA 3D0VB 4AG4H 5JW5A 1F13A 4L29A 1T7VA 1D5IL 1WT5A 1JPFA 1PBYA 5C86A 4N0FB 5CBEA 2ENYA 1J1XH 4URTB 5KSUB 3GMPA 2M2DA 4LRNH 3S96A 2VLJD 4F15C 1LE5A 4OQTH 3TFKC 5M94B 4HWBH 1G6RL 1RHFA 4H8WH 5J13B 2R69L 1HYSC 1U92A 2GHWB 3NIFF 5BV7B 3BZ4B 2FZ3B 1WISA 3FTGA 3LOWA 3Q6FA 1A47A 1BJ8A 2N7AA 3PXHA 4KQ3L 2EDHA 4ZFOL 1CS6A 2NZIA 5DJDB 4TNVF 5H35B 3D69A 3NPZB 1MJ8H 1JUFA 2GAZA 2LQRA 2XT1B 1C12B 1CD1B 1BVKA 1EERB 3QNZA 4P4KC 2Q8BH 2OL3A 3RWJA 1WCQA 5K9KB 1GGIL 1MCEA 3T2NL 1QA9B 4F57L 4YBLB 4LF3B 4ZTPL 2Q86A 3QHZL 3MBEC 3QJHA 4J2XA 2FJFB 4WY7L 2IPTH 4JR9H 1RK1B 4O2CA 4PGDB 4KKLD 3F58L 3MOQA 1MUJB 5C2BL 1CGSL 4YHIA 5JZ7C 3NFNB 4GQ9H 4WFHE 4MXQD 1AE6H 5FA4A 5D7SH 5F9WB 2P48B 5F7NC 4UOJA 3SBWA 1IAMA 5F9OL 3MZTA 4KZDH 3HNSL 1G7JB 1WBXA 2W38A 1KC5H 3OAZH 2XG4A 5IW3A 5C0EB 4QTIH 4ZPTA 5I1DB 3QUZB 5FYJH 1MCWM 2H3NB 4GO6B 3ILQC 4J6RH 2J3SA 1CL7I 2AEQH 1A4JB 5C0ND 4MNQA 3VFSB 3O6ML 1F6AA 4ORZC 1OSPL 1D9KC 1LP9F 1WBZA 1HIML 2OR8A 3LDBC 4LLUA 4G8EB 5DMGC 4M6MH 3RU8H 1MH5B 4N9GA 1HQRB 1ZANL 1C08A 4FA8A 4RFOL 1G7HA 5IM7A 4P5KB 3EOTH 2HG5B 5EO0A 1EFXB 4XP5L 1MFEH 4RFEB 4JO1L 1CGSH 3G5VA 4ZNEA 3S4SB 3WBDA 4G8GD 1UWEL 4ONHA 5T1LB 1EX0A 3LAFA 5I1KL 4IIQC 1J7VR 2AEPL 4WGVB 3LS4L 3PHSA 3R06B 4R8WH 2YMXH 5D72L 1KTLB 4LSTH 4PRPA 1BAFH 3IDIA 4QCIA 3O2VL 4ZUVB 1BBDL 1WTGT 1YPZB 1VKXA 3RZCC 1QQDA 3L95B 2NNAA 1GOGA 4J1UB 4IOFC 1U8LB 1IQDA 4XP6H 4XWGH 2R0LH 2GITA 4P99A 4RMRA 2ENSA 2YK1H 1JZ3A 4ZUSB 3GI9L 3N1MC 5JW3L 1U8QB 2P5WA 5KAQG 3ULVE 3GBML 4MNGE 4X7SL 4XP5H 1ITBB 4X99A 2DQIL 1UCTA 3ME0A 2EZ0D 4LLVA 5JHDB 3Q5OA 1OWWA 4AZ8A 3C8HA 2VDLH 3VFTB 4TTGA 3SDXA 4G8IA 4HXBH 5K59E 3WKMH 5D2NA 4FS0A 3G6JB 2YPLD 3F7YA 3KJ4B 2XQYG 5FM5O 1UACL 1YEJH 1T5XA 5CEYB 2A6IA 4AT6B 1MJUL 1KCRL 3GGWB 5E5UB 1NUNB 1KLGB 3WFHB 5F89A 4QGYA 5E9DD 5IR1A 4XXDA 5CJBA 2FL5B 3QNYB 3ES6B 5CILH 2H2PD 4WUKL 3DJ9A 4XNZB 1UXWB 3QDJB 1CICD 5IEKA 1PYWB 3UJTL 3TO4D 1JF6A 3PWVA 2EDYA 4XVSL 4GBXD 2W65B 1AR1C 4X4YA 3R1GH 3RUGA 1AGFA 3PL6C 4UINL 5F9JB 1A3RH 1IC4L 3SE8H 4KXZH 2GJ6B 3OR6B 1QQDB 4QHKJ 1S7TB 2R1YA 2BVQB 4JO3L 4KU1A 4NFDA 2FJHA 4OZGF 2XZZA 4RGOH 3SGEH 2OMBA 4PJFB 5FO9B 1PZUB 2JE8A 1YUHB 3DGGA 1YNLH 3HS0B 3GRWH 4UQ3A 4X6DA 1RZJC 1ORQA 5DTFA 4YXHL 1JE6A 3GSWB 3HR5B 3RTQB 1AIFA 1FBIL 4KTDH 2L0DA 1IAKB 2QADC 1LD9A 2WBJD 4U3CA 3DX8B 3GMMA 7FABL 1U6AL 4R7DB 4ZQKA 2F5AH 1Q9KB 4RNRA 2R4RH 4U1GB 2EYTB 4JY4B 1XGQB 3FB8A 4IRJA 5LGJA 3VG0H 3VGAB 2F58L 3DLQR 5D8JL 1MFDH 2UWEE 4Y16D 3IFOB 4ACPA 4X6CB 3SEPA 1UWGH 4DVRL 15C8H 1DCLA 5CWSB 3VFUB 1F3DJ 4PJ9C 1JTTA 4XCNB 1A22B 1A7OL 3ARBC 3O9WA 3C8KB 4PJ9B 1IGFL 5F7EL 3NCYS 3P30H 3G9AB 3DWTA 4X4YB 2BNRA 5ID1A 2D9CA 4DZ8B 4G42A 1JGUH 4L3EE 2JCCB 5FA3A 4YE4H 3DMMC 1IE5A 2WW8A 2B1HH 5I1EL 3EHBD 4OD1H 5D6DC 4WTZA 1ZLVH 1PLGL 1FG2B 1EK3A 5DDHA 2Y6SC 5DQ9B 4XNQA 4WFFE 4MD5B 4FFYH 1RZIA 1MY7A 1BIIB 1R3IH 2B0SL 4GG8A 4L3CA 5E9DA 3BAEH 3MLZL 5HYSG 3EO1A 3T1FB 4GKSB 3D2UA 1MREH 2AXGB 5EBMA 3PWPE 3P0YL 1U91B 5KS9B 4KQ4L 3U0TA 3IF1A 4LSRL 3TBWA 4HW6A 4M9PA 1KLUB 5DRZA 1MI5B 1NCWL 2I26N 1I1YA 4M5YL 1OF2A 4JANA 5KSVB 3BJ91 2DI8A 3Q6FB 2P5WD 2DWDA 3HZYA 3O3DB 2JJVA 5ALCH 4IRJD 3CFKA 3D69B 4YDJA 3AVEA 3E2HB 3MXVL 1S7SA 1BQLL 2ICWJ 1EMTL 2DQIH 1NANI 4PJ8A 4XP1H 3PQYD 5BMFL 5I1HH 1B0GA 4PJXA 2ICWB 4I18A 4QXUL 1LEIA 2BK8A 1J86A 3QIUB 1XGPB 3RVWD 4M43L 4LAQL 4DW2L 1JPFB 4Y89A 4Y4KB 3GIZL 3NZHL 3FO9A 4MJ6B 4TUJB 4YK4B 3OKYA 2IPKB 4P2QD 1WAAF 3RWEB 4CADB 4HS6A 4HEPG 2GSGA 3GKWL 5F7YC 4ZDHB 1KCUL 4FOMA 1TXKA 4M5ZH 4PUBH 1OP3K 1Z9LA 5ACZB 3NCMA 3O4LB 1RUML 1L7IL 3GJFK 3JUYA 1ES0A 2C3HA 1Q0YH 2DDQH 1U91A 5KS9A 2R23B 2XOTA 4PJHA 1QEWA 5KZCD 3OAYH 2VXUH 1CLYH 1S7QA 3IDGA 4C56D 4QRPB 4N0UA 1WBZB 3PUCA 3TV3L 5FKPB 1J88A 3TO4A 1HQ4B 5HY9B 4X7EC 2P8PB 1T2QH 5J6HB 5TE7H 5IROC 3RY6A 3O6FC 5I1JH 1A7QH 3BGMB 4BQ6A 3VD3A 2HT4D 1D5ZA 4MDJA 2ZCHH 3O8XB 1Q9LA 1RUPL 4B41A 2XACC 3BQUB 3KYOA 2W91A 3B9KC 4J12A 3DVNA 3OJ2C 3G5XA 2ZUQC 3ZSSA 4Z7QE 4JVPA 4ZXBA 2ED8A 4XVTH 3MOBL 4YNYB 3ZKND 4LLWA 4UINH 2XRAL 1PG7W 5DO2C 3LZFH 5DA0B 1S3KH 4Q2ZA 1MCJA 1GIGL 4QCIB 4EI5D 4P59L 4AY0A 3BPOC 1AO7E 4W6YB 3TYGH 3REVB 2CJUL 1OVZA 2XZAH 3TBYB 5D5MB 1GHFH 3CJJA 4JY4A 3UTPE 3EJJX 1YY9D 3MRBB 1PW3A 2JCCF 3KPRA 2WBJC 1G1YA 4PJAE 5I30L 4LOUC 3F62A 4GAJH 1YYLL 2EICA 1X5LA 2OQJB 2I9TA 4P5TB 4CVZA 3KPNA 4HPYH 2GJ6A 3OR6A 4RAVB 4AH2A 5A40E 1U42A 4DCQA 5HGDB 5HDQH 1WQVT 1YYML 5C08D 1KN4L 2FCBA 4EDXA 5BS0B 1MHEA 4OLZL 2VSCA 4Z0XB 1FORL 1FV1B 3MNZA 4PRBA 5DEZA 4FZ8L 5I19H 2FECI 1OLZA 4NQED 1KB9J 2EH7L 2BVTA 4KK9C 1OAYL 4ZAKB 2G9HA 2ZSVB 1C1EL 3SDCA 4JPKL 5GGSA 4B53A 4N0FA 3QUML 1IGJB 2DLIA 1RU9H 3JBG7 4P2QA 4MX7A 3RHWF 3ZDYF 2DYPB 4CVXA 1UWXH 1YPZF 4X7CC 2Y5EA 2PYED 2A9ML 2B1AH 1BVLA 4FZEH 3FO2A 3VRLE 3QXAB 3MODH 4RX4A 1GJIA 4BUGA 4YDLB 5IEKB 3CMOL 7CGTA 3LEVH 3GBNH 2O5YL 4MNQD 4B5EA 3U0PA 2V2TA 3EDDA 3OHXB 3S6CA 5KW9H 4WHCA 3M45A 2QTEA 4PJDA 4ODUA 3LN9A 2CLRB 2X4OB 2ZPKL 2EIEA 5CP7A 5D7IF 3OAUH 1PZ5A 1T4KB 1FVCB 3SDXB 1PSKL 4P2OC 5D1ZC 5IP4A 5D7JB 3IU3A 2EC8A 5SWSA 3VD5A 3RWHB 2JB5L 4WI2A 5L7XH 3LQMA 5KTEL 1DBKL 4RFNC 4PJXE 3U1SH 3B3IA 3VXPA 4D9QD 1WCBA 5ISZD 1I1FA 4HQQL 1A4KA 4RDQG 3GJFH 4LNVA 1FV1A 5GGSB 2AEQL 4MXVF 1D5XB 5HHOE 1I3VA 2R2BA 3HCVA 3PP4H 2MQCA 4R97C 1P7QB 3LKQB 1RY7B 4HKZA 2WLZA 3FO0H 1XGQA 3ZT5A 5B8CB 1E27B 4QHUA 1NBZA 4RMUA 5D9SB 1ZKAA 2YPLE 3UBXB 5IESL 3HMXH 1QRND 1S78D 3HI6H 5KSBA 1FLTX 4HFWA 1T1XB 5MEOA 3T3ME 5T1MB 3WO4B 5C8JA 4JQIH 2CDGA 4X6FA 5JPMB 1OTTD 1D7FA 1KEGH 1F02I 5I75C 1A6ZA 4PLKD 4DUVA 1N64L 3QDJE 2AJUH 4MXVE 2XA8L 3PP3H 3QDHA 4HIJA 4JR9L 4KRLB 4JRYA 2GCYA 4XNQB 4LU5L 3T4YA 1N0LA 4PR5B 3I50L 1FZOA 3DVNB 4DEPC 4FQJL 4KKCD 4R4BA 1IEAB 4ZXBB 2B7DT 5J6GA 3QJFA 5DRWB 2EEDA 1P2CA 2F58H 4PJEB 3HUJE 3BDYL 1UADC 4AMKH 4N8CL 3JWOC 1KFAL 3PWJA 5F1KC 4NJAL 1T21B 3NTCL 1KJ2B 3VD7A 1FZKA 4PJCF 2AV7A 2X4PA 2X6MA 3LB6D 3OX8A 4MD0B 5D5ME 1FIEA 5DHYB 5FHAH 2Q7NA 4N68A 4BSVA 5TH2A 5D1QD 3UTSE 3CMOH 1F90L 3EAKA 5FGCE 1U2HA 3TCLA 2XFXA 4PB9H 3FT2A 4OQ1A 1CLYL 2CGRH 4KK8D 2AXFA 4N8CH 3ROLA 4QO1A 1NLBH 4O4YH 3UTTB 1YN7B 1AXTL 4C56A 2DQEL 3QXTA 5MERA 3F65A 4X6DF 1U8PB 1P9MC 4PJDF 5F3BB 4NPYB 1MRDH 3MNZB 4WI7A 5E6YA 1A6AA 1QBAA 4QTHA 3VGGA 2XXMB 4HWZA 5C6PB 5HYEA 1RPQA 1CZ8L 2UYLA 1P7HL 5DMGD 3G6AA 3T3MF 4LQFL 3VXSD 3EOYG 5IIEB 2R1WB 3IFNL 1BBDH 4NJAH 2YC1A 1W72B 3EFFA 5ENWA 4EEEA 4LKCA 3KPMB 1FGNL 4P46B 4PRAA 4WW2B 4XRCB 3J7HA 2H1PL 4GW1A 2FO4B 3AU1B 1XZ0A 3BP4B 4JFZH 1UJTA 1E6JH 5IB3B 3S88L 1ZT1B 3NMEA 1JCKA 3V52H 4Z77A 2BOCA 1OD9A 4J23A 5BXFB 2EKSA 5H8DA 4ONGL 1H8SA 2V2WB 3MLRL 3W9EB 2X4UA 3AMLA 5CMAB 1H3PL 1A0QH 5GGSY 3DVFA 3X3FH 3MRCA 2CH8A 4HJJH 4EOWH 4MD5A 2QJDA 1MNUL 4E41D 4JO2L 1OGAE 4IBLT 3K46A 5JMRA 2DS4A 4X80H 1FG2A 3QDJD 5DDHB 3X11A 2OZ4A 1KCSH 3ULVF 4DGYH 4JB9H 1C1EH 3CC5A 4KK8C 2OL3H 4GW4B 3X13B 2VMFA 4M1CD 3UYPA 4NQSA 1YNTA 3G6AB 4MNGA 1NFIA 3MSPA 2XY2A 3O3UN 3HMXL 5TF1H 1BBJB 1YPZA 4PTUB 2DM3A 3FHQA 4F7MB 4AEIL 5CEXB 4V1DD 3C8KA 1KPRA 2COQA 1CLCA 1DFBH 2Z91A 1T6WA 4XPBL 4EBQL 1TCRB 4OQTL 1ZLUK 1U8OB 4S1SH 3PGFL 4L4VD 4U4BA 3I3BA 5C2BH 3GBNL 3EYSL 4XP4H 4UQ2B 4M8QA 2W07A 4PRIB 3CLFL 4OM1H 4J4PA 4M1DH 3C5JB 3KS0J 4G8FA 1BMGA 1UZ8B 4PS4L 3MGOB 2ZJSH 3QEHB 4ZFFB 1T7XA 2Z31D 4UDUB 4M7JL 5SWZE 4ELMA 4RX4D 1CTOA 1R3HA 1BVKB 4NZUH 3Q5TA 5C9KA 2WBWB 1I8MA 2FX7L 2VABA 2XTJD 3C60C 2VH5H 3NA9L 3IXAA 1Y6KR 4IS6A 2AV1B 3TVMA 1IL1A 4K2UL 2IH3A 4U0RC 1T7ZA 3P0VH 2BRRH 4HLZH 4PJ5D 4BFIA 2NY2D 4Z95H 5EU7E 4H26A 3X11B 4OCXL 3LIZH 5MI0B 2DBLH 2GTZA 2ZG3A 3FB5B 1KG0A 3K8MA 4ETYA 5MI0C 4YX2H 4JG1H 5DT1L 1UFUA 4JFED 5FECA 2X1WL 5LAXA 1UM6H 2DMBA 3KVQA 5F9JA 3KG5A 5I15L 3PGCB 3U9PL 4DFHA 2W65A 4N0UB 1QLEL 4G6MH 4X6EA 5DMIL 4GG6E 4PJDB 4FQ2H 2YN5A 3X17A 5EC1A 5KG9B 3NOIA 3WIIH 4HD9A 1LO4L 4AMKL 3RGHA 3OKOA 4NFBA 2XXCB 1A6WL 2EE9A 4Y8AA 4Y4HA 3BH8A 4P3DA 3QJHB 4GBXA 3ALWA 4FQXD 1RK0B 1OTTC 2XTLA 3WO4C 2I60L 5T5NG 3Q48A 4JQXA 3VFMB 2K7PA 3THMH 3PWUA 3VXQA 2OM5A 1XH3B 5FB8A 4JZOA 4WUKH 4Z7VF 5INCB 4ZXBD 3WJJA 4OIIH 5J12B 3QQ3A 2DI9A 3UYRL 2A6KB 1YJDL 4H0HB 1IL1B 4E41E 4LLDB 4GRLC 4LDLB 4HWEH 1QKZH 4OT1H 5CP3H 1Z0MA 2HWZL 4LKXA 1CYGA 2A73B 1IKNA 3V6OE 2C3XA 3L95A 1X6NA 1QHPA 1S9WB 2NY0C 1YEGH 3DSFH 3KPTA 4C4KT 4OCRL 1MFDL 4AH2B 5JQ6H 1TJHL 1U8KA 4OTXL 2KQNA 5L8KB 3EYQC 3BRGC 1UM4L 4FN0A 1FNSH 4NWTL 4FTVE 5CJOH 1XF5B 4YHNA 1DDHB 3QQ9D 2VWEC 3S9DB 1NPUA 3MCG1 3BISA 1D6VL 3LEYH 3O45B 4I8DA 5F1IA 3MLXH 1OPGH 2I9LA 4U1HB 5FYLE 2QQQA 5FHAL 1NAMA 1R3JA 3FZUD 1N0XL 2VLJB 3RP1A 4HC1L 4OSUL 2NXYD 3QUYD 5GZND 4WNQA 1ADQL 1F4XL 2QHRH 4JQVA 4NRZB 1HNFA 2XTJE 3PWJB 5DS8A 3RIAK 5DJ0B 4JJHA 3ESUF 5MEQA 5IBLD 3CFCL 5DZOA 3X13A 1YN6B 3FJTA 1QD0A 4WENB 3MREB 1NDGA 2BSTA 1AHWC 2PW1B 3VXRA 5KSAB 3QH3B 1BVZA 4WI6A 5D7JD 1AO7A 1MWAB 1H3GA 1AHWB 5IJKC 3BXNB 1INDH 4M1DL 4CMHB 4WEBL 3FCTB 5C0JB 1JPSL 2BNUA 2RB8A 4TOYL 5BXFA 3T0EE 2H32H 4JRYB 4LHJB 4CMHC 1YMMB 1IEBA 3AXLA 5DWUH 3IDGB 2ZZUT 4PJIA 3GSXB 4YC2C 3C5SB 2F19H 4QRQA 3QULB 2DM4A 4KRPC 4LPUA 5FFLA 5ETUB 4MVBC 3TIEB 2E27L 2GEEA 4V2BA 3SQBA 3FQXB 3GSWA 4EKXA 3V52L 1HCFX 3HNSH 3DUSA 1EUUA 3TVMD 4ZDHA 1P7QA 3QQNA 3HR5A 4DOHB 4JFOA 4WO4B 2VUOA 3RZCD 4KXZI 1KCKA 4CMMA 5I71C 2JKXA 5IEHA 1U8LA 3NCJL 3PXJA 1HEZB 2ORBH 2CK2A 2NNAB 1PFCA 3SGEI 3X3FL 2Q8AH 3VGBA 1KULA 5C0CB 3F7VB 4OLXL 1QLFA 2FEEL 5DJCB 5JHLL 1Q1JH 2EDWA 2Z31C 4W6XB 3VH8A 2JJUA 2MSPA 4GKNB 3RGVC 3VWKD 2P7TA 4KUCF 5HI4D 5AZ2L 3IRPX 1RURL 2BSRB 3O8XA 4V1DA 4KKCC 4JFHD 3VFRB 3ZKMD 5ALBL 5T1DL 2KKQA 1I3RB 4DQOH 1KIPA 2RCSH 5CD5C 4JDTL 3MTRA 3DURA 4L1HA 4Z7UF 5EZOH 3O2DL 1OTUC 4U6XB 3VRLF 1SJHA 3VI4F 4L8DA 1JZ4A 2YZ1A 3CNKA 3K3QA 5E6IB 2ARJQ 3K4AA 3QJFB 1N3NA 5DRWA 5D5MF 1R3LA 3SDCB 3PJSB 4EI6B 1A1OA 4M6NH 4XCEB 4X7TA 3BKYL 3PHOB 3C60B 3MREA 3EYUL 4GLRH 3RDTD 3GMRA 3FB5A 3DXAA 5MENB 1BOGB 4KTEL 2OR9H 4OCWH 2E9JA 3V8OA 3OAZK 3PNWB 4XPAL 2B2XH 5T1KD 3VD9A 4MLIA 5A3IC 1KTKE 5B39G 1E4KA 2X1XR 3DUUA 5HD8D 4JY5L 1ZEAH 3H0TA 2X41A 4XPFL 3OR7B 3ZDYE 3MRFB 1BD2A 2Z8WC 3UO1L 2YD9A 3LPGA 1U8PA 1RUMH 1X4ZA 3QIBC 2JIXA 4NNPH 4AM0A 4CW1B 1BECA 5IVXB 1DDHA 3IDXH 3Q5YA 5ID0A 1Q9WB 5JTWA 5JXEA 5D1ZD 1LD9B 2X09A 3HFMH 1OL0A 2PYEE 4MD4B 4IOSD 3OG6B 5IMOB 4MXWL 1G7PA 2DIJA 3QZWB 4KKBD 3L3JA 4LAJH 4X9IA 2VAAA 4AQOA 4LNRA 4ZOAA 1GOHA 4LPVA 1ZV5A 2X4PB 3DV4A 4MDIA 2BVPB 4JFEB 1NGYA 2ZCKH 2DF3A 2PO6A 5ESVA 1QBML 1WZKA 2BSTB 1BQHG 3UMTA 5I66A 1G6RB 4I77H 1AGFB 1G6RH 1A6VL 4JFYB 3PIQB 5H94A 2OJZL 5AAMA 2NMSA 2ZUVA 5D2NE 2VQUA 1KELL 2GK0A 1GC1H 3WSQH 2OP4L 1R5WA 3MRCB 1D5ZB 3MRLB 3V4UH 3SHSA 3MRJA 1KLGA 1K5NA 3STBA 4PJGA 1L4IA 1DVFC 4JM2B 1IGML 1FAIL 4YHKH 5HD8C 3RVXD 4RZCA 5IHUH 5JXAH 3SGKC 5JPNB 4LKCB 2X9WA 2VDPL 1HHHA 4FQXB 4O9HH 5F6IC 1LK3L 5JMOC 3GHBL 1JGVH 3AU1A 2EDLA 3UDWC 2GJ6D 4PV9B 3O41B 1WFNA 1EPFA 3EDJA 3P30L 1J0KA 4UNVA 4F8TA 2VXTH 3CDCA 4IMKC 5J9PA 2KBGA 2FZ3A 4QWWC 1S9WA 4HG4J 1CDHA 2J12B 3N85L 1DLHA 4N5ED 1NBYB 5E1AA 4QTIL 1YEKH 1CICB 2MQ0A 2P5ED 1CLZH 4ZSOE 1LK3H 3KPLB 5HHVL 4P4RB 4JQXC 5CEZE 5KSAC 4HT1L 2R4RL 5IHZA 5D96B 4JZOB 4MQ7B 2A83A 2O5ZH 3T0EB 1I7UB 5FYKE 1FORH 1FO0A 2QKIB 1RULH 4TVPD 5K9JL 1H0DA 1RAMA 3O3EB 4MJ4A 2SEBB 4L8BA 1VDGA 1DBMH 2CK0H 4C55A 1CCZA 5IGXH 5DC9B 1RFDH 4ZUWA 3UTOA 5HHMD 1QPPA 5LQBL 3QUMA 5IQ7H 2N4IA 2RCSL 1FC2D 1H15B 1GGCL 1TQBB 5CSZA 3PE9A 3NAAL 2J6EL 1H5BC 4OTXH 2D7TL 3L1OH 5HHMB 2DQFB 3RUGE 5HYFA 5C0JA 4P3CH 5FECB 5EPMA 2G5BA 1PLGH 3B9KA 1ACYH 3HC3L 3LN5B 1JBJA 3PL6B 1LK2B 1QFUL 5J56B 4TN9A 4X7FC 3QA3A 3WFCH 1G7LB 4ZXBC 4R96A 3F5WA 2CIIB 5HGHA 4HHAB 5F8RC 3RDTA 4YZFE 2AV1A 3TWCH 4OD2B 1F3JB 4JY6B 4QXGL 1M7DB 1LO3H 3P2TA 4OCLC 4YHMH 5IBTH 5F97E 2VDLL 3WS6A 4KVCL 3JV4A 4L9LB 3WS3B 1NEUA 3U6RB 3WKML 1P7KB 5I2IA 1WUNT 2QQLL 3LQAL 4H1LG 1T0PB 4WCYL 2ZUTA 4G6AC 4X8JB 2NR6D 4JFFE 3W39A 2HFFB 1GGCH 2WBJA 4YHYB 2RHEA 5J11C 3T8XB 3BMVA 3TV3H 5FDWA 4AEEA 3CX5J 3BZFB 5CCKL 3B43A 4YHYC 3TLRA 5GS0D 3QPQC 2MCPL 4CVWA 3OKLB 1SMOA 2V9RA 4TULH 5B8CA 4K3JH 4YQXH 1XF2B 5MHSE 1F58H 5EB9A 1I85A 3EUUA 4MQXD 4TSAL 2D7MA 3MNVB 4LPTA 1OARL 5H35A 4EUPA 2XWBA 5DT1H 1FZMA 2PTVA 2LTQC 5JZ7D 1KB5A 4P9HL 1BD2B 5DF0A 1C5BL 1KTRL 5L2KD 2OXGA 3ARFD 1XF1A 4PRHE 1GZPA 1BM3L 1PX3A 2IH1A 4MA3B 2MCPH 3KYOB 5TPWH 2BMKB 1EEQA 3PL6A 1NFDB 5DVMA 3W0WB 4HV8B 4OCNC 2X44D 4DN3L 5M7QA 5INCA 1U93B 2XN9B 2DAVA 4ODHL 5DJZA 2VSDA 4HFUH 4WU5B 3VXOB 3CFDB 2DJSA 4J3VA 2FEEI 4X7DC 5FXCH 3SJVE 5IT2H 4PB0H 4U05A 2FECL 1ZHKB 3F7QA 1ZS8B 4Y4HC 4XXCC 1R5VB 3T65A 4FABL 3BD4A 1JGEA 3K80A 1FQ9C 1UJ3A 1QRNB 3MGAA 5D2NC 2EDNA 3KS0H 1MI5E 1L0QA 4HKBA 3DROA 5K9OA 3RWDA 2EDOA 4G5ZL 1FPTL 5HHME 4QXWA 4YAQB 2ZKHL 1U3HB 5DZLA 4NO2A 5L9DL 1P7QD 3CMGA 4K3DL 3ECBB 1WFTA 3MLRH 3ARGD 4HT1H 1S5HB 4YLQT 5EZJA 4JZNA 1QHOA 3VU2A 3OB8A 4D0BB 4CNIB 3QUZC 2F54E 2HT2D 3CCHA 3GO1H 1DQMH 1QACA 5JW3H 2IC2A 1A1NA 2EDQA 3V4PH 2BMKA 1WTLA 4N8PA 4NQCA 5IUSA 3KNBA 4Q9CA 1GZPB 4PJ5E 3QZWA 2DWEB 2GSIB 2IH3B 3QDGE 5EH1A 4NPYA 1MLCA 3FRUA 1CBVH 4FQLL 1X4XA 2F54A 1LDPL 3P3YA 3R0NA 4YHOL 1OCWH 4NQCD 3W39B 2OZ4H 1RZ8A 1KCLA 5HPMA 5IB2B 4LSUL 3TFKD 5J1AA 4JZJA 2OTPA 4X0KA 1ZSDB 3G08B 4PLNC 3PGFH 3EO1B 4NT6A 2CKBB 2G60H 3MRFA 1KJ3L 1DBBL 1YMMA 2RGSA 2VERN 3T0VA 1IGYB 4KTDL 4HZLA 1U8MA 4OLVL 4RAUB 3TYFA 5ITBH 2Z8SA 4HJGA 4R2GD 5IB5A 1JGUL 3VI4E 1OM3H 3FQUB 1YMHB 2GK0B 4JLRB 2B1AL 2JCCA 1IAOA 4HUWB 4M6ML 5IJKA 4Y1AD 2KZ1B 3VXMD 3KYNB 3ULUD 2HT4C 4UT6L 4PJIE 1Z0NA 3NFNA 1UYWH 4OLVH 2HVKB 2I5YL 5BRZA 3O6KL 4WI3A 1OAZL 5BS0D 4M4PA 1MFCL 4HCRA 5C0EA 4ZTOL 2JF1A 1FAKT 1FBIH 5EOTB 5D96C 3N1FC 3TJHC 3B9EA 5KANG 2HFTA 4M7JH 1U6AH 5F7KC 3VXUE 5E2VL 4F7CB 2Z8RA 4U1IB 3WFBH 5HVWA 1YJDH 1RD6A 3PWLA 3RAJH 3VFGH 2XWJA 3DMMD 4WW1A 2FO4A 4K71C 3LH2H 2GQHA 5C0RL 1W8OA 1YY9C 1ES0B 5ITFB 4TSBL 5ECJE 1WZMA 3G6DH 3C87A 4XVUD 4Q97A 3SE3A 4EN3C 4XPBH 1NH6A 2DN7A 1HYRC 1FJ1A 1CQKA 4XNUL 4BM7A 1U8QA 1QOKA 4HS8H 5IVXA 5IHZB 1ZT7A 3B9AA 4QRRE 4NN7B 3NAAH 2N1KA 4UQ3B 4K8RD 2PYEB 3F12B 4K94C 5HJ3A 4NUGL 3A67H 4OCYH 5GIRB 3VFNA 5EUKB 1KTLA 2A9NL 3VG9B 5HDOA 4PV9A 2XG5A 4FQ2L 3CC5B 3LRHA 3BIKA 3D6GA 3FAWA 4WEUD 4OZ4B 1N5AA 1Q94B 1T22A 2PO6C 2A0LC 2UZIH 3W9DA 4NHUA 4MB5A 2CDFA 2W9LA 4Z7VB 3JTTA 4U31A 1R3KB 4Y5YB 3IB4A 1QRNA 5SWZD 3OL2A 1MI5A 3PWLB 3QIWD 4P2CG 1OTSC 3WXVL 3ZO0A 1CGVA 3UP1A 2PTUA 2VL4A 4P0DA 3QUYB 4G7YL 5J11B 3SE4C 1IC1A 1QFPA 2HT3C 1Q8MA 4GRWE 3RBGA 4XMLL 1UT9A 2Z9TA 3S3JA 3CK0H 1JNNH 1KB5H 1NCDH 1JWUB 2GY5A 1H8NA 3SDDD 2HJFB 2ATPB 4M7ZC 3CH8A 3NCEB 2P45B 4PJEA 4JFDB 4U6VH 1CE1H 1CICC 1CDCA 4IS6B 1YQVH 1MHEB 1ZOXA 5KBNC 1MEXH 4IEFB 1L9NA 4M6OL 4GH7B 1T3FB 2DLFL 4K7FA 2WQRA 2ICES 4F7EA 4IRJB 4N5EC 2AW2A 2AJ3B 1RU9L 4GOSA 1YECL 1RZKH 3O11B 4I3SH 2P49B 3X14B 2ZUUA 1RSFA 3LSOB 1XF2A 2NY1D 2NY6B 3UTQA 4BKLA 1ZAGA 3DX6A 1AXSB 2V2XB 3LKSA 1T5WA 3MA7A 5FO7A 3ZE1E 3RA7L 1DQJA 4HIIB 4UV7L 5DHVA 4ISVA 2CKBA 3K8LA 1S7RB 1QBBA 1E28B 1JHTB 2X7LA 2V7NA 5E8PB 3UPRB 3OXRA 5ACLA 3CAFA 4J4PC 1IEHA 5D2LA 4I0KA 2M8XA 2XA3A 2Y9RT 4FP8L 4P4RA 3Q1SL 4TUOA 5I1LA 3G5VB 4U3XA 2GKIA 5FEBA 5IOPA 4APQA 1H5BB 1OAXL 3QEUA 2OI9C 1FNSL 4NWTH 2EDEA 1E0OB 1FNFA 2P5WE 3WLWD 3P9MA 5DUMH 3DHMA 3KNBB 4YGAB 4BQCA 2CSPA 3UJJL 1R3IL 4CN1A 3FQNB 2AKRB 3IDMB 1HH9B 1OAUH 1K6QH 3PJSA 4EI6A 3CDGA 5C08A 2BNQB 3ARGA 3D18A 4GQ9L 4U2ZA 3UC0H 4LSSL 3STLB 3RWGA 2IQ9L 4JRYE 4KVNL 3C6SB 3GBLA 3RWDB 4X7TB 1WC7B 4RMVA 5F6HI 1RHHA 2NW2B 5IG7B 1BF8A 3VDBA 3UXFA 1QEWB 1A7PL 3W9EA 43C9A 1C16A 2AEWA 4NRYB 3EGSA 3RNQB 2WMPA 3L3IB 3CFDA 1QA9A 4S10A 1OP5K 4NZJA 3FFDA 1QFWL 1ZEAL 2DQJL 3RWJB 5D7IA 5I74C 3BEWB 4B7LA 1NGXB 1FL5B 2A9NH 4XC1L 4M3KB 5GGVL 1YA5A 4GW5A 5E03A 4U1MA 5HI3D 5JHDE 4OLYL 5I16A 2AJXH 3ZE1F 4NBXB 4XNMA 1UEMA 5EWIH 4OZFA 1B0WA 4M5ZL 1HZHH 1F2QA 3AREB 4NCDA 3CSPA 1QPXA 2DWDB 4HUKB 3O6LH 5C0CA 2E7LC 5D7KE 1HSBB 3PV6B 5E94B 1HEZA 4U7MA 2P47B 4HUUA 4UQ2A 1AQDA 1GVIA 5TF1L 2V7NB 3FRPA 1SYSA 3JTSB 4BSVB 1YNKH 3CPLA 4S2SA 3QZWG 4G7VH 4RFOH 5EU5B 3KPPA 4E41B 2HN7A 3UTPD 3CZFB 1AY1L 2A6DB 1M05B 5C2UB 3ARFC 4W4NA 4Y5XA 5F96H 4GRMB 3ORJA 4LVOB 2HG5A 1A6TA 4OM1L 2V17H 2I07B 4APQD 5J1SC 4XZUB 3QCTL 5DJ2A 1U8JB 5ESAB 3VXUB 4XH2B 3MC0A 5EOTA 3IGAA 4EIGB 1YEJL 4FFWD 2DMCA 1OY3B 2NY5L 5MEQB 3GSUA 3CDGB 5KSAA 3CVHB 3K7UA 4D3CL 1MCQA 2FGWL 3WHE0 4Q6IB 2XNAB 1ZA3B 4NN6C 5KJRL 1NUGA 1SBSL 1KT2A 3ULVC 1PEWA 4DOHE 3BRDA 5EU6A 1PY4A 2P8MA 1K2DB 1YYLH 4LHUB 1RJLA 5J3HD 5EUOA 2RR3A 5J7CC 3KPNB 5GS0L 1QSVA 4XVJL 1T6VN 1T89A 3N85H 3OKMA 4QNPE 2OL3B 2EDFA 3KPPB 32C2B 4X99B 4P9MH 3JTSA 1EBPA 1NKOA 1M05A 3BP6B 5EN2A 2Y25A 4S11A 2A83B 1JNNL 1NCDL 4HH8A 4PJ7A 5ID0B 2VZSA 4E41A 3QUMH 1LEKB 1FO0B 3I6GB 1MLCB 1BZ9B 3GK8L 4PJFA 2VXQH 2DQJH 4Y5VA 1A7NL 1G9ML 1D5XA 3LB6C 4TVPH 3PG2A 2J88H 5AUMB 4BZ1L 2F54B 2ARWA 4OGZA 3U48A 4DN3H 4K7FB 3MOAH 3HE7C 3LPFA 3ZT6A 2JELH 2F5AL 5GS1C 5JHDD 2X9XA 1B3JA 4Y4FD 1DN2A 4J3TA 1MLBA 1JZ2A 2ZUYA 2VR4A 5FYLL 5HHQB 5K9QI 1WAAA 4XPTL 1OARH 2R1XA 2AK1H 2R4SL 5ANMA 3NFSH 4FFWC 1MCFA 2NY6D 3V0VA 4XXCA 2H8PB 4ODTH 4YPGB 3H9YA 5EPMB 1XGRB 3IS1X 4G9FE 4NO0A 35C8L 1INQA 1H9VA 4NN5B 1PZ5B 3WV0A 1F4YH 5DD5L 1JWUA 1J05A 1GXEA 3H42L 5CMAA 2E9IA 2I60H 4OIBA 1X5ZA 2DYPA 5C0AB 5ICXA 4PV8B 4OIAA 1CDGA 1UH3A 3MV8D 3GKWH 3SKMB 1W2KT 2GT9A 2R0WH 4ODVL 2E7HA 3W9DB 2IPTL 3RL2A 2I27N 2FIKA 1IEAA 3E1F1 4EIZC 1RFDL 4OLXH 1X5JA 1HZHL 1P2CB 5LCVL 3BH9B 3VCLB 1FYTB 2X89D 3QP3A 1JWSB 4ZO8A 2C3VB 4JO4H 3TN0C 5D6DA 1JZ5A 3BW9B 4RQQA 4XBGA 4G43B 4NHCH 1W72A 3B8SA 1VADB 4YO0A 1VKXB 1EEUA 3VWJC 1QLFB 5JIIA 3HI5L 2PR4H 2HMID 2R0WL 3KPOA 4J1UA 1KIRA 5E4EB 4EI5A 2DBLL 5JIHA 4KI1A 4OF6A 5DRNA 3ARTA 2VC2L 2XZAL 35C8H 2DQDL 3RZCA 3B5TA 5E1AB 4S1DC 4XMKH 2XWBB 4LIQH 4P9HC 4CJ0A 1J18A 2MKWA 3P9LB 3WKNA 4P57A 2CLZB 3QUZD 4XBEL 1SYSB 1A14L 2H2PC 1JHLL 1M7IA 5ETUA 3RVTD 5DVKA 1H5BA 4KRNA 2UZXB 4KJYA 3MOBH 3V4VL 3FQXA 2K3TA 1N26A 3QXWA 3E6FB 4MAYD 3UAJD 2C1PB 2B0SH 2OMNA 1FNEB 3DX7B 1UXSA 3H9SA 4TSCL 4KDTA 4FTVA 4PD4K 3VGAC 4JFQA 5D72H 4R4FL 3P11H 1EH9A 2PW2B 4F3FB 2FJGB 4K3HA 1T21A 1BFTA 4KK5C 4MNQB 43CAB 1WVZA 4GRWF 3BKJH 4NZUL 1F6AB 4HPOH 1GPOH 4WWID 3T0WA 4LCWB 2A6JB 4EZMA 3QPXH 4JE4B 1U36A 2R0LL 1ZANH 2NXYC 1IAIH 1KNOA 3MYJA 3MBXH 3QISA 4HF5H 3RNQA 2M1KA 3QUYA 1A6UH 2NTFA 5FYKD 3MLTA 1NDMB 2NY4B 3K2MC 1DANT 2Y06H 2R39A 2A6DA 1HQ4A 5IMMA 4MVBD 3NZHH 5KJRH 2AEPH 2CDEB 3HI6L 4MQXC 3JZ7A 4M7LH 3AROA 3MBEB 1XF5A 4BELD 4DTGH 4PJ8D 5IESH 1DVFA 2Q6WB 1HOCA 1N5AB 2QKIA 3SDAD 2C1PA 3CD4A 4EUPH 4ZFGL 3RWGB 5I1EH 4RGNE 1TTFA 5C0DA 4MD4A 4LDOB 5DZNA 5GISL 3E6FA 4MJ6A 2IPUK 3AFLA 3HNVL 1RZ8B 2CPCA 1BWWA 1QKZL 2JB6B 4OT1L 3GHEL 3MJ6A 5F7MC 5J1AB 2B39A 5JNYA 5KVFL 5EU3B 4BJLA 1U95B 2EC9U 1RMFH 4LKXB 4HGWB 4M7LL 3KYMA 2BNRD 2H1PH 1AQKH 3FTGB 1CFQA 1JYWA 4JQVC 3SE8L 4RA0C 3MNVA 4NQTA 2QQNL 5FYJL 2X9YA 3LQZB 3GMQB 3KPRB 2PTTA 1K3ZA 2HRPL 2JB5H 4PYHA 1MJ7H 2WWKT 1WFOA 4L3ED 4U1MB 2ITCA 1V3LA 4GAYA 5J1TC 2XIDA 1UVQA 1FN4B 4FQCL 4UNTA 4I2XB 2NXZC 3VRJA 3BIBX 3SJVB 1WZLA 5K93A 4ZOBA 5IMMB 2QSTA 4BA8A 1JNHA 2CXGA 2FL5A 2R2HB 5EO9A 2ZSWB 1RZIB 4YNYA 1TETL 3CX5K 4JAMB 2VXTL 3MBED 4PGBA 3T1FA 5T3XH 4J3XA 2OR7A 3AS0A 3SDXE 1YNTB 4K7PH 3ARGB 3TH3T 2NW2A 1BX2B 2VZOA 3C6SA 1JTOA 3VXRB 15C8L 3GNML 1A4JA 3B9KB 1HNGA 4MHHG 4ELKA 3LRGA 2NW3A 3RDTC 2UUDK 2YD1A 5TE4H 4N9OB 3WE6B 3WXWH 1Y0LA 3U0WL 1GZQA 1YEGL 4QRTA 5DJXB 3CFIC 2HJLA 1LQSR 3HG1B 5DJ8B 3TIDB 4JO4L 1KJMB 4BK4A 1I1CA 3CSYA 1V7MH 5BS0A 3QIBB 4ODXA 5BRZD 4EQ2A 1W0YT 5C0AD 4L4TD 4OB5H 3SJVA 3OKEA 2HJKB 3CH1A 1CXLA 2EO1A 4LQ1A 4WFFD 3SE4A 2X1OA 4NN5C 3DUSB 2IPKA 5GS3A 3VH8G 3TJEH 2CUIA 5IMKB 3NVQA 4TRPH 1WJ3A 3ARFB 3GI8L 3BZFA 4LVNC 3RIAF 3TZVD 3C8DA 2V7HB 3EOBA 4ZFGH 2D0FA 3RKDC 2YBRA 3LZFL 1NAML 3DX9B 4MJ5A 1F42A 1ZHLA 3VD4A 5FYKL 2NLJA 1CICA 1UYWL 2ICWI 5I15H 1NCWH 1FDLH 1BFVH 2LU4A 3NGBB 5BVJA 4OGAD 4YDJB 5GJTL 2D03L 1DBML 2CK0L 3EYOA 5EULV 1O7SA 3IDYB 3KLHC 1PKQB 3VFPB 5SWSB 4PRPD 2NY0B 4N0YH 3VRIA 5E2VH 4EDWH 3HAEB 4JREC 5FV1L 2GT9B 3HAEH 1IT9L 4GS7C 1JL8A 2F15A 5EO1A