2A1WH

Anti-cocaine antibody 7.5.21, crystal form i
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
225
structure length
225
Chain Sequence
b'DVKLVESGGGLVKPGGSLRLSCAASGFTFRNYGMSWVRQTPEKRLEWVAAISGNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARHDDYYGKSPYFFDVWGAGTTVTASSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin light chain kappa
publication title Flexibility Of Packing: Four Crystal Forms Of An Anti-Cocaine Antibody 7.5.21
rcsb
molecule tags Immune system
total genus 45
structure length 225
sequence length 225
chains with identical sequence I
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a1wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a1wH01
4XNMA 5DMIL 3WFEL 2DQJL 2B5IC 3JV6B 3ROOB 4WJ5B 3OGCA 2FIRT 4LIQH 3NIDE 4OFVA 1XF3B 4RAVB 5KVGH 1U93A 1MCDA 2BVTA 3K8KA 4NRYB 4WCYH 4UNVA 2EDYA 3H2WA 5JXAH 2IGFH 3VXOA 1K8IB 1CF8L 1S7VA 2APVA 3BD4A 1BM3L 3P0YH 1S5HA 3D39D 3RUGA 3B2UC 4JR9H 4XPFH 5IEHB 4LF3B 1V8HA 5C08E 1DVFD 1R3LB 4V1DE 2AJXL 5LBSH 5C3TA 5D1ZB 4QY8B 3EOTH 5E9DB 4XMLH 4JFPA 2C9AA 3IS1X 5J1AB 2HG5A 1ZHLA 3HI6L 4O9HH 5EIIA 5CHNB 4ZUSB 1W72L 2Z8WC 4QRRB 3ESVF 4QGTA 5ISZD 5MEPB 3QRGH 4A2MA 5KVGL 3Q48A 3MRLA 3VWKB 8FABA 1B6UA 3HUJA 4FXGB 2IPTH 5H2BA 4ZUVA 1BEYL 3P0YL 3MBXL 4XHQA 2F5AL 2N7BA 1P7KA 4JR9L 1LGVA 4BQ6A 5F9DC 4OIIH 3OPZH 4LSRH 2Z93A 5F1KC 3V5KA 4WUUE 1AKJD 2CRMA 1QBBA 1R3HA 1G7HA 3U46A 3EOTL 4NQUA 3MACL 4XMLL 5C8JA 4ZSOE 5CEYB 1INQA 4LSQL 4QT5B 3OGOE 3LS4L 3VFTA 3MJ6A 4MD4A 2H3NB 4JRYD 4CJ0A 3NIGF 4ETQA 4JKKA 5AYQA 4F7PA 3HLAB 4U7SA 4NZDA 4LQ1A 2CLZA 4UT7L 4NKDA 4ZUUB 2E9IA 1U8PA 3TNNB 1RVFH 3QRGL 4OQTH 3V5DA 5F3BA 3IFPA 5I19H 4X8JB 1QRKA 1RUKL 5DQJB 2IPTL 1V7MH 4Z8FL 5I76B 3VWKC 4K3EL 2R2EA 4OIIL 3OPZL 4LSRL 4ZPVA 1HQ4A 4GAYB 1N2RB 3GBNL 3L3KB 2OTWB 5FKAB 3OMZA 3QEHB 4QHKJ 3X17A 4AH2B 1EJOL 3MZTA 1ZEAH 2CK0H 4I5BA 3EDKA 3TBYA 4OGXH 5L2JA 1B4JH 5E8PA 4XRCA 1XGUB 1RVFL 5E8DH 2AP2A 4U4BA 3RY6C 1MSPA 1RZ7L 1M7DA 1HHKA 5DVNA 4Z7WA 4KJQC 5E6ZA 3QXAB 4XXDA 1W72A 4FQ1H 1OVZA 5EBMA 4EOWH 3FN0L 3SE3C 4PJCF 3MQIA 2BVQA 2XI9A 5GZOC 4U6TA 1UB5A 3CH1A 3BH8A 4F80A 4HJJL 5GRVK 1R3JB 1MUJB 4ODTH 1IC7H 1KV3A 1ZEAL 1IEBA 2CK0L 1FNLA 3D3VD 4N9OB 2BHZA 5JA8B 4PJ8C 3SKNB 1NEZA 4OGXL 3THMH 1B4JL 2VZSA 3CC5A 5FDWB 2PUQT 3MJ8B 1AQDA 2H32B 4RFNB 4MXWH 4TULL 4NQXB 5I1CH 1I8IA 3BEVB 1KXQE 4PJHF 1YEHL 4IHOB 4QOKE 3BE1H 1CFVL 1NQBA 4BH8B 2BSTA 4YHPA 4EOWL 4IM8A 3ULVH 1VDGA 3O6FB 4U49A 2ZOKA 2VZVA 3DO3A 3PABB 5GGUA 2VXQH 2OM5A 3OHXB 4ODTL 1SEBA 1IC7L 1QQDB 4WI4A 1YNKH 3MXVH 4WHYH 3MLSL 3FT4A 5ICYA 1R24A 4WDIB 1IARB 4HG4K 4LSPH 4MJ5B 4PYHA 2Y23A 3FCTA 4NQDA 2XZQL 5T1LA 3LHPH 4MXWL 1T4KB 4NC1E 4D9QE 4G6MH 2VDKH 4P4KA 5D8JH 5I1CL 1P4LA 4LGRB 2H26A 3NCYS 1F00I 1ZA6B 1B6DA 3CCHA 4TSBH 5C7XH 1CT8A 4ODWB 4NPYB 4KUCF 4RFNC 1ZK9A 1LE9A 3C2SA 1H3TA 4K3JL 4NQSA 2LE9A 3ULVL 1EBPA 3X13A 2JE8A 5DHVH 5TPWH 4ZYKA 3BWAA 3HHRB 2VXQL 2RIKA 4PLNC 3GEWB 4XAKE 5TE4L 3MXVL 5IW3A 1EEYA 4H1LB 3RKDD 4X6FB 5HHQB 3O3AB 1IGFH 4LSPL 1WIUA 2AK4D 4H5SB 1D9KD 4P23B 3UTPD 1HHIB 5CEZL 3JVGC 1WIPA 1F42A 5DRXA 1LP9F 1UCBH 4QF1A 5C0AB 3PWJA 5D8JL 3E0GA 1XR9A 3MLZH 4FQJH 4KRLB 4M93C 3PL6D 3QPXH 5C7XL 4NKIH 5I75B 1EXUB 1MCJA 3MRQB 5L9DH 2G5BA 2D7MA 4YH6A 1P5VA 3HI5H 1CXHA 5FEBA 2C4FT 5EBLB 5TPWL 5J13B 5D1XD 4JQIH 1TLKA 1CD1A 5J89A 5K9JH 5HVHC 5ISZE 2VDOH 2JCCE 1UADC 2FD6H 4Q9BA 5EA0H 1U8LA 2DLEA 2P47B 3BMVA 4OGAD 1Q38A 1LEIB 3T09A 3QWQB 3PWVA 3WFHA 3S36H 3ZE0E 5D2NE 2HT3D 3ZDZE 4FQQB 1J88A 3H0TB 5GISH 2ITCA 2HVKA 1UZ8B 1CXKA 1UCBL 2FH6A 3OKMB 3Q6FA 1X5ZA 3IFNH 4XNXH 4C4KT 1AO7D 4X8XA 1HIMH 3OR6A 4FQ2H 3QPXL 4GUPA 25C8H 3FO0L 2KZWA 2F54A 1EIBA 5F9WB 1CFQB 4PJIF 5L9DL 5HYEA 5HYSA 3ARFC 3OAUH 2YC1A 5TDNB 4JQIL 4PRPB 4ODVL 1NGYA 4LHUG 4F37K 2XNAA 1PEWA 2VDOL 2FD6L 5EA0L 5K9QG 4K9EC 2NLJA 4OGYH 4DVRH 4NFBA 1PZUB 1DEEA 1FE8L 4PRID 4F8QA 5J13C 4WFED 2VZ1A 1UXSB 1A6AB 3LN9A 1AJ7H 3H8NA 4N1HB 3EUUA 1N6QL 4KJYB 4OAWB 2B4CH 3L95B 4F9LC 2W07A 2VLRB 3FTGA 4XNXL 1LO4L 4JLRB 2Q3ZA 3RKPA 1JWUA 25C8L 4XX1E 2IQAB 1S9YB 4NC0B 1HKFA 3QULB 1SMAA 4JVPA 4NZUL 3ZE1E 3MBEB 4H26A 2X09A 3H9SD 3SDXE 3D69B 4OLZH 3F7VA 3DURA 2DTMH 3HA0A 5F9WC 2ADJA 5J11B 5D2LA 2GTZA 3Q3GB 3QXVA 1ZLUH 2BVOB 4KHTH 5ICXB 4DVRL 4QHUA 2PYEA 4HG4J 1HCVA 2NPLX 1L0XA 1EHLH 2YPVH 1ZGLB 3VXMD 3OKDB 1LWRA 5FA3B 3CDFA 5DHVA 5EUOB 1DQQA 5F44A 4ELMB 4KAQL 5IMMB 5FOBB 4S1DD 1OL0A 2OK0L 4WEUD 4EN3B 1CYGA 1QHPA 1AQKH 5SWSB 3S8WA 1TQCB 1ACYH 2Z92B 3CXHK 3UJIH 2CDFB 5F7NC 3MA7A 1VFUA 4PGDA 4PB0H 4ZUTA 3SCMB 1P9MA 4DTGH 3MRGB 2HJLA 5HHXL 1CE1H 5M94B 1TVBB 4UDUA 1UM4H 2X2YA 3GNMH 1VFOA 4G6JL 4MX7A 2C26A 2P5EE 2J8HA 1I7ZB 3BRGC 1DBAH 3MBEC 5F3HB 1E4KC 3HNVH 1JRHI 3EZ8A 4HK0B 3WJLA 5J11C 4OLVL 1KGCD 4PJXB 4GXUN 4D0CA 3REWA 4ZFOB 3VFRB 4LCUB 1ZSDA 1ROWA 4LLVB 3EJJX 4HHAA 5DJXB 3LKSA 3OAYH 3BMWA 2KH2B 3QUZC 3FB7A 4WFGD 3UJIL 5KS9A 1GGIH 3MV8B 4FZ8H 4XNYH 3EYFB 4RCAA 4EN3C 4DTGL 1P7HL 2BVYA 4JAMA 2B39A 3T3ME 1CE1L 3EFFA 3WN5C 5ID0A 3V6BR 3ULUE 5JXEA 2LQRA 1U95B 1RU9L 3HNVL 3SCMC 2R4RH 3WV0A 4ZO8A 3G6JA 4YZFF 3TZVB 5BZDA 3VGGA 1MWAH 3FOLA 1RZIB 4PG9B 1A1OB 3BPCA 1NCTA 1I9JH 3C6SB 1SBBA 2Z91B 2NY5C 3RQ3A 4M7LT 1NAMB 1ZWIA 4FNLL 3VFUB 2D9QB 1KG0B 5D7IE 2P5WB 3VG0L 5B22A 4FZ8L 4NQEB 5J7CC 4A6YL 1CD9B 4MD0A 3HPLA 5FKPA 5BVPH 5FCUH 2JIXD 5E8EA 5B3JE 2PR4H 3B5HA 1VFAA 1DL7L 1EEQA 1F8TL 4NNXB 3CFKB 4WFFE 4F7MB 2VOTA 3MV7B 3E3QE 1GVIA 1YPZE 1UCTA 3RY4A 5FF6B 3F5WB 4JGJA 5C0GB 1MJJB 1DUYA 2X4OA 5J12B 4FFWD 5J6GA 2VABB 3O3EB 1I1FB 4UBDD 5KSUA 1I9JL 1XGYH 4N8VG 3TZVC 5E1AB 3MV01 1YYML 2YR3A 3UPAA 2A73B 1KTKE 2DYPD 2WK2A 3RL2B 2IWGA 3D85D 5ILTH 2CLRA 3L3OA 3TBWA 4LHQB 1JNLH 5HHPB 2PR4L 2DL2A 3DXAB 4N5UA 1KTLB 1N64H 4FQHA 3MLRL 1DZBA 3MRIA 5BV7B 4KJPC 1T7VA 4JY4A 5DHYB 3P9MA 4HKJA 1DBKH 3SKOA 1U92B 4JANB 3UDWC 2B0SH 5CBAA 5IUSA 3VI4F 4AM0B 3OKLA 1AXTH 5D5MB 4Z6AT 5FGBA 1BBJA 4AQOA 3BUYB 3D39A 5I66A 5IHZA 2OQJA 1NCWL 3RU8L 1DVFA 2VDMH 3BAEH 5ILTL 1M7IA 4XBPB 2Y06H 5FYKU 3QDMD 3VFPB 2C4FU 2DM7A 3INUH 4PRIE 2J8UA 2D4FA 3OF6D 4XGZB 4LHJB 1NGZA 5DMGD 1N64L 1K4DA 1S78D 5FA4B 5IIEB 5ACMA 5I16B 5KSBE 1QRNB 1C7SA 4JQVC 5E99L 3MODH 5E6ID 4D9RD 1DBKL 5GRWA 4A6YA 2XWTB 1P7QB 1AXTL 5BV7C 3QEGH 4KTDH 2ZG3A 3U0PA 1ND0A 4M1GL 3MZGB 3WFDL 2LABA 2VDML 2VLKE 1AKJA 1QR1A 3BAEL 3MLVH 3WHXB 2GT9A 1RHHA 2Q8BL 4KFZC 1MWAA 2EO1A 1EZVX 3INUL 2YA2A 2BNRE 4Y19B 4JRYA 5FHAL 2F74B 4PJDF 3FJTA 4MCZB 2ARJA 4DJMA 5I8EB 3VDAA 5M7QA 4AY0A 4HUMB 2X42A 2EYSA 1J8HB 4GAFB 5EOCJ 3G5YA 5F1NA 2ARWA 1C5BH 4PJ9B 4KTDL 4PLKD 1A3LL 2MTPA 3BISA 4I3SH 4PG2A 1T89C 2GKIA 2QADB 2VRAA 1ZHNB 5CSGA 1A8JH 3I6KA 3S5LA 3KPNB 4NHUA 3IDMB 3IF1A 1N6UA 2DL9A 5EN2B 1Q9LA 3MLVL 3ZKMD 4PJBA 4LVHB 3SHSA 3EYVA 12E8L 5FECB 1FH5H 3BESR 4EUPG 1YN6B 4PJFF 4MAYA 4EVNA 4Z7OE 4KZEH 5D7SL 3WCYA 4FFVC 1KGCE 4G8GE 3L9RB 2R29L 4LLDB 4Y89A 3QG6B 4YK4C 3U36A 3RWIB 1Y18B 3QJFA 3KPPB 4M7JL 5IR1A 3MRNA 5CGYD 2BZDA 4D8PB 4NCC2 5GRUH 4PJ9C 2EDNA 4LRIA 4NJAL 2C3HA 3CK0H 2QADC 4JCLA 1FH5L 5EC2B 5CSZA 1TETH 2A6IB 3KPMB 4TSAH 3WEXA 3T2NL 2XRAL 1S5IH 3O3BA 3OV6A 4N0FB 1S7TB 1SJHB 5EBWB 2F53E 1CFNB 1G7QB 1KJVB 5GGVY 1AH1A 5IW6A 5D7LB 1MH5B 1S7SB 5LAXA 3BHBB 4JPIA 1CFSB 1T7YA 1XCQA 1JZ2A 2DQCH 4JQXA 3T0ED 1ONQB 2BK8A 2BVPA 1QLFB 3GMNB 1B0RB 5GRUL 3IDGB 1G6RB 4ENEC 1KEML 1B0GA 3VJ6B 1MCLA 4YFLI 1HYSC 5CLWA 3TO4D 3L7FB 4EJ1C 2ADIA 5ITFB 1CGTA 3O4LB 1ZT7A 2XTLA 4PJFB 1S5IL 5JOPE 5BVJB 3NIFF 1NAKL 4GW5A 4JPKH 1OQOA 3SOBH 3HAEB 3KYNB 1LILA 2ITDB 3FQUB 3QNYB 5DI8A 1U8NA 3MFGB 1A9EA 1EX0A 3CZJA 4MNGB 3NGBB 4K3GA 4Y5XB 5GZNC 2DDQH 4JCMA 4ZOAA 4CW1A 4WGVB 1NMBL 5DK0B 4XNMB 3OGCB 4OF5A 4XP6H 4JHAL 4ZFGH 2NW2A 1U93B 4GKOA 3LKNA 1Q9KA 4ZFZA 5M95B 1CN4A 4C56B 2X41A 1WBYA 4QNPF 3RZCC 3VXOB 1S7VB 4I2XE 2AK4A 2HMID 5KVEH 3UTSA 1I3GH 1D9KA 4HLZG 1S5HB 3QXDA 3QH3A 3RUGB 2HJKA 4JPKL 1WAAA 4OQ1A 4KQ4H 5KSAD 3MLTA 4TUKL 1JNNL 1H3GA 3PL6A 5GGSY 4JFPB 2HG5B 1ZHLB 5EIIB 1HI6A 2DDQL 5EULV 2Q86A 3MA9H 2VTFA 4Z7NF 1JHTA 4XP6L 4LQFH 3BN9C 3NGBC 2XICA 4ZFGL 4FHBD 4Y5XC 3P11H 3MRLB 8FABB 3ARPA 2D03H 4OZGF 3HUJB 1HH9A 1NFIA 4M1CC 1RK1A 4R90L 2CDGA 4LDLB 5H2BB 4ZUVB 1I3VA 4NC2B 5KVEL 1I3GL 3VRIA 1P7KB 1G6VK 3O45A 4LSDA 4NKQB 5E7BA 1MIMH 3C5ZA 4KQ4L 1PY9A 2X4QA 4YPGA 3V5KB 4N68A 3BIKA 4JRXA 3B5TA 1R3HB 1AO7A 1MAMH 2ED8A 4QXGH 3U46B 1TJGH 5C8JB 1IC1A 4U3HA 1INQB 3U1SH 4PD4K 1D5XA 3VFTB 1MCCA 5ESAA 1UQSA 4HS8L 3EDJA 4MD4B 1E4WL 5DUBA 5HYFA 4P2RD 4ETQB 5DVOA 3MA9L 5A43C 4DUVA 3M8OH 5GGRA 1A2YA 4F7PB 2CLZB 5IFAL 4NKDB 4KKCC 1U8PB 1RQ5A 2G60L 3HFMH 3V5DB 5F3BB 3IFPB 3GMOB 1KENL 1EGJH 4X83A 2WAHA 3MGTA 2AJ3B 4P4RA 1JI1A 2VDNH 2R2EB 4D9LH 5JHDA 3FQWA 1JWMA 4HEME 1FP5A 4U6XA 3C60D 3HE6C 4PRHD 1MAML 4QXGL 3QSKB 1KNOA 1TJGL 4U1IA 3JXAA 2Y4SA 1ED3A 4I5BB 3TFKC 5E5MB 3FHQA 4YEEA 3OJ2C 3DHJA 4ZUWA 3DUUA 3H9SA 4OFIA 5L2JB 1XGQA 5E8PB 4FABH 4XRCB 2R23A 1OAZL 2NY1B 1IRAY 2YBRA 1M7DB 1MCIA 2WM0A 4Z7WB 5K59F 2XKNA 4JPVH 1OT2A 4XXDB 3VXMA 1W72B 3MOBH 5D72H 5EBMB 1MY7A 3JUYA 2BVQB 4Q6YA 3LD8B 4I4WA 5KSVA 1UB5B 3CH1B 4DUXA 5IMOA 3T08A 1CLOH 4BFBD 2MHAA 4XB7A 5CD5C 1IEBB 1WVZA 1B88A 4NM8H 4OI7A 1NEZB 3WNLA 2EH8H 3CC5B 2RGSA 3LVEA 4QXTA 2D0HA 5CBEA 2AJZA 4YBQC 4JY6A 1I8IB 2A9NH 1GPOH 3WDIA 4JPVL 4L3CA 4PYGA 2UWEE 3TT3H 2BSTB 4MMZC 4YHPB 1MCWW 1OTSC 3T0EE 2CKBH 2ZOKB 4IRJD 1CLOL 4LIQE 1SEBB 2DIJA 3FT2A 1KYOK 3C6LA 3FT4B 5ICYB 2ESVE 3LD8C 1R24B 4CUCA 3NIDF 4LU5H 4DQOH 1W0VA 3FCTB 4NQDB 5T1LB 3BUTA 5J9PB 5DUPL 1JPTH 5I8KH 3GJFA 4LSSH 4P4KB 1G7LB 1P4LB 2CRZA 2H26B 3LQMA 1JMZA 1BF8A 2A9NL 4HPOL 3CCHB 5SX5K 3TT3L 1CT8B 1LE9B 4NQSB 2WWMC 1L4IA 1NCNA 4TTDC 4ZYKB 3BWAB 32C2A 3Q1SH 2XV6B 2QQQA 1EEYB 1WF5A 1XR8A 2QQNH 5JIHA 3TH4T 3CNKA 4MXQC 4W6WB 4WHTA 3EOBA 4S0SD 4GLRH 2JIXA 1ZLVH 4L3ED 5GRXG 3MV9D 2UYLA 4U31A 5B39A 4XCEA 1JPTL 4U1HA 5I8KL 5FYLE 4DGYH 3PWJB 4LSSL 4YBLC 1A7PH 3KHOA 3SDDA 1F4XL 1RIVH 5DJ0A 1WWAX 2YMXH 2YD2A 1BX2A 2QJDA 2G5BB 3SGEH 4MJ4A 2E8YA 4P4KC 3LIZH 2KKQA 2W60A 2FO1A 2W0FA 1T7WA 3DVFA 4LHUD 1VADA 4WU5B 4Z7QE 5J57B 1CD1B 5C6PB 3Q1SL 3EYOA 4XTRC 2DYPA 2EC9T 2AERT 2D9CA 1ZS8A 1BQHG 5IMLA 1U8LB 3NFNA 1QSFA 1SBSH 1I4FA 2OR9H 1NLDL 2QQNL 5AUMA 3WFHB 2LAGB 3BPNB 3VFSB 1YEJL 2LU7A 4G43A 1UWEL 4XWGH 4PBVC 2ITCB 4XI5D 1JI2A 1A7PL 3Q6FB 5T1KA 2E6QA 3BP5A 1MIEL 1X7QA 1CL7I 3OR6B 4GUPB 3CDYA 2YUZA 5ALCL 1Z3GH 3NABL 2JLLA 3ARTA 5F7WC 5L2KE 2ZOLA 1WBZA 3LIZL 5HYSB 2L0DA 3T1FA 2YC1B 2FZ3A 3BGMA 2B1AH 2LVEA 1NGYB 2XNAB 5D1QC 1J1PL 1O5DT 4KDTC 4UINH 2NLJB 5GRJH 1SBSL 1DEEB 1CD0A 5MEQA 4HXBH 3QDMA 3ZYJA 3EYQD 3OF6A 1D6EA 1MJUL 1MOEA 3V4PH 3DVGB 3QIUD 3VXQA 4HUUA 2Z4QA 1J0JA 2HFTA 2VSDA 3FTGB 1LDPL 2CO6B 3SKMA 3T2OA 1JWUB 3BPNC 4HCRH 3PDDA 5EUKA 4YXKH 3V6OE 2O5XH 4H26B 1A6TA 1EO7A 1KYOJ 4PB9H 4PBWD 1O7SA 3F7VB 2B1AL 3DURB 2ADJB 5D2LB 2GTZB 3PP3H 5CJ8A 1AC0A 4UINL 4ZSOB 3QIBA 3G6JF 4QHUB 2PYEB 1T04B 1HILA 1F02I 4X98B 4BQ8A 4XHJD 5LVEA 5DHVB 2MQ3A 5JPNA 3FO9B 2FCBA 2NY2B 5GXBB 1CCZA 2NW3B 2R2CA 1BHGA 2ZKHL 3EBAA 1JFQL 1RUPL 2DKMA 5C0CE 1CBVH 2WBJD 2D7TH 4WUKH 4HCRL 1LO5A 3VFMA 3FQNA 4FTVE 3MA7B 2O5XL 4PGDB 4XXCA 3WSQH 4ZUTB 1IT9L 3MGAA 2HJLB 4UDUB 5FYKH 4IDJH 4MX7B 5JZ7C 1MI5E 4R4NC 4MHHI 2EKJA 4JGUA 3AB0B 1QO3A 4D0CB 1A3QA 3REWB 4HT1H 2DD8H 1I7RA 3DX9A 4HC1L 4JFZH 4F3FA 1GIGL 5F7FA 1ZSDB 2ID5A 4ZQKA 4HHAB 4HS6A 1CBVL 1FIEA 1BAFH 3FB7B 4QHNA 4LCWA 2NY2C 4H0HB 5F7UA 2ICWB 4L29A 1XF1A 4JAMB 5ERWA 3EFFB 5ID0B 1J87A 1CDCA 4IDJL 4RX4D 3BGAA 1P69B 1XT5A 2HLAA 3G6JB 3W81A 3MLWL 2GY5A 4KMLB 5BZDB 2IFFL 3I2CH 2WUCL 5CZVH 5F6IB 2IQ9H 3FOLB 2CDEA 4HT1L 4MZ3A 2DD8L 3BPCB 4NFDA 1ZANL 4JFZL 4TRPL 3AB0C 3WJLC 5IROC 3QQ9C 4Y4HC 3DVNA 2LU3A 4LVNC 2SEBA 1QG3A 1BAFL 1X4ZA 2AJUH 2GY7B 5DURB 2HWZH 3HPLB 5FKPB 2C4XA 1I1CA 5E8EB 4LEOA 2JCCF 3HG1A 5INCA 1VFAB 3KPSA 1AY1H 1F3JA 4DN4L 4GT7A 1NGWA 5IB2A 1AI1L 2IEPA 4HCRA 5D70L 3ZE0F 4HWBL 2IPUK 3TO4A 2P48B 4EDWL 2V5SA 2D7QA 3ZDZF 4S1QH 2FJFA 1G84A 3MFFA 3WD5L 2IQ9L 1KJ2L 2HTLC 1DUYB 5I73B 5HGAA 3X11A 3WDHA 5J6GB 1U3HA 5KSUB 4RAHA 4G6FB 3W11D 4LLYA 3BW9A 5F6IC 3LQZA 3SDCA 3T1WA 4Y4KD 2CLRB 3PDGA 3L3OB 2AJUL 1S7QA 2PO6D 4OCYH 4ODBD 3TBWB 2EIDA 2G5RA 1OGAA 4GO6B 3GMRA 4HC1A 3LY6A 4FQHB 4XAWH 7FABH 4KK5C 3MRIB 3SE8L 4KZDL 4JY4B 4S1SH 2P8MA 3P9MB 4JFDE 3HI1A 4I3GA 4HKJB 3SKOB 4S1QL 1RZFH 5TE7H 4U6HA 4U2ZA 5CBAB 3OKLB 2JJSA 1FG2A 1BBJB 3VDCA 1EH9A 2EE9A 3D39B 5I66B 3CFDB 5IHZB 2OQJB 1DVFB 4G7VH 3S98A 2H8PA 1FRGH 3EDEA 4OCXH 2WP3T 5L88H 1M7IB 3ZE1F 4OD2A 1ORSA 4NC1C 4OCYL 3SDXF 5CIPH 2X6MA 2J8UB 2YS4A 3FFDA 3VFVA 3DYPA 4KUZL 1NGZB 1N7MH 4XAWL 7FABL 1K4DB 3GIZH 4JO1H 1E27A 1R3KA 4ODSH 2R9HD 1X6NA 2CO7B 4A6YB 2QTEA 3UROR 1RZFL 5TE7L 1PY4A 3U0PB 5LWYH 1ND0B 3CVIH 4PJEE 3HZVA 5BZWA 3ULSA 5CFHA 4DKDC 5IB3A 3D0LA 1FRGL 4MWFA 4HWBA 5DO2D 2C3XA 4OCXL 1TTUA 1AKJB 1QR1B 3MRJA 2GT9B 4Y5YA 1RHHB 1MHHA 1PSKH 3U7YH 1KN2H 1DVFC 1KJ2A 4OZHA 4W6XB 4JRYB 1FNHA 2W38A 1QSVA 1RK0A 2UUDK 2ARJB 4HIJA 2QBWA 1QBLH 3GIZL 4X6BA 2D3VA 2DI7A 2MWCA 2DJUA 4GRLD 3ARZA 3MMEA 4WO4D 4KPHH 2ZSWA 5DQDH 2EYSB 1KULA 3GSNL 3TPUA 3G5YB 5F1NB 1T22B 4X4XA 4CDGC 1YEEH 5DWUH 1ZXQA 1N0XL 1MPAL 4KKAD 4K94L 3H3KA 4IRSD 4P5TD 3I6KB 3S5LB 3C60A 4NHUB 5F7EL 4ORGA 4PJGA 1WITA 4PRHA 1FN4A 3P0VL 2MQCA 3G04B 3RGVA 1Q9LB 4PJBB 3EYVB 3U7YL 1KN2L 4M7LL 2EEDA 3X14A 4RMSA 1I85C 4DK3A 1Y0LA 3T3MF 4JFEE 2XZCH 4MAYB 4EVNB 5JDJA 1VFBB 3ULUF 3SDXB 4URTB 4GG6E 2AW2A 2AJVH 1XGRA 1K3ZA 4RWHA 5D7KD 3CLEH 1IZJA 2UY6A 4KPHL 3U36B 2IAMD 3QJFB 5IR1B 1A7NH 3R4DA 3MRNB 1LD9A 2W91A 5TQ0H 1NCBH 1YMME 2ZUTA 3MYZA 5DA4A 3WHE0 2OTUA 2W0PA 3O9WA 4MB4A 1X3DA 2AI0H 3D5OF 3ZKXB 3HRZA 5I1EH 3C8KA 5B3JF 1AGEA 5HD8D 3P77A 2G2RB 2GTWA 3QDGA 3D3VB 1MFNA 4JZJA 3U7WH 5CSZB 3AM8C 5C0JA 5DTFA 4LKXA 5ACLA 3WEXB 2VZUA 3O3BB 3NH7H 2AJVL 2AK1H 5HJ3A 3CLEL 4JGMA 1YPZF 1G9NH 5IW6B 4UMGA 2LFGA 1KB9J 3K8MA 5LAXB 2R4SL 1KJ3H 2OR8A 1HKLL 5KW9H 4JPIB 1A7NL 4JJ5A 1H3XA 1XCQB 4NM4L 4KQ3H 4ZAKD 3EJYD 1NCBL 3TBTA 1DFBH 4Y0GA 1KCUH 2BVPB 2P45B 3UJTH 5KTEH 4MNHA 1S7UA 4IRJA 3KPTA 1F6LL 3CH8A 5I1EL 1B0GB 3GSNA 3MUJA 1O0VA 3QEQE 2ADIB 3H3BC 2IG2L 1HHJA 5HHOE 3MTRA 3MJ7A 1ZT7B 3ZKXC 3KS0H 3MNZA 3NH7L 3P4OA 2AK1L 1A4KA 1E6OL 4GW5B 1G9NL 4KI5D 2X4TA 3DBXA 2EXWD 4XVJL 3K0WA 1EAJA 1RIHH 5DI8B 1U8NB 4P2QE 3VFGL 1A9EB 2XACC 1MNUL 2DMKA 4FXKA 4XP1H 1V3KA 4GRWB 4CW1B 3S88H 3UEZA 5GSRA 4MJ6A 5J6HA 5IHUL 4OKVA 1X4YA 5B38G 2JELL 2AQ2A 5DHXB 2NW2B 2BDNL 1OAYL 2J4WH 3LKNB 1Q9KB 4ZFZB 1BVKA 3MRHA 4FZEL 2OI9B 1ITBB 1AXSB 1WBYB 2EIZA 1A22B 4OCRL 5GS0D 2CD0A 3KPQA 5KSBF 3QUKA 2AK4B 4ZD3L 1YC7A 4L3EA 3FT3A 3RI5K 1D9KB 3MV9A 3QXDB 4G6KH 3QH3B 5C70A 1P6FA 2HJKB 1P84K 5HHMD 2Q8AH 3B9KD 4ZS6D 2G9HB 4Z76A 2BCKA 1NSNH 2BP3A 1ZLSH 3V95A 3PL6B 1RIHL 4RFOH 3VXNA 5C0BD 4L4TA 1OSPH 1K3IA 4K7PH 1O7VA 2H6PA 4XP1L 3UTTD 4PV8A 1HI6B 4Y8AA 1MCOH 2Q86B 2WLYA 4GKSA 1FYHB 2NY4D 1BD2E 1JHTB 3QHFH 1AGBA 3JV5A 5TGBA 5JLZA 2OJEA 1C08A 4AZ8A 2IAND 1HH9B 4DFHA 1NFIB 3MV11 1RK1B 4G8FA 2CDGB 1QPXA 3EFDL 2XIDA 3P30H 3IETA 2HKFH 3MRFA 3VRIB 4WV1B 3O45B 2WW8A 3RKDC 1T83A 3C5ZB 2Q8AL 2X4QB 3UTSE 2PKDA 3BIKB 5HPOA 3I02B 2V2TA 4JRXB 1X5YA 1AO7B 4RFOL 3NAAL 4RMRA 4WVRA 1OSPL 4K7PL 4LDEB 3B9AA 5ESAB 1UQSB 5DUBB 5HYJD 3K2UL 5HDQL 4KRPD 2VIRA 5GGRB 1A2YB 3PL6C 1NDGA 3ROLA 1A6VH 2PYFB 1QVOB 5DJYA 3PP4L 4R8WL 5F21B 4Z7OF 1A6WH 2VAJA 3G5VA 3MRPA 3WIHL 5D1XC 4EI5A 1L9MA 3MGTB 3P30L 5IFHL 3MRMA 2HKFL 3QIUA 5IFJA 3H9HA 4OGAC 3NOIA 3FQWB 1JWMB 2HKHL 4U6VL 2W9EH 2IPUG 2V5TA 5MERA 2HT3C 5FUCC 4Q9CA 3M45A 1IGML 1KNOB 4IRZL 4U1IB 4WV1C 3KYOA 1RUQH 2E7LA 3VFOA 2IBZY 1J0ZA 2Y7QA 3QWOA 4ZUWB 2AS5M 5ACZA 1A7RH 3DUUB 3H9SB 3DYMA 2R2HB 2X4UA 3ISWA 1XGQB 1A6VL 4O00A 1KTRL 2ADGA 2R23B 4LCCA 5T1MB 5KAQF 2ENYA 2YBRB 1T0NA 2VXTH 4YHOH 1YEGH 5IBLD 1IAMA 5DD5H 2XKNB 3SJVA 4NDMA 3VXMB 1RSFA 3DSNA 2NTFA 1DLHA 5HGHA 1JZ5A 4X4ME 4KC3B 1I3RA 4I4WB 5CJOL 5BCAA 5KSVB 5IMOB 4S10A 2DM4A 3FZUD 1J8KA 5GRVL 3D87B 4F7CA 3C87A 4NJ9H 3L3IA 3FFCA 2MHAB 4XH2A 2C3VA 1FL5A 4XMPL 1A7RL 3RPKA 1H3PL 3F62A 4QXTB 3IKKA 2ZSVA 4R7DA 4BZ2L 5CBEB 3N0PB 4UTAH 2AJZB 1N26A 4PY8J 3SO5A 2VXTL 4YHOL 4JY6B 4F7TA 5DD5L 1FBIH 1S9XA 4MXVE 1PW3A 2YPKA 3OJDA 4L3CB 1P84J 4WENB 2NR6D 2ZCLL 2R0LL 5D71L 1VESA 4HULB 1P4IH 4UNUA 2ATKA 2FRGP 1GGYA 5FYJU 4FS0A 4NRXA 4UV7H 3WIHA 3FT2B 4NJ9L 4NO3A 1C7TA 3OAZK 4S1DC 3D25A 4YHMH 4GW1A 3PXJA 2DKSA 1UWXK 3F12A 3VXRE 1VFMA 2YEZA 4P0DA 2V2WA 4LP5A 3V8OA 1W0VB 2KZ1B 3ZHLA 3SQBA 4UTAL 1LVEA 3GJFB 5IVXE 4N1EA 4KI5E 1FBIL 2F8VA 2FIKA 4P9MH 3VA2C 1BIHA 4BK4A 3UO1L 1SM3H 2ZUUA 4JY5H 3QHZL 1EHNA 4BZ1H 3CUPA 4EIZC 4N8VA 1P4IL 3VD5A 4P3DA 2D0FA 1KIUA 1Z2KA 4M48H 4WRLA 2YA1A 32C2B 4UV7L 5CJXA 5FUZL 4E41D 1SJEA 1XR8B 4WHTB 3O6LH 6FABH 3EOBB 4Q0XH 2JIXB 1FNEA 2ICWJ 1DQLL 3PQYD 2UYLB 5B39B 4XCEB 3O41A 4U1HB 1U3YA 2NX5A 3KPLA 3ZYIA 3BT2L 4PP1D 2R8SL 5HHME 4RAUA 3SDDB 4NZTH 5DJ0B 4HSQA 4P9ML 1C8PA 1BX2B 1SM3L 4UIMA 1P4BH 4O2FA 4BZ1L 4MB3A 2EH7H 3RL1A 2W60B 3UTTE 4M48L 5T3XH 2W0FB 1VADB 1KEGL 3EYOB 2DYPB 2H45A 1ZS8B 3B6SA 4L4VE 5IMLB 4GQ9H 4Y4KA 3NFNB 1I4FB 5AUMB 5EPMB 2PO6A 1FIGL 6FABL 3O6LL 4OFPA 3OG4B 4Q0XL 1AD0A 5MP6H 4YWGL 1YA5A 4M4RA 4Y7MA 1L7TH 1DDHA 4AEHH 4G43B 4NKOA 4MDIA 2AV7A 3EOAB 3BP7A 3U79A 4HF5H 3DUSB 5T1KB 3RTQD 1Q9WA 3BP5B 5D7JA 1JGUH 2KBGA 4Y1AD 1JF6A 1X7QB 1FYTE 5C07A 2CLVA 2ZOLB 1WBZB 3U4EA 3T1FB 2FZ3B 5IWLC 4HFUH 3BGMB 3U30B 3RVXD 4M7ZC 4MB5A 2AXJA 5H94A 3LCYA 3A67L 4HW6A 4S11A 4GQ9L 3TCLA 5C71A 4FFWC 5I8OH 5F1SA 4DGVH 4UBDC 5MEQB 2W9LA 3DLQR 3QDMB 1NFDE 4GXVH 1EMTH 5EORH 5INDA 1D6EB 5C09D 1L7TL 2YD4A 3VXQB 5CEXA 3R0MA 4HUUB 1DQDH 1ZA3B 2AQ1A 2P7TA 2IPKA 2Z4QB 4HF5L 4PGBA 4UQ2A 4OSUL 1JGUL 4KH2A 5E6IB 3SKMB 1CZ8H 5E8OA 3D1MC 4LNVA 5F88B 4JO3L 1A6TB 1OLZA 3QUZD 4EKXA 5AZ2L 2BVEA 2FJGA 1HHGA 1N6VA 5I8OL 5IT2H 4DGVL 1HILB 3VMOA 1OHQA 4EUPA 1CDGA 5L0QB 4GXVL 3N1GC 1BLNA 2EECA 1EMTL 1UH2A 3RIFK 3VXTA 3CFCL 4J8RA 1CLZH 2HFEA 5JPNB 1UYWH 4CN4A 4Z95H 3RWCA 4QHMA 3ALPA 4KVCL 2APXA 5JQ6H 1GRWA 2UWEF 1CZ8L 3QI9D 4R97B 3OL2A 5DMGC 3NFSH 1S78C 1LO5B 2ARJQ 4NRZA 1ZOXA 4UIKL 3VFMB 3FQNB 1D3CA 1NCUA 4N0YL 3QP3A 5E6IC 3LH2H 4IRSA 4C83A 4P5TA 2MNUA 4G80A 4Z7UE 2DLTA 3TBSA 2DM2A 3DX7A 3U9UB 4IMLA 4UT6L 1CDHA 4D0BA 4YGAB 5C6TL 4H8WL 3DECA 1PKQA 3DROA 4KKNA 1MFAL 1I9IH 4JDZA 1QO3B 4PR5A 5C0IA 1LMKA 5HI4D 4C4KO 3BZDA 1UYWL 1I7RB 4Z95L 5EOCH 2RHEA 3DX9B 4F3FB 5L0QC 5JQ6L 4OF8A 1J5OH 4KTYA 4ZQKB 2N4IA 4HS6B 4QWWD 2DLFL 2AJYL 4UV4H 1MY5A 4QHNB 1HNGA 3QBTB 1DUZA 3LH2L 1FZMA 3AAZA 5GS0L 4L29B 4R97C 5ERWB 1JGLH 3WIFA 1X4XA 3PG2A 2FH8A 2J2ZA 4XP9H 4PLKC 4BSJA 4XXCC 3SEPA 2HLAB 4K3DH 2QSCL 4PJ7A 5FK9A 3V5HA 2VLJE 3ZKMC 4OM0H 1XIWD 2CDEB 2QHRH 5EOCL 3EO0A 2RB8A 5IBUG 4YX2H 1JE6A 5FV2A 3BSZH 3QQ4A 4KKLD 1J5OL 1QYGH 3DVNB 5IJVA 3WFBL 2SEBB 1T2QH 5F6HJ 5FDYA 4TUJA 4GSDH 3S96A 1K6QL 5T33H 2YKLH 2YD5A 5T3ZH 4LP4A 4Z7QF 1RJLA 2AABL 2R39A 4ZAKA 4LCWE 2NXZD 4LEOB 4AIXA 3HG1B 5INCB 3KPSB 3PQYE 1NGWB 5IB2B 5CGYC 4HMEA 5C2BL 3QDJE 3TO4B 4K3DL 3F7YA 4XP4H 2XXCB 2E8ZA 2FJFB 1QOKA 1CGSL 3MFFB 1FDLH 4HUWA 3BD3A 1TCMA 5FM4A 4D0DA 5HGAB 3X11B 1OCWH 1U3HB 5EU6E 5DFTA 5I0ZA 1QEWB 3CLFH 4LLYB 1HK6A 3MPCA 1CGVA 3BW9B 4WJ5A 2I07B 2IADA 3LQZB 3SDCB 4AK1A 4D94A 1S7QB 1UKQA 5T3ZL 1IAKA 4J23A 1OGAB 2EIBA 3GMRB 1CI5A 3CMOL 4FA8A 2FO4B 1IQDA 3AS2A 2VN7A 3S4SG 2P8MB 1AE6H 3HI1B 3ARDD 3T0EC 2F58L 1K8DA 3P3YA 4U1GB 4H88L 4XCYA 4FN0A 4U6HB 4MQSB 3SQOH 4CDHA 1EHXA 4JO2H 1FDLL 1AXIB 3P4LA 1RY7B 3ARQA 4TTGA 1F2QA 3NA9H 4UQ3A 1YEKH 4OZIA 3TO4C 4LPXA 3B9KA 1L7IL 2H8PB 3CXDL 3ZTJH 1FSKC 5MEPA 2EDWA 4OD2B 1ORSB 5C0BA 4P3WA 5I17A 3T0VA 3PWPA 5EO0A 4I18A 3FFDB 3VFVB 1F6AA 2DQTH 4FFYH 4BFIA 4OBRA 1E27B 1GC1L 3KYAA 5CKGA 1AE6L 2DBLL 5C0FA 4Q9QH 2IANA 3OZ9H 4LAQL 3TESA 5ID1A 5FO8A 1MCEA 1YEKL 4J3WA 3R1GL 5BZWB 3ULSB 5IB3B 4YHKH 3D0LB 1A1NA 1T80A 4MWFB 3KPRE 1TPXB 2JJSC 5FYKE 1C5CL 1MFCH 4ZUUA 2X1PA 2HMIC 3MRJB 1MHHB 5L7XL 1ZHBB 1KJ2B 4Y88A 5KSAC 1KT2A 1K4CA 5HYJA 4P2RB 4HIXL 1F45A 1RK0B 4H1LH 4FFYL 3ARUA 4L8DA 4HIJB 1DBMH 4X6BB 3CFBA 1JZ8A 3OXSA 4GAYA 2ZSWB 4Q9QL 3RP1A 4PJ8A 1Z9MA 4FXLA 3ARED 3TPUB 3NZHH 1J18A 4HBCH 3GJFK 4X4XB 5IB5A 4J6RL 5TE6H 1WJ3A 5E4EB 5FB8A 3C60B 4ORGB 4PJGB 1MFCL 4PRHB 1AGFA 4K9EH 3X14B 2HRLA 1Y0LB 3W2DL 1MREH 2R1XB 4IOIA 4R3SA 4D2NA 3QXAA 2PW2A 5F7MC 4OZHE 1DBML 4XPTH 1RJZA 1XGRB 5EU3A 2FR4A 3EHBD 1JYWA 2YPLD 5TFSL 3KR3H 5FXCH 4M02A 3SGEI 5EU7E 4XX1G 3N85L 1FL6A 4HBCL 3JSSA 4ZNEE 1LD9B 4JVUA 1SEQH 3SKNA 5SWQA 2OTUB 1BIIA 3O9WB 3TO2A 4K9EL 3MJ8A 3HRZB 3C8KB 1KUMA 3RWEA 5E4EC 1AGEB 1QFHA 3P77B 5MHSE 1NDMA 2GTWB 3QDGB 4JZJB 3C60C 1ITCA 1MREL 3TIDA 1IBGH 5DTFB 4LKXB 5C0JB 4Q9RL 1GL4B 4P5KA 2W65A 3BJLA 4AEFA 4BH8A 5SWZD 3RWDA 5HJ3B 4NKMB 4N8PA 2YUVA 4YUEH 5AD0A 2XN9D 3KR3L 4UOW1 4XC1H 1VKXA 4QCIA 3PDOA 5FUOH 2HFGH 1NUNB 1HQRA 2V2XA 4RA0C 5IJKC 1MJ7H 4JJ5B 4QXWA 2PTVA 4PGCA 1IGTA 3TBTB 1LNUA 1EFXD 1SEQL 5JW4Q 2AXHA 4WWKD 4MNHB 1S7UB 1T1XB 4RNRA 4IRJB 3I3EA 4U7MA 4AIOA 4R26L 4XBGA 3GSNB 2VKXA 2UY7A 6CGTA 1E6JH 3U0WH 1HHJB 2WNGA 3MJ7B 3VMNA 1HNFA 1C16A 2YZ1A 3MNZB 4ODWA 4NPYA 5DJ6A 3RJDA 3P4OB 1A4KB 4YDKL 1GCFA 4JZJC 4GBXD 2X4TB 3DBXB 4PJCA 4X7SH 5FUOL 2HFGL 2I27N 4HKZA 2ORBH 3TV3L 3I50H 1MJ7L 1HEZA 5T5NF 1G9MH 5HXMA 4H1LA 3O2DH 4FXKB 2NXYB 4OTXH 1IVLA 1VPOH 4TVPH 3LQAC 5JW3H 5I30H 1X5HA 5GSRB 4MJ6B 5J6HB 4AMKH 4OKVB 2ED9A 4MJIE 1BQHA 4QYOA 2F9BT 4E41A 1F2XK 2MPAH 1BVKB 3MRHB 1JHKH 3U0WL 2HN7A 3ARFA 5C2UB 1M05A 3DTXA 4IRJC 1IL1A 2EIZB 3KPQB 4PJHA 3QUKB 4L3EB 3FT3B 4NZRH 1NCDH 1OWWA 1FVEA 3MV9B 4K7FA 4OD1H 3UYRL 2NY5H 1QPPA 3DMMD 3BZEA 3VGFA 4K94C 5BRZA 2BCKB 1A64A 1KOAA 3Q0HA 5DZNA 2EDLA 3MRRA 2DWDA 5C3LD 3IDJA 1PKOA 3VXNB 2X1OA 4U0RB 4PJEF 1G9ML 3UJJL 4OTXL 1VPOL 1X6LA 5FYJH 3V6FA 4WHDA 1SVCP 4GKSB 2DTSA 5I30L 1GOFA 2DWEA 1IC4L 4CAGA 1MRDL 3OSKA 1KBGH 2X1XR 4PJ5E 4NO0D 3VD4A 3H0TA 1AGBB 1OAUH 4J3XA 1UZ8A 4X6DE 5TGBB 3TFKD 3JTTA 2OJEB 1C08B 5JLZB 1JHKL 1TZHB 1ZAGA 3RWHA 2DLIA 1IAIH 4RGNE 4G8FB 4JHWH 5E7FA 4OLWH 4Z7VE 3IETB 4NZRL 3MRFB 2AEPL 1OY3B 4OD1L 2NY5L 1EUUA 1MAJA 1TJIL 2FEDD 3O3UN 3RTQA 2V2TB 4LASL 1QBMH 4Y1AA 4YQXH 1NC4D 5I1IH 4NQCE 2E5EA 3C8DA 4KDVA 4WI8A 5I1JH 5FYJL 1JN6B 5GJTH 3R8QA 1A6AA 1KIRA 4TNVK 3Q5YA 2GJ6A 2VIRB 1QFUL 1A14L 1NDGB 3ROLB 4U0RC 4G7YH 2OLDA 3T0XA 1XH3A 3G5VB 3MRPB 3MLXH 4GG6F 1LP9A 4Q7DA 1OGTA 4EI5B 1MELA 1L9NA 4OLWL 1KELL 1U8KB 4U05A 3MRMB 4XP5L 2HFFA 5C09A 3QIUB 1NL0H 5IFJB 3H9HB 3BP6A 2W9DL 4AQ1B 1E4KA 4JFOA 2BRQA 3WXWH 2FB4L 1QBML 2OS7A 5MERB 3QA3A 1MHCA 1TXKA 3KYOB 5I1IL 5LQBH 1B90A 3CD4A 3G5ZA 3PWLA 4XI5C 5I1JL 3GIVB 3G6AA 4RA3A 3VFOB 4TYUA 5GJTL 4LFHG 3C09B 4QRPE 3QWOB 4LNRA 3IU3A 5ACZB 2AVGA 4YDLC 2X4UB 2EDKA 2ADGB 3QUZA 1LK3H 4LCCB 4HH8A 1W8OA 1T0NB 1AR1D 2DB8A 3MLXL 1QFOA 1L0QA 1F11A 4EN3A 4YXHH 3OBAA 5BV7H 4NDMB 2CUHA 1ULVA 3WN5A 2R1YA 3BKMH 3QG7H 5F7YC 1DLHB 3KGRA 5HGHB 4PJIA 2FEEL 4QRUA 1I3RB 1FAIH 3UTZA 1N3NA 5D6CA 3WXWL 3EYQC 4F7CB 4ZTOL 3V2AR 3QIUC 5DSCA 5LQBL 2WBJB 1CFBA 3L3IB 1QSEA 3FFCB 4XH2B 2OMBA 1FCGA 2J7LA 2C3VB 2ZNWA 1FL5B 4BSVA 4KWUA 1LK3L 2ZSVB 4MVBD 4R7DB 2E7LC 1W0WA 1BWMA 3GMQA 3C09C 4LLWA 4XVSL 2Y72A 4F7TB 1S9XB 5DC9B 2YPKB 5BV7L 3OJDB 2AQ3A 1DBBH 2X1QA 5SX5H 4PTUA 4LCCC 3BKML 1F4HA 2H2SD 3RIAF 1DBJL 4OV6F 1UH4A 5LGHH 1FAIL 2I25N 2ATKB 3L3JA 2GITA 4XHJC 5MI0C 4NRXB 4K3HA 4NO3B 3D25B 1PD6A 4HUVA 4GW1B 3VG9C 3TZVA 3F12B 35C8H 4CVUA 3MXWL 2YEZB 4HDIA 2V2WB 4CJ1A 2WBJC 3HC0A 3WMSA 2V5MA 2HAZA 1B0WA 2CJUH 1JGEA 4B41A 1J12A 2EYRA 2XTJD 1H5BA 2FIKB 3LV3A 4PUBH 3S3JA 2CR6A 1BZQK 1A21A 1XIWA 1TENA 3CUPB 4N8VB 3WL9B 3VXSA 4P3DB 2DICA 1RZKC 4JG1H 4UILH 4G42A 4XNQA 1J9CT 4F7MA 2YN3A 1SJEB 1IGCL 3K46A 2F5BH 2DQDH 4V2BA 5KAQG 4G6AD 2ICEA 2OP4L 35C8L 3TT1H 1FNEB 3F5WA 4AT6A 1UACH 5JUEH 3EO1A 4MS8D 5E95B 3O41B 3KPLB 4LSTH 1SVZA 2CJUL 1EUTA 4RAUB 3EYSL 2EC8A 3KWWA 4WI2A 4UIMB 4LARH 3MX0A 4O2FB 3RL1B 4S2SA 4PRAA 4R2GD 4JQVA 3LN4A 1E4XL 2YD1A 3SPVA 4UILL 3BJ91 1IQWH 1H9VA 1RI8A 5JOFA 4Y4KB 5DT1H 2P42B 1PEZA 4WW2F 5C9JA 3ZE2E 3TA3D 2PO6B 2BJMH 4YHNA 3TYFA 3TT1L 5I1DA 5CJXC 1S7RB 5AYUH 1UACL 1IGIH 5JUEL 4HPYH 1DDHB 4NKOB 5C08D 2B8OT 4V1DD 3LDBB 4MDIB 3GSVA 2AV7B 1CU4H 4U1MA 3WFCH 3BP7B 1KC5H 1Q9WB 3ARDA 5D7JB 4J12A 4DFIA 1IFHH 1JGVH 2NX5E 1NKOA 4QHKI 3E6FA 1OW0C 4WY7L 5ALBL 5C07B 2GQHA 4M5YH 1EO8H 1FFOB 4M61B 4LARL 2CLVB 2H2PD 3V4UH 2IBBA 4HKXB 1FLTX 1WV7T 3W0WE 5H94B 3DRTA 1IQWL 3KDMA 4JFXA 4TOYL 3TCLB 5DT1L 1F4WL 4TQEL 5CJBA 3W11C 2CR3A 3LSOA 3QZWG 5ESQA 5AYUL 5GGRY 5INDB 1P7QA 1IGIL 5LXGL 4HPYL 2BNQA 4Y4KC 5JZ7D 2ADFH 1GOHA 2PO6C 1CU4L 2IPKB 2P7TB 2W0LA 4B5EA 4W4OA 4WUUD 1KC5L 1RMFH 4OM1L 4PGBB 4UQ2B 3GKZA 1PG7H 4DKEH 5E8OB 1IFHL 1JGVL 4HGWA 3LDBC 5D1ZD 4YXLH 4OLXH 2RAMA 3V4UL 3IB4A 3FB6A 2Y07H 4PJAE 3ZDXE 4LVEA 3RX8A 1D6VL 3IU4H 4QRRD 1LEKA 3UX9B 2FJGB 1HHGB 4RGMB 3HE7D 3UPCA 3C2AL 4ZTPH 1NCCL 3GM8A 3RNKA 4EUPB 4QTHA 1BLNB 3VXTB 5IQ7H 1W8NA 1J8HA 5MENA 3WIIL 1NC2D 1TVHA 1MCSA 3GSOA 4YIQA 2HFEB 3L3GA 3O8XC 2L7JA 4MXVF 3RWCB 1C1EL 4KVNH 1RMFL 3GK8L 3H6JA 1PG7L 4DKEL 1U3JA 3L7EA 1NBVL 3AREA 5K9OA 4NRZB 4OLXL 3S37X 2R9HC 3QUXD 2Y07L 4Z0BH 4JPWH 4IRSB 4C83B 4P5TB 4JFFA 2M2DA 3KXFA 3IU4L 3RBGA 3SN6N 4G80B 4KKBD 5FO9A 4F7EA 3TBSB 3DX7B 4IMLB 4N8CL 2VZTA 5LG1A 2DLHA 4D0BB 1G0YR 1W0YT 4I3RL 1FNSL 4X5LA 1PKQB 3OKOB 5DO2C 5IQ7L 3VD9A 4JDZB 4QKXB 2WSKA 4PR5B 5C0IB 1N5YH 4RGMC 3DARA 3DPBA 5IVXF 4CVZA 4KI5F 1R5VA 5E2VH 4KVNL 2YPLA 3C08H 4TSCH 5EZOH 5GIRA 5JW5A 4HIEA 2UV3A 4C55A 2BC4A 5H37H 2HTLD 1DUZB 4HWNA 1CS6A 5JR1L 4HBQA 4Z0BL 4GRLC 2V9QA 4JPWL 4WO4C 4A2LA 5CGTA 1FZMB 3AAZB 4PS4H 4M6OL 5DD0H 2EDXA 3TBVA 1DSFH 3RA7H 3WIFB 3MNWA 4PJDA 4XVTL 1XF5A 3SBWC 4LKCA 4KKAC 1X5XA 2OX5A 4IRSC 3UTQA 2BFVH 1Z9LA 4PJ7B 4QOKD 5FK9B 3V5HB 3M1BA 1SYVB 1X44A 2B5IB 5F8QC 1N5YL 1CFSA 4RWYL 3GB7A 5SWZA 1BOYA 4O02L 5E2VL 3EO0B 4U1KA 5T3XE 4TSCL 3QQ4B 5DMIH 3GMNA 2XN9A 1FHGA 2P49B 5IJVB 3RZCA 2O26U 3JWOC 5EO1A 1CVSC 4TUJB 3RJQB 3S96B 1RJLB 4ZG1A 1S9VA 4ZAKB 3GSUA 4U1LB 3CVHL 3ZL4H 4PS4L 2IAMC 4X99A 4YFEA 4HV8A 3GSXB 1I8MA 4PJFA 1BM3H 4KY1L 2O5YH 5B38A 3QUMH 2GCYA 3KYNA 3F7YB 2BFVL 1OTUD 2IALA 1LO3L 3W9DB 5I1LA 3WFZA 4HUWB 1FZOA 5IB4A 3AXLB 4D0DB 1EZVY 2GJJA 5HD8C 4B0MM 2DIBA 3V0WH 5CKAA 2P44B 2Z9TA 3PGDA 4XAKD 3O6FD 2IADB 4G9FE 4P5MA 5IEKA 1IAKB 4C56A 1J1XL 3X3FL 2BOCB 1OP3K 4PLJD 3ZL4L 1BEYH 1GXEA 3MBXH 2O5YL 2F5AH 5DRZA 1OM3H 2WWKT 3QUML 1NFDF 1IQDB 1YZZA 4ZAKC 3EJYC 2IMNA 3PV6A 1FGVL 5CD3A 1K8DB 4QRQA 2D2OA 4XCYB 3UYOD 1UVQA 3MACH 1UWGL 5HGDA 4RDQF 4LSQH 3LS4H 3V8CA 5IKCA 4UQ3B 4OZIB 4GMSL 5GS2H 3DMMA 3B9KB 3V0WL 1Q1JH 2X5PA 2I60H 4UT7H 5F9AC 4POUB 5F9JA 5IB1A 5C0BB 1DE4A 3FRUA 1R3IH 5I17B 4XCCH 3ZHDA 4KI5C 3PWPB 5EO0B 4DUWA 1RUKH 4Y5VC 2EXWC 4H8WC 3NPZB 2AEQL 4I18B 3DOSA 3HE6A 3BD5A 1F6AB 2UUDH 4BFIB 4Z8FH 5CGMA 2NY4B 3IYLW 4NO0A 1UJ3C 1OM3L 4K3EH 4P23D 2ATPA 4U6YA 3T0WA 2Y6SD 3NCJL 3T77A 1JZ4A 1XCTA 5C0FB 3GBNH 2IANB 5C0AD 3KAAA 4I9WE 5HSFA 2F19H 3K4ZA 1EJOH 2X10A 5ID1B 5FO8B 4EIGB 1CDYA 3CDGA 5E9DE 3GMPA 4PY7A 3MO1A 3MJ9H 3N06B 1A1NB 1I1YA 1Q1JL 4MNQA 2I60L 5GS0C 4WTZA 3DSFL 4QRRE 5BXFA 3V0AC 1NC4A 3GMOA 1R3IL 4XCCL 2ZG2A 1RZ7H 3B9KC 4ZS6C 4Z7UF 1KT2B 1K4CB 1QLEH 2VR5A 3MGOA 3WNNA 5HYJB 3VD7A 3GO1L 2AJ3A 3QAZB 4L8DB 5DJZA 1MCFA 4MLSA 3FN0H 3CFBB 2VXSL 3LMJL 2EE2A 3OXSB 4I18C 4HJJH 4ZS7L 4PJ8B 1AD9A 3QDHA 4Y2DD 2NY4C 5F8RC 2F19L 5IB5B 1RUAH 1QZ1A 5E5MA 5B8CA 5FB8B 3BIAX 3MJ9L 3QUMA 5JPMA 3EO9H 1AGFB 1FC2D 3QHTC 3VXUA 5DC4B 2BX5A 4TULH 2APFA 1QLEL 1YEHH 2VE6B 4IOIB 4R3SB 4OZGA 2PW2B 1BFVL 1CFVH 3FB8B 1N4XH 4NBYB 1RJZB 2FR4B 5EU3B 1NUDA 1BGXL 1OPGL 3SKUD 4KRPC 1WFTA 1SY6H 3QAZC 3AMLA 2NTSP 1FL6B 3MLSH 1RUAL 3FKUS 5CWSA 2WP3O 1YNLH 4ZO9A 5GS3A 3EO9L 5SWQB 1BIIB 2VDLL 4P2YA 3TO2B 2YWYA 2P5ED 2XZQH 3ZMRA 1PDKA 3RWEB 4LMQI 2BXYA 4JB9H 1OTTD 5F70A 1FNGA 2ZUWA 3JBG7 4CKVX 3FQTA 1NDMB 4BKLA 3TIDB 1IC5L 3FL7A 4P5KB 2W65B 2D7OA 1N4XL 3MLUH 1CLYH 3RWDB 4K3JH 3I3BA 4HKBB 3BPOC 5AD0B 3KJ4C 1VKXB 1SY6L 4B7LA 4QCIB 3PDOB 3NPSC 3QWRD 3OKNB 4R4BA 1HQRB 2E27H 2V2XB 4BZYA 1T21A 5TE4H 3EKCA 3IDYB 4EQ2A 5SWSD 1YNLL 4PGCB 1IGTB 1LNUB 4U0QB 4F8TA 5IBLC 2E7HA 2FX7L 2NY6D 4M93B 5C0EA 4RNRB 3ULUD 3RAJH 3U48A 5CEZH 4OUUB 2Z8SA 5J9PA 4XBGB 2VWEC 3RX5A 1K5NA 4JB9L 5FGCB 1CK0L 4R0LA 1GC1C 1G7LA 3DX6A 3FZUC 1TTGA 1JYNA 4M5ZH 3IXAA 2N7AA 4GKNA 4MA1B 3MJ9A 1C16B 2OR7A 4OCLC 5DJ6B 3MLUL 1CLYL 5BS0A 5HVHB 1OAKL 3B83A 2R0ZH 2O93L 3HR6A 4PJCB 4N0UA 4O2CA 5HI3D 4ONFH 4HKZB 2E27L 3WKNA 3K74B 1HEZB 1S8DA 4WFHE 3IDNA 1LEGA 2CKNA 1ODAA 1KB5L 4OLYH 2NMSA 4WFFD 3RAJL 3IDYC 1XEDA 3QPQD 2NR6C 2Y5EA 1BQHB 4QYOB 4E41B 2OYPA 1HH6B 1NLBL 3SO3B 5JQHC 3B4NA 2HN7B 3H9ZA 3ARFB 2FX9H 1M05B 3DTXB 4M5ZL 1IL1B 4X4YA 3FO0H 4PJHB 5EBGA 4Z78A 5D1QA 1FVEB 4K7FB 4KDTA 1JPFA 3U9PL 3BZEB 2R0ZL 2EXYD 1II4E 4NN7B 5BRZB 3Q2CA 4MA1C 4Z0XA 4ODVH 4WU5A 4U2YA 3O11A 4ONFL 3MRRB 2DWDB 4WI5A 1PQZA 3IDJB 1FL3B 1FE8H 3HC3H 4WW1A 3KLAA 3V6FB 5DMYA 1VACA 1PFCA 1WCQA 1F4AA 4OLYL 3VFWB 1MQKL 4I48A 3V7AE 3WS6A 2DWEB 4C58B 4JFHD 3JTSA 1N6QH 5HPMA 1SY6A 4F9PA 2VXUH 4MGXA 1LO2H 1Z5LA 3JTTB 3RPIA 1N0LA 3S3PA 5B4MD 2BHUA 3RWHB 2FX9L 1LO4H 5C0AE 2V17L 4WI9A 4GG8A 1S7XA 5DYOA 3SO3C 5C08A 4HWUA 4NZUH 4V1DA 3RTQB 4MZ2A 5A16A 4K23L 2C3WA 2FYYA 4JZNB 4Y1AB 3T3PE 2G75A 4K07A 4AG4L 1Q0XL 3HC3L 2X89D 4H20L 4NN7C 4ZFFA 4LFHD 4PP1C 4O58L 1KIRB 1DJSA 1INEH 2GJ6B 5I1HL 3QIWD 4OLEA 3DVGA 4KAQH 2EDJA 2VXUL 3IFOA 1KIPB 1GJIA 1LO2L 1XH3B 2OL3H 4ZODA 1KJMA 5GGQL 2OK0H 1LP9B 3T2PA 1DCLA 1OGTB 4YFDB 1V05A 2E3VA 1KB5A 3B2VH 2HFFB 5C09B 3QFJD 3BP6B 5T5NG 4RMTA 1DQML 1L6ZA 2VLKD 4JFOB 4WUUA 4CMMB 5HHXH 4U1JA 4GAJH 3BKJH 3OKYA 3QA3B 1N8ZA 1MHCB 4ZSOA 2DQIL 4G6JH 4PRPE 1Q9OA 3G5ZB 3PWLB 1T04A 3MREA 4O4YH 3G6AB 2BNRD 1MJ8L 4X98A 3RTQC 4ZNCD 4LNRB 3U6RA 1INEL 3IU3B 4OLVH 4ZXBD 1T03L 4X4ZA 2DMBA 5GHWH 3QUZB 4ELKA 3FO9A 4DGIL 4U3CA 3HE7A 4QHLA 2X7LA 2OL3L 3UBXG 4YHIA 3SY0A 2NW3A 3N9GH 2JJUA 1QRND 1F11B 2ZCHL 3RVXC 5CCKL 2IH3A 2VLRE 3WN5B 2R1YB 2XOTA 3B2VL 4KI1A 1NC2A 4KGLA 4APQC 4F15C 4G5ZH 4PJIB 2LVCA 4QRUB 1BECA 2YOCA 4MDJA 4OT1H 3UTZB 2VQUA 1N3NB 5D6CB 2DQFB 2APWA 4GAJL 3BKJL 4RFEA 5EU4A 5DSCB 3OAZH 1QSEB 2IMMA 1RU9H 4O4YL 3AFLA 1BQUA 2VR4A 1OAXL 1UWXH 4BSVB 3FB5A 4M1DH 5IROA 4Y4HA 4NNPH 3RGHA 4G8GD 4Y19D 5GHWL 4PRBA 1W0WB 1G7MA 5EUOE 3GMQB 1UM6H 4ELME 3FAWA 4LLWB 3N9GL 1MFBH 1JNHA 4FNLH 4P57A 4JFQA 3DO7A 4PTUB 5EB9A 3VG0H 3P40A 4TVPE 1G9MC 4G5ZL 5SWSE 4A6YH 1F58H 4OT1L 2DJ4A 2ICWA 3L3JB 2GITB 5JNYA 4X6EA 5IK3A 1DL7H 1F8TH 1P53A 1SYSA 3RWJA 1QR4A 2YK1H 2FGWL 1QP1A 4HUVB 2XXMB 3TPKA 3ARWA 4M1DL 3QI9C 4NNPL 4HDIB 1KN4H 5EDXA 3HC0B 2F53D 5I0DA 4PJXE 4NP4H 1UM6L 2PETA 1JGEB 1YYMH 1MFBL 4ISVA 3ZDYE 2EYRB 1H5BB 4POYA 1H3WM 3LV3B 3O6MH 4OZ4A 4EBQL 3SKJH 4QOKA 5FOJA 1UFUA 3OXRA 5F9OH 5E03A 2EKSA 5B21A 1XIWB 3B9EA 1F58L 3VXSB 4NOFA 5IM7A 3MV8E 2OL3A 3MLRH 5HI4C 4G42B 4LPTA 2YK1L 4XNQB 5F1IA 3ME0A 1E28A 4ORZC 2ICEB 1FZKA 4QWWC 2NXZB 4AT6B 1KN4L 5JOPD 1AIFA 4X6DF 4L8BA 5TF1H 3EO1B 3GKWH 2UVFA 3S4SA 4NP4L 3RU8H 1AHWC 1NCWH 3DUHA 5JIIA 3K7UA 4Z7VF 3O6ML 3SKJL 3F58L 3KWWB 5F9OL 4P99A 5E4IA 2LAAA 4FQXD 1WCBA 4PRAB 4S2SB 3TEUA 2P5WE 2KPNA 3WDJA 1H5BC 3LN4B 2EIEA 3V6ZA 3G5XA 4NQEE 3SPVB 4S0TD 3IT8D 3TC9A 1JYXA 4JFHE 1XIWC 5JOFB 2NQCA 5C9JB 5E99H 3MV7E 4KKLC 4YHNB 3TYFB 5L8LB 5I1DB 1RZGA 4X9IA 5TF1L 5I2IA 3O4LD 3GKWL 1X5JA 4I0PD 4M1GH 3GSVB 3CFDA 3L5WA 4U1MB 3WFDH 2MCPH 4X9BA 3VRJA 3ARDB 3L1OL 2NXZC 2JB5L 2NCMA 3RBSA 2IC2A 3E6FB 3NMEA 5DLMH 2LTQC 2A83A 2IBZX 2Q8BH 1JPST 5TH2A 1IKFH 3QRFM 5J56B 5A1AA 5K9KA 3PWNA 2V5YA 3ZLQC 3WKMH 1T1WA 5KVMC 5DJ8A 5FHAH 4JZOA 4NCC1 2OSLA 5DVMA 1Q8MA 1WFUA 4CRPA 3BWUC 5ISZA 3DRTB 3KDMB 4LSVH 2JCCA 4JFXB 3DXAE 5LGKA 1A7OL 2HYMA 4XPGH 3LSOB 5ESQB 1KCSL 4PV9A 5D2NA 5KOMC 3CIQA 4MAUL 2BNQB 4AEEA 5CJ5A 4WGWB 5GGTL 3S35X 1A3LH 3QFJE 3TN0D 4YZFE 2GUOA 2DLGA 2RBLA 5I71B 5D5ME 1I85A 2MCPL 4OFDA 2XQBH 2VZ3A 2NNAB 4HGWB 5DLML 4XBEH 3CU1A 1IKFL 3B43A 5ANME 12E8H 1HSBA 4M6NH 3FB6B 1MCRA 3WKML 3ARDC 1NBZA 4YK4B 2FATL 1MFEH 5D7SH 3RFZC 3V9FA 1LEKB 4GRWH 4LSVL 2R29H 3HC4H 4P3CL 3RNKB 5TJWK 3GSQA 4QTHB 4XPGL 1MQ8A 1QRNE 5MENB 4M7JH 3WLBA 1T22A 1TVHB 3GSOB 4YIQB 3L3GB 4KK6D 4WI6A 2VQ1A 3X3GH 4G3YH 3VDBA 3ULUL 3AM8A 3L7EB 1R5WA 2XQBL 3G04A 4YHZL 4Y2DA 4XBEL 5I74B 4NJAH 3AREB 4DAGH 5K9OB 2XYCA 4M6NL 4W4OC 3OWEA 5I71C 5BW7C 1BJMA 3U4BL 2XT1B 1VFBA 1A9BA 3SDXA 4JFFB 2H41A 3KXFB 1MFEL 3T2NH 2XRAH 5FO9B 4F7EB 4YO0A 4Y19E 1U8MA 4G8EA 1WWCA 2Q7YA 2A77L 3EIFA 3HC4L 1G9EA 3G08A 4LPVA 4HEPG 4GW4A 3IGAA 1OAQH 2DQHH 1ORQA 3EYUL 4MMXC 4CVZB 3S34H 1QUNA 1R5VB 5GS1C 3X3GL 4G3YL 2YPLB 3VFNA 4K7PY 5GIRB 5JW5B 4HIEB 1P5UA 1RUML 2Z31D 2BC4B 1JF1A 1KEMH 4DAGL 4OIBA 4G8IA 1TDQA 2R0KH 3EAKA 2G2RA 4AENA 3D3VA 5GGTA 3PHOA 3TBVB 5I74C 3MNWB 3AREC 2FHBA 3OTTA 2V9TA 4PJDB 1OOAA 1XF5B 4JN1L 1IAII 2P5EA 1NAKH 4UTBL 4LKCB 5DD6A 3WUWG 1YY8A 3UTQB 2NY1D 4X7DC 1NGPL 3M1BB 1UC6A 1OAQL 2MCG1 2DQHL 1U0QA 2V9RA 2N56A 1BF2A 3GB7B 5SWZB 4Q58C 3S34L 1F3RB 5FFLA 1CR9L 3A0OA 4U1KB 1NMBH 2VR9A 4JE4B 2XN9B 4NT6A 3VXPA 3VMPA 3VGAC 3O4OB 3RZCB 4POZD 4JHAH 4Y4FD 5EO1B 2ESVD 5ETUA 3EHBC 3U7AA 2R0KL 1CFTA 3LKPA 1S9VB 3GSUB 1J1OL 1S3KL 4X99B 4HV8B 1I8MB 5E08L 5B38B 3ZE2F 1TQBB 1CVRA 5I1KL 1J11A 2GCYB 5JDSA 4UZGA 4TUKH 1JNNH 2GFBA 2EYTA 2IALB 3DV6B 4CU8A 5I1LB 2FEEI 5D7LE 1FZOB 5IB4B 2WIIA 3LPWA 1U8OA 2XKSA 4LLQA 1A02N 5C0RH 4K71B 5DD1H 3PGDB 4HAGA 1WT5A 1YYLH 5D7IA 1DLFH 4X6CE 1DTUA 1ZVYA 1Q94A 1CG9A 4P5MB 5IEKB 2E6PA 3CSPA 3RNQA 3LKQA 1R5IB 4R90H 1AXSA 3O4OC 3KLHD 5A2IH 5DRZB 1D5IL 4LGSB 5FYLD 3O4LE 1T66C 3P2TA 2VYRE 5IW1A 3ILQD 5E2WH 5E70A 1X5GA 2G9HA 3PV6B 3LZFL 5CD3B 2BSRA 1YPZA 4QRQB 4WWKC 3TIEA 1UVQB 5HGDB 1TQBC 5ENWA 3NACL 5E1HB 5IKCB 4HS8H 4RZCA 1UH3A 1E4WH 1ZGLP 3DMMB 5C0RL 3F65A 4MNGE 5D1XA 5DD1L 3CFEA 4HGMA 5IFAH 1YYLL 3MCLL 1DLFL 2G60H 2VZOA 3CZFA 4PJAF 4FOMA 3ZDXF 5F9JB 5IB1B 4HJ0D 1KENH 1DE4B 3FRUB 4L9LA 4ONHA 4JFYA 4HWZA 4GBXC 3SGDH 4K71C 5F7KC 2IF7A 3HE6B 2VISA 3LRGA 4C56E 3K8LA 4NO0B 4NUJA 4WV1A 5IV2A 2J8OA 2ATPB 1EO5A 4U6YB 5E2WL 5FHBL 1A0QL 3T77B 4BK5A 5IBTL 3O3DA 1XCTB 3I02A 3RUGE 2DRUA 3B3IA 4R7NA 3CVHB 3GJFH 5L2KD 3GUTA 4GAGH 1GHFL 3CDGB 4FFZL 2VSCA 3GMPB 3RVUC 4PY7B 3MO1B 4DN3L 5KBNC 1I1YB 4MNQB 5D6DC 2PYFA 4UT9H 1QVOA 5BXFB 1OAZH 1NC4B 3DMMC 3A6CL 4PRIA 3NN8A 3MGOB 5DJZB 1CLCA 2VL5A 3HUJE 5FCSH 3MSPA 5KSBA 3HMWL 1JHLH 1N5AA 1XF2A 3S9DB 1QFWH 3TNMA 3ZO0A 3I6LD 5IESL 1AD9B 1FPTL 2X9YA 4H0IA 2C7UA 4CBPA 2HVJA 1JL8A 4GAGL 2WINA 2F54D 3QNXA 5B8CB 3QUMB 5JPMB 3OJVC 3D9AL 2VLKA 3NCEB 2R2HA 2H9GA 4UT9L 3NCMA 4PFEA 3PGCA 3VFSA 4GQPH 5T1MA 4DOHB 1HXMA 3VXUB 1V3MA 3STBA 3S35L 3RX7A 2BNRA 2FEDC 4UU9A 3ARVA 1EEZA 4OZGB 4JM4L 1DR9A 4ZXBA 2W59A 4MCYA 2M26A 1JWSA 3ULVD 4RDQG 1UZ6E 1JHLL 4MQXD 1EFQA 4KROC 3HMXL 4QNPE 1QFWL 5C0CD 1RFDH 1AC6A 5KVFH 4NGHL 2PXYD 1IM3A 4FTVD 5CWSB 4F37F 3TH2T 1DP0A 4J3SA 2ZPKH 5E5UB 2UZIH 4P9HL 1MI5D 2XWJA 5DUPH 2VUYA 5B8CC 4HMDA 1FNGB 3FQTB 1OD9A 4BKLB 1LE5A 3SGKA 4HPOH 5IHBA 3H3PH 2R2BA 3VI3E 4G8GA 1BZ9A 4Z7WE 3ES6B 1A1MA 1JPGA 1RFDL 3FONB 4R4BB 5DJCA 1QBAA 3R06A 1T21B 5KVFL 3IDXH 1F3DJ 1OLLA 2OTPA 3V52H 3F8UB 1AR1C 4YBLB 5ADOL 2WUBH 2ZPKL 5FGSA 1I9EA 5C0EB 2UZIL 3PHSA 5CJQH 2DI8A 3OX8A 1K5NB 1KFAH 1URLA 1FNFA 4R0LB 3DX6B 5ELIA 1F4XH 1T3FA 4XNUL 3H3PL 3IXAB 4GKNB 3MUGB 3L3HA 4NOBA 3VA6A 1JTTA 3RWFA 5BS0B 4M3KB 2F53A 4AJ0A 4L3AA 1CQKA 3PXHA 2NZIA 3QCUH 1SHMA 1OARH 3P73A 4N0UB 4O2CB 5DA0B 2XTJB 1TITA 1S8DB 4BM7A 3IDXL 3DETD 4I77H 4MVBC 1ZVHA 5HTSA 3KYKH 3V52L 3GI8L 1NLDH 3IDNB 4F57H 1LEGB 2WUBL 1A3RH 3M07A 5TF0A 3L3DA 3KNBA 4OD3H 1DEDA 4Q2ZB 3HMXA 5I1AA 5DRWA 4OZFH 4YE4H 1YEJH 5CJQL 1UWEH 2H2SC 4M9PA 3LB6D 2XY1A 1KFAL 2Y5TA 4OBSA 4NQDE 5J0BA 2QQLH 3CFIC 4YJZL 1MIEH 5IWLA 4X4YB 3P0GB 5ALCH 5DXWA 1RULH 2J88L 3NABH 1FO0H 2GHWB 4Z78B 5D1QB 2NZ9D 1JPFB 4NSKB 3IFLH 4R0LC 1TZGL 3UCRA 3QCUL 1OARL 5AWNL 4Z0XB 4HH9A 3O11B 2NY0D 1PQZB 1J1PH 4QXUH 2CIIA 3D85A 1LO0H 4I77L 2YD3A 3KYKL 1ZE3C 4WW1B 1JZ7A 5EPMA 4F57L 2A0LD 3KLAB 1VACB 2B2XH 1AGDA 1J10A 4FQXA 2OCFD 1A3RL 1INDL 2XTJC 4OD3L 4I48B 3JTSB 1MJUH 4YE4L 5HPMB 2P43B 4JFDD 3EOAA 1Z5LB 4E5XA 3DUSA 3RPIB 2QQLL 2QSVA 1JJUA 1LDPH 1CDIA 5HYQB 5E94A 4N9GA 4I2XA 1RULL 1FO0L 4GG8B 3IFLL 1RHFA 1S7XB 5DYOB 4OFKA 5C08B 2W92A 4V1DB 5JHLL 3BDBA 4G6AC 5A16B 4G6FD 2PTTA 1HCFX 2GSGA 2FYYB 2B1HH 1M4KA 2G75B 2DQGH 4FMFA 4HWEL 4MS8C 4QXUL 1LO0L 2YA0A 3LEYH 1M1SA 3FMGH 4ZFFB 1IE5A 5ADPL 2B2XL 4W70A 1F13A 3DX8A 1ZLWK 2YD9A 4MA8L 2NYYD 3P4MA 3IFOB 1ZA3A 3SDAD 5HVWA 4HFWA 1KJMB 4R2GC 3WS6C 2ZKHH 5E6IA 1JFQH 1RUPH 3GGWA 4M8QA 3I6LE 5F88A 3T0BA 5HVFB 1KB5B 5HDLA 4F9PC 4CN6A 5FM5O 1YQVH 2AEIT 3BIBX 2F54E 3HZMA 3GJEA 3TA3C 3TN0A 2HRPL 1YUHA 1IT9H 4WUUB 4EQ3A 4U1JB 3QO1A 3S36X 2B1HL 1N8ZB 2DQGL 4Q6IA 1Q9OB 4M62L 3LEYL 3CU7A 3FMGL 3MREB 4KHXL 1EHAA 2OXGA 3FAXA 2PTUA 3U6RB 4AL8H 4HZAA 1QLRA 4ELKB 3ULVE 4Y16D 1BJ8A 4HC1H 3HE7B 4QHLB 2H2PC 2X7LB 3MC0A 1GIGH 4OF6A 2AXGA 4LIQL 4YHIB 5DFVD 3RVWD 3SY0B 4K8RD 4CU6A 5CZXD 2IH3B 1NC2B 4WCYL 4HMCA 1YQVL 4OZFA 2IGFL 4YR6B 5JXAL 4QTIH 4MDJB 4KMTH 1PZ5B 4XPFL 1U8QA 2VN4A 5CEZE 2EDOA 4RFEB 5EU4B 5FYLH 3U9UA 1MF2H 2CK2A 1AR2A 1YNTA 5BQ7A 1SQ2N 4RRPG 5LBSL 4JFED 1FO0A 5D2LE 2Y1VA 2GK2A 3QUXB 5TDOA 3FB5B 3MLWH 1T5WA 2PYEE 4AL8L 4O9HL 4Y4HB 2IFFH 4LVNB 2WUCH 4RMWA 4PRBB 5D1ZC 1G7MB 1ZANH 4TRPH 2X70A 1J86A 3REVA 5E24E 1JNHB 3TF7C 4P57B 4DZBA 4JFQB 3DO7B 3V0VA 4CL7A 3HE7C 5F7LB 1YMMD 4YDVA 4Q74A 5IBUB 3JV0A 2C1PB 4QTIL 5GJSH 4KMTL 3UZQA 3DGCR 5JNYB 5HHNA 3RDTD 3B5GA 4X6EB 4QEGA 1JCKA 5IK3B 4DN4H 4E42A 1FFQA 1SYSB 2Z31A 5FYLL 3RWJB 1MF2L 1AI1H 5D70H 4HWBH 4X9GA 1NEUA 4EDWH 3LPGA 2Q1EA 4KV5E 1BMGA 5DVKA 4MAYD 3WD5H 2XZZA 1KJ2H 3I9GH 1X5IA 2WQ8A 4OF0A 3QUXC 1JV5B 4ISVB 5ICZA 4OQTL 3IRPX 4OZ4B 4KJWD 4QOKB 1BPVA 5I19L 4KKBC 3OXRB 2UWEA 1M7XA 2EKSB 3NZ8A 3JWDH 5HBBA 2QHLA 4IMKA 5DQ9A 3TM6A 1V7ML 4M8VA 5GJSL 1QHOA 3T0EA 3CSBA 4X5WA 5IM7B 5KS9E 4KGJA 4PGZA 2OL3B 3KLDA 3AU1A 2QLVB 3SGJA 3SE8H 2WZPD 5F1IB 4KZDH 2R0WH 3QEQD 4Y4FA 2ESVA 1E28B 1MCHA 5HHOD 1QACA 3P4NA 4MD5A 1FZKB 4NBZB 1JNJA 5JO5A 5CAYB 3U4AA 1OP5K 1AIFB 1HZHH 3G6JE 3I9GL 4L8BB 5D96B 1I8LA 3KYMA 3S4SB 1QEWA 5SV3A 5E8DL 3ZTNH 3VH8G 4P2QD 2I07A 3KS0J 1WLHA 3JWDL 3KVQA 2RJMA 4FQ1L 1WCBB 1JZ3A 3V6ZB 3T3PF 3G5XB 4KUZH 4UB0H 5EU5A 2GEEA 5JA9A 2A2QT 2FO4A 2R0WL 4R96B 1BFSA 4PBXA 3HPJA 2XQYG 5E2JA 1UJTA 2EDQA 1RZGB 3W5MA 1HZHL 1KB9K 1ZTXH 2JKXA 5I2IB 2YUXA 3IKCA 3L5WB 3THML 3I6GA 3VRJB 5KSAA 3C5JA 3ZTNL 3V4VH 5D96C 4IOFD 2A83B 5TH2B 3O8XD 2M8XA 1G0DA 2ZUYA 5K9KB 2C1OA 3LQAH 3PWNB 3BE1L 1T1WB 1RIUH 5DJ8B 3F7QA 1BD2D 4JZOB 1OTUC 4UB0L 2OSLB 4PREA 1Z9OA 4M4PA 1CQYA 2EC9U 4OQTA 5ISZB 5LCVH 2JCCB 4BQBA 4HS3A 3ZT7A 1MLBA 4LBEA 5HI5D 3QYCA 1YNKL 2DMCA 1UENA 3WJJA 3GSNH 4PV9B 5D2NB 3O6FC 4M00A 1ZTXL 1I1AD 1N0XH 1MPAH 1H15A 4K94H 3UTSD 2GUOB 3ARGD 1HDMA 3LHPL 4PLJC 3D39E 5F7EH 3V4VL 3LN5A 4G6ML 2VDKL 3IJSA 3P0VH 2HJFA 1MCNA 4M7LH 5L2KA 1X5AA 1HSBB 3BI9X 1ZHBA 3LQAL 4TSBL 1NANH 2JB6B 3O0RH 1RIUL 1NBZB 5F93C 4P2RA 2J8UE 2VJXA 5A3ID 5LCVL 2DOCA 3ABZA 2BXZA 4PY8I 4ODUA 4I8DA 1JF5A 3GSQB 1ADQH 3DRQA 5IF0A 4L9DA 3WLBB 5EUOF 4ELMF 1IGFL 3PJSA 4CMHB 2VQ1B 1I7TA 3C5ZD 5JW4R 5D2NC 4E9LA 1R5WB 3VWJD 1V7NH 1QA9A 1GZQA 4Y2DB 1SJVA 3MLZL 4FQJL 4JRXD 2BNUA 4P23C 3O0RL 3V6OA 2Y6SC 4NKIL 4W6YB 2R1XA 1MRFH 1A9BB 2WANA 3HI5L 4NYLA 1KCKA 4YO0B 1IEHA 4JRYE 1U8MB 5IJKA 4G8EB 3CSYA 1KPRA 1N59A 2Q7YB 5MEOA 4U1SA 3G08B 2YRZA 5I75C 5K9JL 2R4SH 3AVEA 3ECBA 1Y6NR 1ADQL 4GW4B 2APTA 1HKLH 4PJXF 3IGAB 4GH7B 3MNVA 5D9SA 4NQVA 1ORQB 3S36L 3ZDYF 4NM4H 4LK4A 2GJZA 4FMKA 4XVUC 4OCNC 3VFNB 5D7IF 5GISL 5JHDD 1V7NL 4RMVA 5C0CA 1JF1B 1XZ0A 3IFNL 1M6OA 1EERB 3AUVA 1JGDA 3SE4C 4CMHC 1HIML 4G8IB 2PXYA 4YC2B 4FQ2L 3WS3A 4FTVA 1PX4A 4AENB 4PJBE 2IG2H 3RY5A 1UA6H 3PHOB 1MRFL 4BSWA 4HIHA 3EZJB 5IMKA 2ICWI 1JPSH 4Y2DC 3TVMD 2DI9A 4RQQA 3OAUL 3LEVH 1E6OH 2P5EB 3ZSSA 4NKMA 1FVCA 1MI5A 3B9DA 3OJMB 5DD6B 4GOSA 5KANI 1JP5A 1YY8B 4XVJH 1ZMYA 4KK9D 4OGYL 3H9YA 2BY2A 3VFGH 1H8NA 4YHLH 5DR5H 1MNUH 1AJ7L 4QO1A 2B4CL 1MVUB 4NT6B 3VXPB 4PP2A 1T1XA 5IHUH 2JELH 5ETUB 2BDNH 1OAYH 4YFLF 1CFTB 3LKPB 4FZEH 3VXRD 1UA6L 2L4OA 1OP3H 1JPSL 4OCRH 2NY6B 4ZD3H 3D3VE 3LEVL 4YC2C 4OLZL 2DTML 2Z35A 3ZKQD 5JDSB 4KHTL 2GFBB 2EYTB 2HTKD 1EHLL 2WIIB 4YHLL 5DR5L 2YPVL 1U8OB 1VCAA 1OTTC 3QUYD 4LLQB 3EOYG 5DMKA 3BX7C 2HH0H 4GKZA 5D7IB 1YC8A 1BZ7A 2X05A 1ADQA 1Q94B 1CG9B 1AQKL 4RBPK 2V5RA 3C6LD 4HUKB 1YJDH 1ACYL 4K8RH 4JHZA 5KG9A 3RNQB 3LKQB 5DZLA 3EFDH 4YPJA 2QEJA 3N1MC 4PB0L 2VC2H 4DWHA 1Y6MR 5IW1B 1TQCC 2Q87A 2WLZA 1UM4L 3GNML 5KJRH 2GIYA 2BSRB 1YPZB 2NY6C 1DBAL 3EJZC 5KVDH 3TIEB 3ULUC 3D6GA 3GDBA 3NAAH 1WIOA 5ENWB 3IAPA 5D5MF 4RZCB 1T0PB 1HWHB 3K2UH 5HDQH 1WZLA 1RZKH 2HH0L 2ZG1A 5D1XB 3CFEB 4GRWE 4LHUA 3MRKA 4L4VD 2EZ0D 3CZFB 3PP4H 4R8WH 3MUHL 3OB0K 4L9LB 4ONHB 4JFYB 1HSAA 1TZHA 1YJDL 4HWZB 4K8RL 4TPRH 3WIHH 1GGTA 1WT5C 1GGIL 4XNYL 5HI3C 2Z8VC 5FV1L 2VISB 5IFHH 2VC2L 4JDVA 1J0YA 2XWBA 3CGTA 4W81A 2ZUQB 4NUJB 4ODXA 1PAMA 5IV2B 2AK4E 4JFDA 4OF7A 5KJRL 3O3DB 4FG6D 2HKHH 4U6VH 4NWTH 3UTPE 4AYFA 3B3IB 1WAAE 4R7NB 1FYTD 5KVDL 2R4RL 3SDDD 1IGMH 4IRZH 4HUNB 4N0CD 3QPQC 3GUTB 3E3QC 4BUHA 4BUGA 1MWAL 1JN6A