2A1WH

Anti-cocaine antibody 7.5.21, crystal form i
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
225
structure length
225
Chain Sequence
DVKLVESGGGLVKPGGSLRLSCAASGFTFRNYGMSWVRQTPEKRLEWVAAISGNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARHDDYYGKSPYFFDVWGAGTTVTASSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin light chain kappa
publication title Flexibility Of Packing: Four Crystal Forms Of An Anti-Cocaine Antibody 7.5.21
rcsb
molecule tags Immune system
total genus 45
structure length 225
sequence length 225
chains with identical sequence I
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a1wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a1wH01
2GTZA 1EIBA 4LFHD 4K9EC 4U6TA 4HGWB 4X7DC 4J4PA 1LO5A 4JFHD 3C5ZB 5HHME 1WFUA 1XZ0A 2APBA 2BVQA 2BVOB 3UBXB 5JHDB 1EEQA 1J0IA 5C8JA 3C87A 3UTTB 1A3QA 4K7PL 2F58H 4X6DF 4NSKA 4P2RD 3K8MA 5I71B 4POYA 1MJ7H 5GJTL 3W2DH 1ND0A 4RA3A 2AEQL 3B8SA 4V1DD 5F7LB 3ZKXB 3OR6B 3QDAA 2X1XR 1T03H 1ZGLA 2IALA 3LIZH 4MD4A 3RUGA 2JIXA 4PJDB 5DFWH 1R6VA 2NNAB 3DI3B 3BGAA 5GSVB 3FL7A 1HNFA 5FYKL 3BYTA 5D7IB 3VFWA 1Z9OA 4XCFH 3JTTB 1NGYB 2WBJD 1MEXL 1I75A 1IAKB 5CWSA 2I24N 4NQCD 4P2QD 3SOBL 3BHBB 1F97A 1UKQA 5JQ6H 3BN9D 4CVWA 5B21A 4D8PB 2DJSA 1YPZE 4JKWA 5E1AA 2NW2B 2C3VB 5CBEA 1N6VA 3MRFA 2RB8A 4IRJD 3L3JB 1IC4H 3MRIB 3CSPA 1OCWH 3P0VH 2FJGA 4P5TC 4GBXB 3QXTA 1JV5A 4N5UA 3BIBX 3QISA 5SWZA 3ES6B 1I1AA 5MEQA 2AJVL 1OP5H 2VDRH 2W0LA 1QSFD 4X6CB 4LQFL 4RMRA 5E94B 4LEOA 4Z7UB 2F15A 2FYYA 1GAFL 3VFOA 4HK0B 2YUVA 1N4XL 5JA8B 1Q72H 1V7MH 5F9OH 3X17A 5J0BA 4NIKB 4P9HC 4Q2ZA 3BO8B 4HKBB 1MQKL 4NWTH 5ANMA 1JI1A 5GGQL 4PJ8A 3ELAT 3VWJD 1PYWA 1H15A 2DKSA 3Q0HA 5E8OB 3V0VB 4UNUA 1YMMB 2AJ3A 1EAJA 3DVNA 1SEBA 3BKCH 4P2OC 4CN6A 2BY0A 4PG2C 4N8VA 1HCFX 4JHWL 2CSPA 2P5ED 3GO1H 5DQDH 5HHMB 5CP3A 3FQWB 2AEPH 1P5UA 4DFIA 1P4BH 5TDOB 1F4YL 3FB8A 2DQTL 5ACZB 4YDLB 3G04A 3KYMA 5MEOB 5FOBB 3CK0L 5ITFA 4Y4KA 3QO1A 5F89A 1M7DA 2OP4H 4JM4H 3OHXB 5I18H 5IR1B 1EDQA 2H41A 1FSKC 1KJMA 4KJWC 5JXAL 1ZLVK 5AZ2L 4JQVA 4KTEL 4BSVA 2OK0L 3CCHB 4ODTL 4S1SH 4MA1C 4WI9A 1BAFH 1LEGB 3TYGL 3VD3A 3MRHA 3L3KA 4UDUB 5BOZG 3M07A 4QHNB 1J87A 4KAQH 2ADFL 2CJUH 5D1ZC 4HIIB 1H3PL 3VFRA 5I9QB 3CMOH 5E70A 4LEXL 4EUPG 4GMSL 2UWEA 5FUCC 4YHPA 4MJIE 4K8RD 1HI6A 3C6SA 5HHOD 1MCNA 1U3YA 3N9GL 3P4NA 1R5WA 1VB9A 3V6FB 5DSCA 1JPGA 2IPTL 1CD0A 3MPCA 3GMQA 2EYSB 4M1GH 4G8EA 4JREC 1EVTC 2C3WA 3E6HB 3JWDC 5EU6A 2F5AH 5K59F 5DWUL 4X7SL 4GAGL 4TSCH 3GMOB 4G6AD 3KNBA 3FFCE 3QUZA 2VZOA 5HI5D 5ERWA 4X5XA 5EO0A 4YBQC 1UACL 4GT7A 2QSCL 4YXLH 3WO4B 5K9JH 3EJZD 4MB4A 3S36X 3V5HB 3FT2B 2YEZA 4KZEH 2BNUA 3OF6D 3MGOA 2V5MA 4J3UA 3GSWA 3QRGL 2PYFA 1JTPA 4DZ8B 4LSTL 3ARBB 3TCLB 3T3PE 2A1WH 3MLZH 5IMLA 3F6IA 1YDPA 1D9KA 4ZUSA 2ZSWB 2F19L 3BIAX 2X4QB 3FFDB 4OSUH 1LDPL 1IARB 1RV6X 3N85L 5FHBH 4WV1B 1T7VA 3LEYL 3VFPA 5I1LA 3T1FB 2VRAA 3CFCL 1N0XL 1NMBL 3KYNA 4I77L 4JN2B 4M00A 5DJCA 4O2EB 4ZTOL 1T1WA 2IEPA 4X4ME 2IJ0C 5F7NC 4A6YA 5ISZE 5BW7A 3VE0B 3MNVA 1T22A 4NNPL 1ACZA 2MQ0A 5D7JA 4WHCA 4IMLB 1DFBL 4C56B 3LQMA 5FYKU 4LGSB 1P1ZB 1G6RH 4CL7A 4FQIL 1WIPA 4NNYB 2BCKB 4R26H 5JUEH 1BFOA 5C0BD 2BC4A 5E2VL 2CR6A 1MUJA 3T65B 4X98B 4Y16A 3TO4A 2EE2A 1NKRA 4UB0L 5D7KD 1U8IA 5DMKB 2A83A 4MJIB 1PY9A 4PJHF 1DL7L 3MLRL 4HIHB 2QEJA 4Y1AE 1K9TA 3D39B 1I7ZB 5JPNA 1BBDL 3D18B 2OYPA 5DJDB 4Z78B 2LU3A 1L6XA 3SE3A 2VKWA 1A4KB 2VDLL 1IL1B 4GKSB 1OP3H 1HYRC 5HDBF 2XWTA 3BH9B 4R0LC 3ROLB 3U4AA 3VXTB 3IDMB 2OSLA 5FUOH 4X4YA 1A1MA 3UROR 1MRDL 1P4LB 3GZKA 4PB9L 2XWJB 3FFCB 5CD5C 5CIPH 4XRCA 3EIFA 1DQDL 5D2LE 3P2TA 3PNWA 2BY2A 4JRXA 1GGCH 5DRNA 2OTWB 1MY7A 4TUKL 3FO2B 1QFUL 1OGTB 4PPTA 2GSIB 3RL1A 1R0AL 4XB8A 2PW1B 2FIKB 1B9ZA 3OTTA 2Z8WC 1J5OL 1FLRL 3KLAA 4OF8A 4WHYH 1GPOH 1I3GL 3MV8B 4NQDE 3MRBB 1MIMH 1LO3L 1N6UA 1QRNB 1TETL 2ADGA 4P5TB 2O5XH 5TFSH 3SDXA 3VRLF 5GGTH 1GZQB 1QA9B 3EDFA 3TV3L 5IW1B 3RX5A 2X4TA 1JPSL 3W81A 4NRYA 5GS0C 3ULVF 1PG7H 1A3LH 1MH5A 2VR4A 3KHQA 3P11L 5F1NB 5C08A 5ISZB 2C3GA 4E0RB 5T3XL 3VFTA 5CILL 1BVZA 4Y2DB 1ZA6B 1GH7A 4HD9A 4R2GB 2MOVA 3SDAD 4L3AA 3A6CH 4K2UL 2FBJH 3I6KB 3MACL 4QTHB 1XGPA 1I9RL 4RWYL 3U36A 3FQUB 4LLYA 1WZLA 12E8L 4X5WA 3OKDB 5MENE 1M6OB 1BIIA 4QXGH 5IQ9B 2A77L 4X7CC 4YXHL 4FG6C 4IRSC 1MCEA 3BPNC 4P2OB 2IGFH 4G9DB 3WL9A 4RAUA 1KENL 4MJ6B 4HS6A 3QNYB 3IDUA 2EKSB 2F74B 3RVUD 3WFEH 5E00B 1HZHH 4KKLD 1FE8L 1C5BH 4NWUL 1TPXC 1XF1A 3HFML 4YR6B 1E4JA 2KZWA 5FK9A 1S78D 3A6OA 2H2PC 4KHTH 1I3RB 1A6UH 2XFXB 4DKFL 3EZJB 4Z95L 2AJUH 1J8HE 1JMZA 1SJXA 3CFJB 1Y0LB 5CJXA 3OPZL 1FSKB 1T2JA 1FRGH 1S5HB 3BIKA 4YDJA 2YBRA 3FJTA 1RPQA 3FAWA 4OFDA 2Q8BL 4K7PY 1IGJB 3SDCA 4AM0B 1T04B 1EPFA 2WK2A 3V79C 4MA1B 3VXME 5FDWB 1J0JA 1OM3H 3I6GA 3E6FB 4XPTL 4YWGH 3G6JE 5D1ZB 2EXWC 4L4JA 3CD4A 3QUXA 5F7EL 5BOPA 4HUUB 1IGIH 4LLMB 1FG9C 2W9EL 5EWIL 2XN9D 1CXKA 2IFFL 4D9RE 3E2HB 4QHUA 3HI6L 5ELIA 5GS1C 2HT4C 3QA3B 2YD6A 4PGCA 4MAUL 5EBGA 3S4SA 2EH7L 2NY1D 4HPOL 3AM8C 2JB6B 3C2AL 1MWAA 1RZKH 3M17B 4IBLT 3MRKB 3PXJA 2ZNXA 4K23H 5GIRA 5ALCL 3FOLA 3OR7A 1CG9A 1CK0H 1H5BC 1INQB 1Z5LB 4JREB 4P3CL 4A2LA 1KCVH 2A9MH 4XBGA 3U9UB 4LSDA 4U49A 5EUKA 4LRIA 4ZODA 5MP6L 4P5MA 3ZT7A 3EJYC 4XWGL 4ZO7A 5I8OL 3MBEA 4AT6B 1AFVH 5D93C 3CFBB 3Q48A 1U8LA 1A6TA 1QLEH 2PTTA 2HJLB 1MRFH 3LN4B 3G5ZB 3QDJE 4XGZA 3ZL4H 4JR9L 5I30H 4PB0H 4EDXB 4KRPC 4N0RA 4AENA 2EDWA 4Q9BA 1T5XA 4NZTH 4ZS7L 3ROOB 1YMHA 4XP4H 1BZ7A 2CXKA 3QQ4A 5GGSA 5ICZA 4LGPB 5C0EB 1UWGL 3BZ4A 4M02A 3KPRD 3QXUA 2HJFB 3VWKC 4NM4H 3QCVL 5L2KA 1Z3GL 2BX5A 3RA7H 4ODXA 2X41A 5DD1L 4HQQL 5J1SC 3UBXI 1I9IH 1RIUH 3V9FA 1A22B 2C4XA 3QUYC 4HIEA 4PY8J 1TJHL 3O2VL 4PBXA 2RR3A 4JFDA 1WBZA 3QIUD 3PWVB 1JF1A 1EO7A 2MHAA 5CGTA 3WS6A 5DQ9B 4QLRA 4A2MA 5DFVD 4H8WC 1BQHG 2YA2A 1GCFA 2DYPA 1BLNA 1G9NL 4GW4B 1CE1L 2XKSA 5H94B 4F58H 4RGOH 1KUMA 5BV7C 4G8GE 3RZCC 4DUWA 2FL5A 4KPHH 3VFSA 2FX8H 5DA0B 1CDCA 1LK2A 1DSFL 3GSOA 3CFIC 1ADQA 3GSQB 3TFKD 2Z4QB 4WUUA 1BM3L 3MYJB 2WWKO 2RFXB 4ZPTB 5E9DE 6FABH 3DX7B 4G43A 4UQ2B 4XHQA 5KAQF 4RZCB 1BFVH 2BJML 1F00I 1YEJL 1WZMA 4V2CB 3CDYA 5DHVH 1AR2A 1NC2D 1U8MB 1OTUD 3IKCA 4LIQH 2DQUL 5ID1A 4J3OC 2X4SB 3ZE1E 2IF7A 2ATKB 3ZLQC 3CZFA 4KDVA 35C8H 4J12A 2R0LL 4PTUB 3BEWA 1UXSA 4WFHD 3ARVA 3PABB 4M6AA 4MWFB 2PYEB 4QRPD 1HH6A 1FO0B 5D7SL 4PREB 4CMHC 3T08A 4LPVA 5TH2A 5A3ID 5C7XH 1UT9A 2AABH 4B5EA 3FB6B 4RFEA 2JCCF 4YEEA 3U7WL 1AXIB 1PY4A 4U6HA 3QDJB 3OKKB 4UMGA 3RVXD 1UZ8A 3D85A 2BMKA 4P49A 4FFWD 2JELL 2NY7H 4JY4A 3X12B 1PZ5B 4OM1L 4RGNC 1OP9A 2FHBA 4NQUA 4L3CA 5A1AA 5AAMA 4LHUD 4XH2B 1TQCC 2VISB 5CMAA 5ITBH 5KZCD 2RIKA 3CC5A 5F7FA 2GFBB 4DZBB 2VWEC 2Y7QA 4LGRB 4Y19B 2AK1H 5IBTH 4HHAA 1TQBC 4JDTH 4EDWL 5HHNB 2P8PB 1BIHA 4D2NA 4EVNB 2Q7YB 5DK0A 5K9KB 5HGDB 5I16B 4LSSL 2ADIB 1VACA 1N64L 2FZ3A 5C0IB 1EA9C 3T0EA 1MFAH 3SDDC 4XX1E 1EO8H 1IGCH 3KWWA 4U1KA 2WINB 3MNZA 1SJVA 4PRHE 4AG4H 4XI5C 4FA8A 1PQZA 2HTLD 2DD8L 4L8SA 1UA6H 5IT2H 2X1WL 1UM4L 1FG2A 5IVXF 1Y18A 2QADD 3VXOB 3ECBA 2PCPA 1LEIA 3EOAB 4DFHA 1INEH 4IRSB 3WIIH 2YMXH 3BPNB 1JGDB 4G6ML 3ULVD 1QLRB 1GGTA 1QSEB 2WANA 1D5ZA 1MI5B 3VA2C 3LN5B 3MFFB 3B83A 2E6PA 1RJYB 1NFIA 4Y4HA 3U0WL 5I1EL 1JYVA 4FQ1L 3NPSC 4NO0A 4HEME 1HINH 1TPXB 4FQXA 3QEGH 3UTSE 2BDNL 3X3GH 4I4WB 3VFNA 1G6RA 1NCAL 3O3BA 3LKSB 5F7DA 4GKOA 4QRUA 4XP5H 4D9QD 2QSQA 1BFSA 5C09A 1SVZA 2QQKH 4B7IA 3BQUD 4R4FH 1QEWB 3D25A 3L95A 2YD5A 3VXUA 1PG7X 2VOTA 5IM7A 1OAYL 1S7WB 4Z0BL 4PS4H 1A6AB 5I1HL 1KB5H 1T21A 4OCYH 3QJFA 5IFJA 4K3HA 4JFEA 1RHFA 1X4YA 3GMMA 1TJGH 1YYML 1MCSA 3K2UL 3OX8A 3HNTL 3H9HA 1HKFA 4LSQL 4BH7A 4XZUA 1GC1L 3P30H 3U0PB 5BJTB 5FYLH 4M03A 4GW5B 4HF5H 3T04D 4QOKE 1NCBH 3IJSB 3A6BL 5GS1B 3ULUH 3MV9D 3PDGA 3SKOB 3B9KD 4JHAH 1KBGL 4LU5H 3TO2B 3IRZA 4HZLA 1N7ML 5F72S 5BS0A 4WUKH 1GRWA 5M94B 5CIPA 1ZT7B 4A6YL 4OD2A 4HXAL 3UBXA 2R1WB 1H5BB 2AV7A 3CVHB 3K46A 3L6FB 3WNKA 4NQEA 4X4XB 2OTUB 4F7TB 1NBZB 5HYJB 1MCOH 1LO4L 1KGCE 3D1MC 1TVBB 1OSZB 2WBJC 3PQYA 2IQ9L 3QNXB 3H7BB 4OGZA 5IHUH 5D93B 1NAML 4XT1C 3BN9C 2IADA 3B9VA 4GMTH 1ZLWK 1G9EA 2R4RH 1DUZA 4PRAB 1BWWA 1UWXK 3GUTB 2UVFA 4KH2A 4PRHB 1IAII 4OFVA 2QSTA 1GGBH 5DZNA 1ZXQA 5I8CB 3JTSA 4G7YL 5E56A 3L3OB 4KRPB 4M43H 1U8PB 4IRJC 3SQOH 3TVMA 5TQ0L 4Q9QL 1KSRA 2EDHA 5GGTA 2ARWA 3ARFB 5HVGB 2DQGL 5BZWB 1VSCA 2HLFD 2X44D 4M6OH 2GJZB 3T4YB 5E2JA 3VWKB 4NO5A 3Q3GA 3G5VB 3CGTA 4HT1H 1F42A 1OAUH 3TIEB 2YD8A 2VO5A 3SO5A 4WW2A 5HDLA 3EYFA 1J0KA 3I85A 2YK1L 5J7CC 3QUYB 1DBML 3UTSB 4LLUB 3RUGF 4XP6H 3GBNL 1Q9OB 4NDMA 2ZUVA 3FQRA 3BW9B 2VDQL 3DUUB 4KI1A 3OJDA 1T66D 3NFNB 5E94A 4GRLD 4ZPVB 3MROB 4N0FB 5TDPA 3VWJC 2YPVL 1F4XL 1PBYA 3MLWL 3V5DA 5BV7B 1CD1A 3QYCA 3ZYOA 2H6PA 2VQ1A 4KTYA 3DUSB 1ZLVH 3C08H 4XWOD 5KVFL 4LL9A 2VDNL 2VC2L 1DE4B 4L4TE 3SY0A 3NBNA 4BQCA 5CJ8A 3IU3B 4JQIL 4PGBA 2CMRL 4YPGB 5E8OA 4WENB 3V0VA 4QOKB 4LLVA 4MVBD 5KG9B 4YO0B 2W60A 3CLFL 4PP1D 1OAXL 5F9AC 3QHFH 3IDIB 4WNQA 4XHJD 3JVGC 4BUHA 2CLVB 3OJ2C 5D1QB 3D2UD 4F7EB 2GI7A 2DLFH 1MIEH 2V2XA 3MJ8B 1SMAA 4OF5A 4XBPA 4HG4K 3OJVC 1FPTL 2ED7A 2J8UE 4I0KA 1X7QB 3ME0A 4CMHB 4PRBA 3VFUB 1S8DA 3ZSTA 4H25B 5EU4B 4WI8A 1MVUA 3TJHD 3JV6A 2LU7A 2SEBB 2CXGA 4ZFZA 5F88A 5B38B 1BF8A 3PL6D 4K8RC 4FFZH 4UDUA 2BRRL 2CO7B 4LCWD 1DLFH 4HX1B 3E3QC 2WP3T 1YYLL 4FTVA 2R2EA 2IANA 5JQHC 4BFEA 2AV1B 4Z7NE 3O3EB 4HUKB 4RGNB 5DURB 4ZYKA 4M61B 3TZVD 1TQCB 4OGYH 3UJJL 1GHFH 1KCRH 2H2SD 1C5DB 3WIFA 4JFOA 4KTDL 4G6AC 5DZOA 5KW9L 5HI5C 3NCJL 1CFTA 3IJHB 1TQBB 2E8YA 1AQDA 1OB1A 2ZCLL 4I0PD 2EICA 4BZ2L 2OMBA 1KJ2A 3EJZC 5LWYH 3MR9A 4RGMC 4ZQKA 5EPMB 3GMOA 4XMKL 4NQCE 4U31A 4X7TB 2HVJB 2JJWA 5FKAA 1FYTD 3O6LL 4HW6A 5JMOC 3UPRB 3AMKA 3SDDB 1G7HB 5FYJL 3B2VH 2H32B 2UWEF 3B43A 5F6IC 4J3SA 1CLZH 4RMSA 2DI9A 2MJWA 1N3NA 1HHHA 1CU4H 3JWOH 4U7MA 3QIWA 4YDVB 2UUDK 4KV5F 4M6ML 4NC2B 4L4TB 1FFOB 1KEML 4EIGB 3K8KA 2WLZA 4PJ7B 1MWAL 3HG1A 1T1ZA 1NGQH 1QSFE 4Q97A 4CUCA 2PETA 2I60L 2Z92A 4RFOL 3K2MC 3TNMA 1CGVA 5DJXB 1U95B 3NPSB 3QXAA 5C0GA 4OIIH 4N5ED 2J6EH 5L88H 2XPGA 3RTQA 3DROB 1JNNH 2AJYL 4P46A 4UIKH 4RSVA 2R0WH 3IU4H 1DBJL 5DMIH 1KFAL 4XNMA 2NY5H 3LKPB 1UCBL 5DD0L 5DHYB 1B0RB 2J8UB 1H3UA 5I19H 2IAMA 2YKLH 4FABH 1XMWA 1EEZA 4NBZB 1NFDA 2DLTA 4NHCH 2MFNA 3HKFA 4MNGA 3BE1L 2VLLB 4ZDHB 1CXLA 4Z7WE 4N0YH 5IG7A 5K9OA 3NA9H 5DHVA 3IDJA 4RAHA 4U33A 4ZOAA 3OL2A 1VFMA 3S88L 2WBWB 4NQVB 2P5EE 3T65A 2I5YL 1S7QB 3MV7A 4KI5F 3PWPD 4U3HA 1HQRA 3MRNA 1VENA 5DRWB 4P2RB 4XPHH 4V1DB 4MA7H 3Q6FA 3HAEH 4G6JL 3AS3A 1L6ZA 1R3HB 2CK0L 5DJDA 5F3BA 4Z78A 3MXVL 3LRSA 4JFXB 5SV4A 4NWTL 3ROLA 2PTUA 1NCDH 3VXQA 3B6SB 3P3YA 3VCLB 3MOQA 4Z77A 2W1NA 1J05A 1DQML 4S11A 3OMZA 1VA9A 3X11A 1ZHKA 4Y2OA 4KJYA 2WBJB 1WBYA 4EZMA 1EERB 4NQCB 1TIUA 5BVPL 4FQCH 3W39A 4P2QB 3EYUH 5GRYA 1F13A 3TYFB 3HCVA 1ADQL 4JZNB 3UTPE 3FT4A 2QQNH 3MSPA 5DQDL 3PV6B 5E1HB 1I1YB 3D0LA 3LEXB 2OL3B 1I7TA 4IRJB 3MRJA 1X9QA 1UKSA 1OD7A 1Q38A 4XPGL 3VXPA 4PBVC 4X6FA 1YEDB 1QSZA 3HUJB 1A9EA 2Q8AH 3ARGD 4KMLB 3P9MA 3PUCA 4MQTB 1QSFB 1JHKL 3MRBA 2VR5A 4UV4L 4ONGL 5TQ2L 1AY1H 2DF3A 4ODSH 1HXMA 2HFFA 3BDYL 4JFFD 2CJUL 2YXFA 3MJ7A 4F33B 2WUCL 3SDAC 1X6LA 4UUJB 3Q5OA 2OJZL 2CQVA 3DOSA 3HNVL 1EVUA 1BPVA 3OKNB 1NL0L 2IMMA 2BERA 2EEBA 2AQ2A 1U3ZA 5DD5H 3NH7H 3VWJB 1A3RH 1MHEB 1P6AB 3IVKA 4N1HB 4J4PD 3NVQA 3MRGB 4LMQI 2D03L 1KNOA 2W9DL 1KELH 3HI5L 1XFPA 4ZAKA 2AI0H 5HD8D 4EI6B 5ESQA 4MCYB 3RVUC 2P5EB 1B2WL 2DBLL 3SDXF 4KKLC 1T4KB 5CJOL 1DBKL 1TNMA 4OBSA 3BJLA 4WDIB 1C8PA 5GGVH 1S78C 3RGVD 1CCZA 1FVCB 2JIXD 3ULSB 3OAUH 3TBWA 2WNGA 3ESUF 5F9WC 2DTMH 1SBBA 3WIHL 2ZUTA 5EUOE 1EEUA 2DMBA 3G5YB 3O45A 3F12A 1D5BA 1U91B 3WEXA 5DF0A 3ARSA 3WFCL 1WAAE 5C0BE 1XR8A 4BFIB 2A1WL 4OLUH 1RK0A 1RUMH 5FYJU 3VGEA 3VW3H 1OSPL 2ZUQC 4WY7H 1A14H 4U6YB 5GRJL 3V4VH 4JPVL 4PRIA 3LQAL 1IQDA 4UDTA 2IBBA 1Z9MA 1MNUL 5SWZD 2NY1C 1I1AD 5DMJB 1W8NA 4OLZH 3RWDB 1FNGB 1RZ8B 1DLHA 3WLWD 4GG6B 1PEWA 3LPWA 5B3JE 1P4IH 2DDQL 1T7XA 4Y5XC 5F3HB 4L4VA 1KN4L 4POZD 4PRDB 4HIXH 1FNSL 2VXUH 6CGTA 1ZA3A 1JGLH 2AJSL 1JK8B 2XRAL 3H3PL 4U3XA 1S3KL 3U7YH 3QQ9D 4W6YB 4OLVL 3MODL 4PJ8D 3GI8L 5TE6H 4RGMB 3OGCB 4LPXA 4XVSH 4D0BB 1HN1A 4IHOA 3QFDA 5IEHA 1JHTB 1YN6A 3RWCA 5J57B 1L0QA 4HKZA 1B0GB 5D6DA 5T3ZE 2XTJD 1ACYL 4MHHI 5LBSH 4XMPL 2A73A 3RWJA 5SWSE 3NCCB 5F6IB 5IB4A 4NM8H 3IDNA 3MRRB 3GSNA 1RULL 4JDZA 5B4MD 3BZDA 1LP9E 3WNNA 4X6DE 4JFPA 3ZKMD 4P5KB 4G9FA 4WEBH 3QDHA 1AXTL 2VLJA 4LSUH 4HUWA 4JO3H 4MNQA 5EN2B 1HIMH 4X6BA 5EC2B 1DBBL 4Y4KD 1KULA 4K94C 5ICYA 2NPLX 1L4IA 4G8IA 1RMFH 1UQSB 3TPUA 1G6VK 3VXRA 3GRWH 3DIFB 4DVRL 3QIUC 2OJEA 2R2CA 1MCBA 3I6LE 2FEDD 1HSBA 4FN0A 5JW4Q 5IF0B 5DFVC 1LEKB 4BM7A 3KS0H 2CLZA 5I8EB 1DJSA 4HUVA 5DC0A 4M93B 3TPKA 4JZOB 1WWCA 3DURB 1KN2L 4OCSH 1VGKB 4YAQB 5C0BB 4ELKB 3O6KL 4JO4L 4MD5A 4MJ5A 2AKRB 3ZKND 1E6OH 2CKBH 3WNMA 1K5NB 3TFKC 3BVNA 3NN8B 2Y36H 3SGDH 2NYYD 4CMMA 3EFDH 3PXHA 2DQFA 2ESVA 1LO0L 4NQXB 3OG4B 4DGVL 5FGBA 2BVPB 3RHWK 3U1SL 4YHNA 3VD7A 3GDBA 5F44A 1FFPB 1UXWA 4K3GA 2D7QA 4UT6H 5A16B 4YIQA 3DX7A 5EU6D 5CKGA 4YGVB 3QUZD 4F2MB 3HR5B 3AGVA 2H3NA 3M1BA 5EBWB 2EDEA 4JRYA 3Q6GH 1FZKA 2FHFA 3IETB 1RZ7H 4LCUA 3SO3C 4R0LA 1C1EL 4N9OB 5A3IC 5F9DC 3PDDA 4I9WE 4Z7VE 1YNTB 3T77B 4TSAL 3KXFE 2FSEB 2VKXA 2Q20A 4YHML 2C1PA 4QXGL 3QT2A 5DK2B 2VXTL 1NAKH 3BH8A 1D9KD 3RVXC 1FGNL 3O2DL 4FFWC 3KPSA 2XN9E 4CVZB 3JXAA 2G2RB 5C07A 2VUOA 3O81A 4KI5D 1WCBA 2KDGA 5IHZB 4CADB 5CZVL 4WTZA 4X6DB 3SGKC 3HNSH 3EDKA 1ZVSA 1MFBH 3MUZ1 4NP4L 4OZ4A 1DDHB 4PP2B 2O61B 4QKXB 2Y72A 3LRHA 5D7JD 2AJZB 3DBXB 3H42L 4LCYA 3VI4E 1EHLL 1UB5A 3B9AA 2XA8H 4RAVA 1JGVL 1TITA 2R1XB 3ARPA 4OFKA 4GW1A 5DJ0B 2A6KA 4UU9B 1QBLL 3NABH 4JFZH 4AIZA 1DR9A 3SDAB 5BO1L 3SCMD 3B8YA 1T2QH 4Y16D 2HKHL 1TLKA 8FABA 2HTLC 3O2WL 1UEYA 3PWUA 4MD0A 1BEYL 1I8IB 2IH3A 3MLSL 1A7RH 1U58A 1FJ1B 1K2DA 2R2HB 3F7YA 4LF3A 3BESR 1P6FA 1BX2A 4G80A 4OT1H 5MEPA 1XCQA 4G3YH 3NPZB 5F71A 1AKJA 5I2IA 3BISA 4ZFFB 3UDWC 3RY4A 3ULVC 3MRPA 1E4WL 3CFKA 2QBWA 1VFOA 1YJDC 2MKLC 4ZXBD 3VFMB 4PR5A 3UTZB 2J6EA 1S7RA 3G6AA 5E6YA 4Y5VA 1YN7A 3HZKB 1BBJB 3MXWH 4IRSA 4DTGL 4J1UA 4BA8A 1JGDA 1IT9L 5F9WB 3P73A 5GGSY 2LVEA 3EO9L 4JRXD 1KTRL 3KPMB 1KJ2L 3BQUC 1J9CT 3T8XA 3WHXB 2Q7NA 2DQCL 3NMEA 3CDFA 4HC1L 4JLRA 1U92B 4M4RA 1VDGA 4LP5A 2BVEA 1KIRB 1V5JA 3G9AB 2OLDA 1F6LL 2ZUQB 3IFPB 1DQLL 4DGYL 3UTQB 1S7WA 3SN6N 3ZKSD 3LS5H 1VADB 4I5BA 3DHMA 1IGFL 1A6AA 1G7PB 1A1NB 1L7IL 2XN9B 3RPIB 5B8CB 3FO1B 4LCCC 4BZ1H 3F5WA 3B9KC 5C0FA 2W0KA 2PXYD 1ZLWH 2NY1B 5FECB 3HAEA 4ORZC 2NY6B 1SEQH 4IIQC 2G5BB 1UWXH 7CGTA 5C08D 3QUKA 2C1OA 3OKMB 3MJGX 4WI7A 4TNWF 5GS1A 1W0VB 4QRPE 4KKAD 2J5LC 4LLQA 4Y5XB 5D7LA 5DD3H 1B3JA 1N8ZA 1I1RA 1NMAH 2CIIB 1CGSL 1G9ML 1I7RB 2AJXL 3RNKB 3WJJC 2UZIL 3HS0A 5D1XA 3L6FA 3SGDI 1RIVH 5CJQL 1T7YA 1U0QA 1I7UB 3WLBA 3QEQA 2R0ZH 3N1FC 2HKFH 3MRQA 5H35B 4E5XB 3BWAA 3R1GL 4PJHE 3R06A 3RJQB 1IAIL 4RMWA 5INDA 3EFFB 1TMCB 2F9BT 3MQIA 2OI9C 4YX2H 2HLFC 2ITCA 2Y5TB 3LZFL 3SE9H 4CVXB 3N1MC 3KPRB 4NZUL 4TNVF 4R4BB 4OZGE 5C0AA 5JIPA 4K9EL 4OGXL 2R8SL 5BZWA 1Q9WA 2QKIB 2Q86B 3BKYL 1NBYB 1YEKL 1MLBB 2C4FT 5FYKE 3D5OF 1CDJA 3LPFA 5ESAA 4BQBA 3QIUB 4F80A 1OGAA 5IMOB 2B1HH 4N8PA 4NYLB 3TESA 5EU5B 1CFNB 1XCTA 4GRLC 4JHBA 1ED3B 3U2SB 3QUXD 4R9HA 4I18C 5D71H 1RJCA 4POUB 1V8HA 3V6BR 3DARA 3VFVB 1XH3A 4H1LG 1CBVL 1WJ3A 2X7LB 4XWOC 1K8DB 1V3LA 1IILE 1UZ6F 3RZCA 5KANI 3I2CH 4BKLB 4XCYB 4HK3N 4XAWL 1E6JL 1ZHNA 3W5MA 1KCSL 1NC2B 4F15B 4QXUL 1ZTXH 1UEMA 5IHLB 4PP1C 3O3DB 4OF6A 1A9BA 4WW2F 4XHJC 3IDXL 3NIFF 1X4ZA 2VLMD 4OV5B 4XX1G 5HGHB 2Z9TA 4J8RB 4FXLA 2HJKA 1LQSR 4XPFL 1QNZL 3MBED 4QRPB 1BQHA 1ZHBB 1F45A 1U8QB 4UT9H 5E2WL 2EC8A 4UINH 3DX8A 1IKFL 2R56H 3TJHC 1WBXB 1CL7L 4X9HA 3MREA 4NKMA 5CJ5A 5KSVA 1JP5A 3NAAL 5DJ2A 3MLXH 1SM3L 1FFNB 3PL6C 4P9HL 1IE5A 1CLYH 4FQHA 4KK8D 1V3MA 4PJHB 2YMXL 5EU4A 3FB5B 4TVPH 1GOHA 1ZT4A 2OR7A 4HS3A 3N06B 4KGJA 5L2KD 1S7XB 2IG2L 5JOFB 5EC1B 3GIZH 1EHXA 2FATH 1UB6A 1XGQB 1S9YB 4LHUB 5JPMA 1T6VN 3TZVC 4HWZA 4DOHE 4ETQA 4FQPA 5KZCB 4JFDD 3QO0A 1UM5L 5FIEA 1OF2A 2H2SC 3F7QA 1XR9A 3LSOB 2GCYB 4JB9L 4YBLC 3UPCA 4NNXB 4N1EA 2UUDH 4I0PC 4HXBL 2DYPD 2VSCA 2EO9A 5DDHA 1OTTD 4PJIA 3I3BA 1QSVA 1UCTA 5EOCL 5BZDA 3QQNA 5JW3L 1RAMA 2XI9A 4GXVL 4K3DL 1EAPB 5D5MA 1NCUA 4XPAH 5IFAL 2DWEA 4WUUD 5CHNA 1BQLH 4HMCA 4P48A 2Z91A 1TJIL 3G08A 5AWNH 2HFEA 3Q1SL 3V8CA 3C8KA 1NFKA 2D4FA 3SDDA 2QADB 1TZHB 4O9HH 5JNYA 1TNNA 4OLYL 3LKOB 2DLGA 3GSVA 4KKBD 4HBCH 5IESL 3GRWA 3MUGB 1H3GA 3OSKA 2JJVA 3FRUB 4PRPD 4WFED 5IHBA 4UBDD 3UO1H 3OZ9L 3IJYB 1FFOA 4N5EC 4IDLA 2D0HA 5F7KC 4PJ7A 5C6TL 4XC3H 1IAOA 3U0TB 3R0MA 1FGVH 32C2A 4PJXA 4RMVA 4CN1A 3GKWH 3JWDL 3MBXL 2VN4A 3BQUB 2CKBA 5BRZE 4PJEA 2QJDA 2Q3AA 5E8DL 3D85D 5EU3A 1FNEB 3F58H 4XP9L 4QO1A 1CICB 3VRIA 1XGTA 4PLJD 1JZ8A 3GSNL 1RURH 3AUVA 3LHPL 5F7MC 2MCPL 2GSGB 1K8IA 1A6VH 4G6FB 2P49B 1UADC 1WC7B 4LCCB 5EIIA 1K4CB 1G7JB 3MV9B 3B9KB 3DO3A 4BQ8A 4XNXL 1FYHB 4AEEA 3LVEA 1W72B 4HCRL 4IIQB 4GO6B 4O2FB 2V9RA 4F7MA 3BDXA 3WDJA 4XXDB 2CIKA 4KKCD 3AS0A 1Y6KR 5D4QA 5IP4A 4ZUUA 4DK3A 2J5LB 3L5XL 2AEWA 3L7FA 5AYUL 4I3RH 4W70A 3T0ED 2BNRA 1WWAX 4Z5RB 1QBML 5ID0A 2W65A 3O6FB 2R69H 4FQLL 1NFDF 4BSWA 4LKCB 2IH1A 4BJLA 3KPPA 1I4FB 3QJHB 4MMXC 1T80A 1JUFB 4P2QA 1WGOA 4JAMB 3UJTL 2R29L 4OM0H 3IRPX 3SKNA 2OI9B 4FNLL 4Y4HD 3RZWA 4OD1H 5DUBB 2ZCHL 5DJAB 4YXKL 5DEFB 2FO4A 4ZSOE 5GHWH 2FDBP 4X7FC 3PV6A 1RK1B 4FQXD 2NY3D 2PNDA 3I9GH 3LEXA 4TULL 4J6RH 1R24A 3ARGC 3O4LA 1P9MA 4NUGH 3BPCA 3S96B 5DJYB 3WFZA 3MRLB 3P4MB 5C09D 4YQXH 3QPQD 4ZUTB 3HUJA 2XZAH 4S0SD 1MFEH 4LFHG 2V7HB 2BXYA 2AW2A 3VXUD 4N9GA 4LKXB 2JCCE 4PJFE 5BVJA 2JJUA 1P7KB 4JFED 5IWLC 1YNKH 5JR1H 1FO0L 2J8OA 1U8HA 1SJHB 1XF3B 3EGSB 4J4PC 1Q94B 4FZ8L 4FFVD 4R7NA 2X4NB 5IEKA 4CNIB 5DK3A 1KB9J 4CGTA 2NXYD 3FOMB 4RFNC 3RY6A 2FWOB 5HD8C 1F8TH 1A6WL 3BKJL 4GH7B 5DD6A 2D2OA 1NBVL 3DGGB 1F11B 2P8MB 2FEEI 3KJ4C 5BS0D 1FIEA 4F3FB 3IFNL 1PW3A 5E7BA 3RGVC 2VJXA 4NQED 2VL5A 1RZIB 4U6VL 5T3XE 3V4UL 4IRZH 2EDQA 3D2UB 1NQBA 1KLFA 4U1JA 3PQYD 5DT1L 4X5LA 3P4OA 5GS0L 4D0DA 4I3SH 2DQJL 4TUJB 4PJ9A 2F8OA 2V17L 3PP3K 4ZUVB 4NZDA 1Z6JT 5AAWA 3WUWA 3OKEA 4TOYH 1U91A 4RMQA 2XQYK 1Z2KA 2XNAB 3TVMD 1I1FA 2YWZA 2XY1A 1IC1A 4LSVL 1LE5B 3PL6B 3HZMB 4LCWB 4PJCE 5C0ND 2JE8A 3QFJD 2B5IB 5AD0B 3O41A 1P69B 1YY9D 1ZSDB 5KN5A 3WLWC 2G75B 2XZZA 1HWGB 3GSRB 3TZVB 3QDMA 5HHOA 4LVHB 3WXVL 4JHZA 3FQNA 2IBZX 1CR9L 5CEZH 4POZC 4KFZC 1UWEH 4OLEA 5DMIL 5B39A 5E6ZA 1W2KT 1JNHA 2KUTA 4I0PB 3QQ9C 4OCRL 1BD2D 4PJ8C 5ESVB 2XZCH 4PTTB 3PDOA 4KWUA 1A5FL 3GMLA 4L8BB 2JCCB 3NA9L 4HWBL 1QFWM 3QZWA 4GRWH 1N6QH 1D5IL 1MCCA 3VMPA 1MCHA 1H0DA 4TQEL 4N8CH 3TT1H 1S7UA 3R0NA 3ULUF 1AO7A 4OB5L 5B4MC 3QG6B 3ZKMC 4WCYH 5CSZA 4JKKA 5LAXA 3B2UD 4WTXA 4GS7B 1UM6L 4Y4KC 4OKVA 1AE6L 3D3VE 2JB5L 4XNQA 5D9SB 1RUPH 1MJ8H 3PWNB 2XACC 5E2UH 1HHJB 4H5SA 4EQ3A 4JQVC 3EW3B 4QNPE 1KCLA 2FEDC 3TBVA 3BRGC 4H26B 5DJZA 3OKLA 3CVHL 1IQWH 2HLAA 1YQ2A 1P53A 5CP7A 5KVGH 1MRCL 3S3JA 4HJ0C 4NKOA 5JIHA 1FH5H 4NRZA 2X05A 3ZKNC 3L3GA 1CZ8H 4ZOCA 4LNRA 1LNUB 2B4CH 4O00A 3L3HB 4U1MA 3HC0B 3ARUA 4WRLA 1L9NA 2NYYC 3V6ZB 5IVXB 4FTVD 5D72L 3STZA 2IAND 5AYQA 4MGXA 4KKNA 5GSRA 5I1DB 2AKRA 1BF2A 1YC8A 4GKZB 3PJSB 4MQ7A 4AK1A 3PIQB 1K5NA 3FN9A 4QT5A 5GISH 4Z7QE 1KIQB 2PW2A 3H9ZA 3A67H 1JN6A 4QHLA 4MSWA 1LO2H 2C4FU 3H9SE 1AD9A 3V7AE 3QUZC 2DWDA 4XCCL 1F90H 4KROD 1HH9B 1YPZA 4OCXL 2X1PA 4AMKL 2BHYA 1CT8B 5IB2B 2Y23A 3T2PA 4U2YA 4OFPA 3LKRA 1T20B 1TVHB 5DGQA 4DGIH 3NCEB 3BP5A 3H0TA 4ZMAT 4QGTA 2P24A 2VIRA 2GJJA 2H1PL 4ODVH 5C6PB 1HHGA 2APVA 4U6XB 1IEHA 3HPLA 4U1LB 3UZQA 5JO5B 1JPFA 3LQZB 5E99L 1D9KC 4XBEL 4NO2B 3FT3B 4QF1B 1S7SB 2VDKL 4H8WL 3MUY1 3QIWD 2GITB 3GBML 4NGHL 5I1AB 3BZFA 3VGGA 4KI5C 2GY5A 4C57C 2AXHA 5BV7L 1CQKA 4UTAH 3QUMH 5FGSA 2H8PA 4GG8B 3HG1D 4R96A 3LEVL 2EYRB 1JVKA 3B5GA 2FB4L 2C26A 1MJUL 4KY1L 3ZDZE 2FH6A 5ETUA 3W9DB 1SY6L 5DS8B 1BQUA 3EOTL 5D7JC 3ARGB 4S2SB 2EKJA 4PV9B 2EXYD 3RTQD 4B50A 4P46D 3NFPA 4XTRD 2FJHB 4UV7L 3V2AR 3SBWA 1HWHB 2MPAH 4JFFB 1KIUA 4JO2L 1MFCL 2IAMD 4EXPX 3UZEA 3HE6A 5CBAA 3SCMC 4JO1L 1DZBA 3VU2A 1CLOL 2ORBH 4Y16C 1D5XB 5D6CA 4IEFB 3CZJA 1H9VA 1HEZA 2XTJE 1N5AA 2FX9H 2XA3A 4UU9A 2GTZB 1JF5A 2E7BA 4TPRL 3SDAA 3IXAA 5HPMA 1LO5B 1BZ9A 1P84K 2VZTA 4H0HB 1F4WL 2XWBA 5ICXA 2A6JA 5KVDL 1YQVL 1XZ0B 2BVQB 3MV7D 3INUH 5HGBA 4OCWL 4D3CL 4RFNB 5C8JB 3QPXL 4U1IA 3TCXA 4NSKB 1ND0B 4ZXBC 3MX0A 4GSDH 1MREL 2YN3A 2J2ZA 1CDIA 3SPVA 4YUEL 5LGHL 1NLBH 1LILA 2XZQL 1ZGLB 2IALB 3KYKH 4MD4B 3RUGB 2JIXB 1AGDA 3N50A 4JN1H 2ZNWA 2CRYA 2EE9A 1U8JA 4NN6C 3H2WA 1G0DA 5IFHH 3VFWB 5LCVL 3I02A 2Y1VA 4U0RC 5CWSB 3VG9B 3P0YL 3W0WD 2B0SL 3WFBL 1CF8L 2W92A 5IBUG 4FP8H 4NC0B 1DQJA 3DV4A 4HJJL 1NCCL 2LU4A 2AK4E 4NPYB 5E1AB 4ZUWA 4MYWB 5AZEL 2X1QA 2EEDA 1EMTH 3MRFB 4KJPD 4TSBH 5EZOH 3TBYA 1BGXL 1F6AA 1U92A 4H1LH 4PUBL 4M9PA 1D5MA 1OPGH 3M8OL 2HFGH 1T5WA 2FJGB 5EA0H 4PGDA 1JV5B 5JDJA 2VMFA 2FCBA 3SKJL 2PXYC 2Y07L 3IFPA 5SWZB 1I1AB 5MEQB 3CVIL 3SDYH 5BMFH 1X5GA 2VXSH 3AROA 4FFYL 5DJ8A 5DR5H 5HBBA 5DVKA 1F3RB 1T89A 25C8L 2L7UA 5FKPA 4Z7OF 1S9KC 4LEOB 2ENSA 2FYYB 2DAVA 1CDGA 1KCUL 4KKAC 3HRPA 4S1RL 3VFOB 1NKOA 4I2XE 4ODWA 2DKMA 4Q2ZB 2P45B 2ERJB 1O7SA 1F3DH 5KSAA 4ONFH 5ANMB 4PD4K 4PJ8B 5HHVH 3HI1A 43CAA 4ZOEA 1JNLH 3WJLA 1PYWB 4OJFH 4HH9B 4KZDH 1E4KA 4QXTA 4X4MA 1KTKE 2RCSL 3TNNA 4KUZH 5IB3A 1OARH 2AJ3B 3DVNB 3G5XA 2XTJB 1SEBB 4NJ9H 3ARWA 4ZAKD 4LRNL 3MOAH 2OBGA 4N8VB 1WLHA 4KI5E 3FKUS 4G8FA 5JORB 1RJLA 5DVNA 1M7IA 4KQ4H 3U9PH 3FB8B 3ARRA 2DIAA 2O5ZL 4M1CD 3G04B 3KYMB 5ITFB 4Y4KB 1I8KA 5F89B 1M7DB 3WFDL 3SE8L 1TTGA 3C9NB 1YEFH 5CJXC 4LAQH 5J13B 2DQIH 5EZIH 2K7PA 4FHBD 5BQ7A 4W4OC 3WDIA 4Y1AA 3MRHB 3L3KB 3H9YA 3MLUH 3HC3L 5E08L 5GRZA 1KG0A 3KVQA 3VFRB 5FYLD 1K4DB 1RZFL 4P2YA 4XC1H 2UWEB 3DVGA 4YHPB 5HHPA 3ULUD 4PRID 2ZCKL 2W0FA 2E9BA 1HI6B 1L7TL 2JK5B 3C6SB 1GJIA 3CU7A 2X4RA 1RZJH 5DXWA 1M05A 2OTPA 3P4NB 1R5WB 5GRWA 3PHOA 1LWRA 4IS6A 1KT2A 4M7JL 4P9ML 5D2LA 5FO9A 3HPJA 4X4ZA 5DSCB 1JPGB 5C0RH 1ZVHA 5E4EC 3JUZA 4LP4A 3GMQB 4G8EB 1LVEA 3KGRA 1XGUA 1NCNA 5EU6B 4ERSL 2OL3L 3I75A 4JGMA 3AU1A 1FHGA 3KNBB 3QUZB 2B8OT 3DXAD 5I1JL 1AP2A 1J86A 4LRIC 4X5XB 4XCYA 5EO0B 3SE4A 1NC2A 3MBEC 1B4JL 4LARH 3RPKA 2YEZB 4HG4J 2BNUB 2H9GA 4CU7A 1W0YT 4NQDA 2YN5A 4MXQD 1OT1A 2OZ4L 4L8CA 5T33L 4CJ1A 2G9HA 3GSWB 1J7VR 4GXUM 2PYFB 5I1IL 2YC1A 2DQHL 1IGML 1ZS8A 5IMLB 3QXWA 1D9KB 4JKPH 4KK8C 4ZUSB 4O58H 1AI1L 1G7LA 4G9FD 2VZUA 2VLJD 3SDXE 2WUBL 2BSSA 3VFPB 5I1LB 4MNQD 2YPKA 5I1KH 3CH1A 1KXQE 5EU7C 5T1DL 3KYNB 5DJCB 1BOYA 1T1WB 4ZTPL 3VXRD 3EYVA 1S7XA 4A6YB 1WEJL 4M6NH 3MNVB 1T22B 3DHJA 3WS6C 2VH5L 4XPBH 3GGWA 2FIRT 5D7JB 5MENA 1TZIA 1TTUA 1FAIH 5GQBA 3SGKA 4JG1H 1D6EA 1IFHL 1MAMH 1OTTC 3LS4L 3ALXA 4KRMB 2BC4B 3RDTD 3U30C 1KC5L 4MA3A 1U9KA 1W8OA 3SCMB 2HTKD 1MUJB 4HIJA 2NZIA 1MCQA 4Y16B 3TO4B 1KLGA 5ILTH 2ESVD 4MDJA 5CGMA 2VLRE 3LMJH 3OXRA 4M5ZH 2A83B 3B5TA 1XF4A 1FFQA 1WWBX 5JTWA 4PLKD 2CK2A 3KG5A 2VTFA 3WD5H 5JPNB 4YDKH 3EO0A 3UC0H 5I15H 1QFPA 1FNAA 4KKBC 3V52L 1KTDA 2XWTB 3D9AL 3VXMA 3K80A 4YHLL 1QR4A 2OSLB 4X4YB 4K8RL 3IAQA 4OQTH 1A1MB 1OAZH 5ABDE 3G6JA 1U3HD 5F96H 4JRYD 4UBDC 4TTGA 1A7QH 1CDUA 4GKNA 2MCG1 1NDMA 3GSUA 3GHBH 1A02N 4XRCB 4IDJL 3LH2L 3P77A 3ZDYF 3PNWB 5KJRH 4M48L 4NN6B 4JRXB 1A2YA 5DRNB 2GK0B 5LGKA 5HXMA 2HKFL 4PJIF 3S5LG 5GJSH 1JL8A 2ZOKA 5FYJE 1R3LA 1V7NL 4LHUG 5C0CA 1FL3A 4U0RB 3REWA 2B2XL 5D5MF 3W9EA 4HSQA 1QBAA 4LLWA 4ORGA 3KPSD 5CEXA 3UTOA 3DUHA 2GUOA 5C07D 3QAZC 5LKNA 3VG0H 2F53A 3SE9L 3BQUA 4PLJC 2FLBT 4MXVF 1QVOA 2DN7A 1CFSA 4RCAA 4YDIL 2K1MA 1P5VA 4UT7H 2R39A 5TPWH 3SDXB 1RUAH 2ADGB 1DTUA 4Y88A 2R23A 1JFQL 2X4TB 4GAJH 4NRYB 1FDLH 3HZVA 1FZMA 4G7VL 5CLTA 3RY5A 1MH5B 1OAQH 1U2HA 3EOBA 5L7XH 3VGBA 1EGJL 3FMGH 3HHRB 4I48B 2D9CA 5C08B 2YS4A 3C8DA 3UXFA 4KKCC 2ITDA 5GRUH 1G7JA 4DEPC 3VFTB 4MZ2A 4NKIL 1CI5A 5GGVY 1JYWA 3CDGA 4PJXF 1W72A 1PKQA 3T0EC 5I66A 1AC6A 4ZOBA 3EDDA 1ZWIA 4KC3B 4YFLF 5I6XC 2MTPA 1OWRM 3WHE0 1XGPB 4L3EA 5J11C 5DI8A 3Q5YA 4PJEF 5J3HD 1XGRA 3U36B 1B90A 4L8SC 4LLYB 4X5WB 5TE4H 3SKMA 4OIAA 4EEEA 2VAJA 5EBMA 3H6JA 1AKJD 2X9WA 4KK5D 5C71A 1AQKH 5T1MB 1M71A 3WL9B 5IQ7L 4RAUB 1DP0A 5JLZA 4Y4HC 1WZ1L 3V5KA 4LASH 4O02H 4FQXC 2NY3C 4C55A 5FK9B 4JFDE 1AHWA 2W07A 1MHPL 1U36A 5SX4I 1E27A 4P3DA 3PWJA 4O4YL 5E9DA 3VI3F 4ODUA 4WW1A 4YDJB 1QFWH 1S7VA 3BIKB 5FHAL 1J8KA 1M1SA 2EDYA 4P4KC 2ZPKH 5IROA 3SEPA 3REVA 3IAPA 2E5EA 4Q6IA 3I6GB 3PP4L 4NUJA 4WUUE 5JOPE 2VZ3A 3KLDA 3QUXB 1MCKA 4TVPL 3HLAB 4P59H 1S9XA 4XVJH 4FFVC 4LKXA 4F37K 3L1OL 1KJ3L 3QHZH 2NXYC 4BYHA 4GRLA 5HYSA 4PGCB 4HWEH 3S4SB 1QTYT 3PP3H 3ZDXE 4HV8A 4I18A 2DBJA 2V5RA 1MWAB 3NGBB 5E4EB 2XG5A 5GIRB 4WEMB 3FOLB 1XGYH 2FEEL 3OR7B 5CCKL 5JHLH 2QTEA 1QKZH 4XBGB 4O5LH 5D7LD 1BFTA 1XIWA 3T09A 5EUKB 4P5MB 2Z31D 1MFDL 3BX7C 3MBEB 5D1XD 4KJQD 4UILH 2HVKA 4ODHL 1PG7W 5FUZL 4MB3A 1U8LB 1A6TB 1U93A 2DB8A 2PTTB 4KMQA 1QZ1A 2HRPL 3QEQD 4GXUN 4X8JB 4XGZB 4R6UA 1IGTA 4KHXL 1QQDA 3GK8L 2VDOL 4H1LA 43C9A 3WHE1 5DMGD 4GOSA 3TWCH 3KJ6L 1OAKH 1YMHB 1RHHA 1BZ7B 3QQ4B 5I75C 5GGSB 5ICZB 1N0LA 3BZ4B 1JGUL 5CEYA 4U1NA 1RJZA 3MA9H 3LDBB 1BZQK 5L2KB 5C0AD 3QXDA 1YY9C 2VZ1A 4ODXB 2HT3D 5L6YH 3PL6A 3ZYZA 4LCWA 4HIEB 4TTDC 4UOJA 4JFDB 3BGMA 3BXNA 1WBZB 4MJ4A 3GJFA 4GAYA 1JF1B 1OGAD 1BJMA 2B7DT 2BFVL 5I0ZA 1MPAL 4YHOH 3H7LA 4HK3J 3QR2A 2DYPB 5HGAA 2D0GA 5E2TH 3NACH 3I84A 3HB3D 2FL5B 4FOMA 3V4PL 3VFSB 4NFBA 3U30B 5L9DH 5GGRA 5T5FH 1A7PL 1LK2B 3GSOB 2WIMA 4Z8FH 4WUUB 3ZHKA 1NEUA 4YHIA 3LOWA 4G43B 4EXKA 4QGYA 1HILA 3O6ML 5EZLA 3RZCD 5TDNA 2VXQH 5DYOA 4HJGA 1FYTA 1OQOA 5CINH 1GGIL 1MCWW 3B2UC 3IKCB 5SX5K 5ID1B 2D9QB 5HJ3A 3CZFB 5C70A 3GNML 3VA6A 3BEWB 2XOTA 1F4HA 1SJEA 3MJ9H 4ONOA 4PRPB 4MQSB 5ALBH 4TRPL 1FQ9C 5C09E 1NEZB 3UYRH 1HH6B 5KAQG 3VH8G 3L7EA 3TH2T 2XQBH 3VXUE 5CD3A 4EJ1C 1EEYB 2AEIT 5TH2B 4XVTH 2ZJSL 2Q1EA 3OKOA 3F8UB 2B1AL 2ZG2A 4RFEB 4JDVA 3MTRA 4PFEA 4U6HB 2PR4H 4XP1H 4U1GC 5HDQH 1UZ8B 3WE6A 4XNUL 3D85B 4JPWH 2BMKB 4BFGA 1RZKC 1TCRB 4WFGE 2LFGA 3QAZB 2D4DA 1O0VA 1RUKH 3IGAA 2EIBA 2ICWJ 4JY4B 4CBPA 2O5YL 5FF6A 4Z76B 4L3CB 3MRMA 3RU8L 4DW2H 4NUGL 3T3MF 3CC5B 3UJIH 3K1KC 2Y7QB 5IIEA 2Z93A 2E27L 4E42A 4KROC 3UTTE 1QFWI 4HHAB 4JG0H 1YEIL 2E9IA 1V05A 4BQ6A 3KR3L 1KIQA 4JVUA 4WIQA 5I76A 3FN0L 3WS3A 4HFUH 3PWPA 1ZVYA 5DK0B 5T3ZH 2EIZA 4MXWH 4P99A 3TA3A 4K94L 2EH8L 3T0EB 3R8BB 1NSNL 4NN7C 5DQJA 4GAFB 1CT8A 3TH3T 3KWWB 5I6XB 1QBBA 1HHKA 3LKQA 3QCUL 3MNZB 4U1KB 5BXFA 1C12A 1T20A 1PQZB 4MQXD 5J11B 4XMLL 2LAGB 1EHAA 4RDQF 4L8SB 5F7YC 1X5YA 1FG2B 4JY6B 3QIWC 1QPXA 1Y18B 1QUNA 2X4OA 2PCPB 3ECBB 2Q76A 2A74A 2BOBB 5E24E 1LEIB 4DKEL 2AGJH 3OG6B 1ZLSH 4YH6A 1HXYA 2UYLA 1J18A 3VJ6A 3ZHDA 2V5YA 1D5ZB 4QF1A 4ISVB 4Y4HB 1NFIB 3WUZA 5CUSH 1YEGL 2EYTA 4NO0B 2Y06L 5I1AA 4FQXB 2NY3B 4H88H 3VXSA 3VFNB 5DUPL 7FABL 1G6RB 3ILPA 1YPZF 3RTQC 2EXYC 4N0CD 5LGJA 3O3BB 5F7DB 1Z0NA 4P46C 5I1CL 4YE4H 4QRUB 1RU9H 3NTCH 3ALPA 5HVHB 5C09B 1DUYA 1KYOK 4EIZC 2IAMC 3D25B 3L95B 4QHKJ 3VXUB 4DKDC 5IM7B 2CDGA 1X5AA 1IZKA 4HS8L 3TLRA 1HQ4A 4PY8I 1T21B 3QJFB 4FQQB 4JFEB 4PJ5A 1T1YA 2R0KH 3EYSH 3GMMB 3EHBD 4XNYH 2GIYA 3OX8B 3S34H 1TZGH 5D70H 2BRQA 3H9HB 3D0VA 4BH7B 4XZUB 1U6AH 1KTLB 3TIDA 1HHIA 3W11D 3WSQH 2G60L 4LPTA 1YMME 2NXYB 1HE7A 4OQTA 3A0OA 1N5YH 2DJUA 5DGRA 2Y6SD 1Q9LA 4J23A 3LD8C 3CSYB 4HZLB 4S1QH 4OTXL 5CEZL 1IC7L 5BS0B 3HZYA 1F58H 5CIPB 4OD2B 2AV7B 4NQEB 4OF7A 3S3PA 4GLRH 2BNRD 1GGUA 3AREC 4YEFA 2LV4A 1P2CA 3PQYB 3MZTA 4OUUA 1XAUA 3RGVA 2A9NH 4Q9CA 2IADB 3MLTA 3CPLA 1UYWH 2J7LA 1DUZB 1AC0A 4AEIH 1K6QL 5IB1A 2F54D 1QFOA 2X4PA 3JTSB 4LCIH 4KJPC 1IC5L 3TVMB 3O9WD 2RGSA 5FCUL 4NT6A 3EO1B 2GAZA 2NY0B 1TXKA 1K3IA 3L5WA 5I75B 4NPYA 2FX7H 4R90H 5A2IH 2DQEL 4CW1A 3BAEL 4NO5B 3Q3GB 5F70A 3F7VA 3O4LD 3NZHL 3QH3A 4D9LL 4C59B 4WW2B 2IBZY 3EYFB 5I73B 3ZYIA 2I07A 5MERA 2DLEA 2F8XC 4NFCA 2F5BL 3X3FH 4NDMB 2LAAA 2LVCA 3FQRB 5T5NF 3ULVL 4APQA 4YNYA 5MHSD 2J4WH 4PJBB 1YJDL 1YNLH 2D7TH 1VFUA 3OJDB 3TBSA 3ZTNL 2AQ3A 5TGBA 4OD3L 2PN5A 2OQJA 4P57A 4UQ3A 4LSPH 5TDPB 5KTEH 3V5DB 3QDGA 4ALAL 2JJTA 5I0DA 2VXVL 3MOBH 1CD1B 4PGEA 4R3SA 2CRIA 2H6PB 2VQ1B 4R8WH 5GZOD 3CJJA 3S35H 2YPLA 3V7AG 1VHPA 2NXZD 2VQUA 4ZAKC 4H20H 1KEGH 3SY0B 3CMGA 4HH9A 3T0WA 3EOYG 3QULA 1EBAA 2YOCA 4PGBB 5J56B 1OOAA 1X5FA 3HG1E 4AEHL 4LLVB 2LE9A 2W60B 3QXVA 4ZD3L 1A7OL 4PV8A 1F3DJ 4M1CC 3IFLH 4WNQB 1Q0XH 2PO6A 3GMPA 2FGWL 4FXKA 4Q9RL 2XYCA 5HYFA 2LQRA 2V2WA 2FNBA 1IBGH 5JORA 3T3PF 3MCLL 4Z7WA 4PLNC 5JHDD 5I1GH 5KS9A 1MHCA 2V2XB 3SJVA 1GIGL 4XBPB 4BELD 1NDGA 3HE7A 3SKUD 5DJ6A 4PJ9D 3TJEL 3O0RH 1W72L 3MUJA 1CFQA 1IGYA 3DWTA 4PRBB 2GT9A 5I17A 2NY4C 5KBNC 1C08A 3C9NA 1S8DB 4C56E 5LQBH 1NFDE 4LSRH 1KLUA 1MVUB 3JV6B 2GTWA 2BZDA 2ATPA 3ZTJH 1EZVX 3HMXA 4AZ8A 4ZFZB 1NLDH 4KVCL 5F88B 3ULUC 3CXDL 4U1GB 5IW6A 4K3EH 2HH0L 3AXLA 1UFUA 1JYNA 4FTVB 1K4DA 2R2EB 2IANB 3MV7E 1Q0YH 3MLVH 3JWNC 4NCDA 4AIOA 4Q0XH 5ADPH 1I9JH 4ZYKB 2JK5A 3D39E 3QDMD 3WIFB 4JFOB 15C8L 4XAKD 1MFNA 4KROB 1CFTB 2P44B 3WXWL 1AQDB 1OB1B 1KJ2B 4N8VG 4CU8A 3MR9B 4ZQKB 4NQSA 2ZG1A 4MXQC 2VDPL 5TF0A 5FKAB 3RWGB 1OLZA 5D6DC 4NN7B 4JM2A 4ENED 3X14A 5GJTH 2V2TA 3PGFH 1UVQA 2AEQH 2OXHA 2N56A 5E8NA 1AO7D 5HI3C 1N3NB 1B0WA 1HHHB 4OZIA 2BOCA 4PJAA 4KK6D 3QIWB 4HMDA 4JFQA 2KL6A 4GSDL 5D2LF 5HHXL 4XXCA 1DQQA 5FYKH 1EH9A 3DSFL 3RVTD 1VGEL 3HG1B 2XICA 1MEXH 4GQ9L 1T1ZB 3MV8E 4GLRI 4MNHA 5GGUA 1ZEAL 2Z92B 3SOBH 1QRNE 3RKDD 3TNMB 1S5IL 3QXAB 4U1SA 5C0GB 4F7CA 4OAWA 2XPGB 2BHUA 3RTQB 1WFNA 2PUQT 4M7LT 1EJOL 4P46B 3N0PB 1U8KA 1EK3A 4XNMB 1NMCC 1RZGB 2D0FA 1J0ZA 3RDTC 2IAMB 3MLYL 3LN9A 3WKML 1EEZB 2HTKC 1NFDB 1DEEA 4MNGB 4LVEA 3S97C 2CGRL 3MMEA 5IG7B 3TT3L 2VLKA 5K9OB 4J3VA 2P7TA 5DHVB 3DRQA 3MRCA 5FGBC 4LQFH 3IDJB 3MCKA 4PLKC 1GAFH 3LV3A 3SCMA 1N4XH 2DM2A 5DR5L 3UAJD 3MV7B 2YD1A 4HPYL 3MCG1 1WAAA 1HQRB 4X83A 3RRQA 3MRNB 3MJ9A 1MQKH 3AS1A 1NUGA 4QRTA 2D31A 5GGQH 3LD8B 1U3HC 3O8XA 3Q6FB 4ZFGL 2X10A 5F3BB 4WJ5A 3LRSB 4WO4A 1ZKAA 3VXQB 4CJ0A 2FECI 4LVNC 3WMSA 4Z77B 4ZXBA 2IQAA 3P4LA 5HY9A 1J05B 2NQCA 4DAGL 1CGWA 4JHWH 3X11B 1ZHKB 4OCMC 4KJYB 4GRWF 1WBYB 2CUIA 4S0TD 4LLAA 4C4KO 3W39B 4TVPD 4NJ9L 4KK9D 3V95A 3HCVB 1CN4A 5EIVA 2DQTH 3ARDA 3FT4B 2GK0A 1N26A 3CK0H 5F1IA 2V5TA 1AD0A 3D0LB 3GJEA 1I7TB 1JJUA 3MRJB 2WLYA 3JUYA 4GQPH 5JXAH 4P2CG 5FUCE 4F9LA 5AZ2H 1JZ6A 4W6XB 4KTEH 2OK0H 5DUML 1YZZA 4ODTH 3VXPB 2R4SL 4UTBL 3TYGH 4X6FB 1P7QA 4G5ZL 3MV01 2FJFA 1A9EB 1SYSA 2ADFH 3P9MB 3G6JF 1IEAA 1H3PH 4L4VE 3RHWF 4ELMA 4Q6YA 3ZMRA 4LEXH 1X3DA 3GBLA 4GMSH 3RIFF 2AXGA 2VDML 5SWSA 2JJSC 2OR8A 1I85C 1HXMB 4EI5A 2HFFB 1IM9A 2PXYA 3QWQB 3MJ7B 3QCTH 1LP9A 3NFSL 3HE6D 4HUXA 4NBYB 4JPKL 3N9GH 4I48A 2QR0A 3RWEA 4YHZL 3JWOC 5J3HC 3FTGA 3KPLA 1SBSL 1ZE3C 3IVKB 5DWUH 4X7SH 5F6HJ 4GAGH 1KNOB 4G9FE 4KK5C 4ZAKB 1UACH 2QSCH 4MNQE 5LXGL 5ESQB 2NX5A 1KB9K 1HDMA 3VXRE 4Y5VC 3HMWL 1FVDA 2A6DA 5T1MA 3TBWB 1OL0A 3QRGH 1WIUA 2NY5C 4LPCA 4LSTH 1JPTL 4ETYA 3P40A 4GRMA 3O45B 4GJTB 3F12B 5HYQA 1D5BB 2F19H 2IBGA 3HA0A 3WEXB 1LDPH 3N85H 4OF3A 5TE7L 3LEYH 1DQTA 1MCFA 1XR8B 1FORL 1RK0B 3CFCH 1N0XH 1NMBH 1ULVA 4JKPL 4I77H 1ZANL 2VN7A 4ZTOH 1BOGA 1ZHLA 5FV1L 4W4OA 3QRFM 4M62H 2DIBA 1GVIA 3S37L 4PRIB 4PGZA 1IQDB 4UDTB 4NNPH 3WFHA 4EOWH 4FQ2L 5D2NA 1PSKL 2EDOA 1DFBH 4YPJA 4HAGA 3HLAA 5FDYA 3TN0C 5EOQL 4FQIH 4J3WA 4Z7VA 1DLHB 4M8QA 3KXFA 3S35X 3U6RA 5D8JL 3DX9A 1PLGL 4KRLB 5E2VH 4KMTH 2P48B 4L4VB 2DM7A 4UB0H 1ZA3B 4OZHA 2RHEA 2Z31C 4OCNC 5D1XC 5KSAD 4M5YL 4KJQC 1DL7H 3MLRH 2PYEE 5IMMA 1DEDA 5C86A 2QHRL 4K71C 1BBDH 4OLXL 4IHOB 3QFDB 5IEHB 1YN6B 4DUXA 1LK3L 3RWCB 2FD6L 5J6HA 3ZE1F 2VDLH 4HKZB 1R3IL 5LG1A 2A73B 4JFYA 5DMGC 5C07E 3RWJB 1MRDH 3BKML 5IB4B 4W68A 3IDNB 4RISL 3GSNB 4JDZB 4PB9H 1YUHA 5IJKA 4X8JA 1OD9A 4JFPB 4HWUA 4G9FB 2VLJB 3HRZA 5J1AA 1DQDH 4HUWB 2E9JA 2H45A 4MNQB 2HT3C 4X6BB 3VGFA 4X6EA 4TUKH 4AQ1B 1QFUH 3QQ3A 5ICYB 4G8IB 3T2NL 3TPUB 5B22A 4G42A 2YUWA 1R0AH 3VXRB 1HOCA 4M7LL 1NCWL 4IOSD 1B6UA 3UEZA 2OJEB 1PZUB 1HSBB 4Y1AD 4Y19E 5F8QC 1J5OH 4U2ZA 2CLZB 3L3DA 4Y5YA 5SX5H 4HGMA 3ORJA 4HUVB 3TBTA 1I3GH 1FIGL 1MF2H 1LO3H 1TETH 3ARTA 1NMCB 3HB3C 4MD5B 4MJ5B 5DZLA 3RDTB 2FR4A 2YD7A 3PGCA 1UH3A 3TV3H 3VG0L 2DOCA 5K9QI 1JPSH 3MGAA 2HN7A 3KDMA 3BVNB 4CMMB 1ERNA 2DQFB 3QWOA 2ESVB 4JY5H 1BP3B 3P11H 5IUSA 4YHNB 5T3XH 1UXWB 5CILH 4K7PX 1AIFA 4YIQB 3STBA 1NC4A 1NGZA 2KBGA 5CZKA 4KVNL 4K2UH 3MACH 1NJ9B 1I9RH 2H3NB 3M1BB 1QSEE 4RWYH 1MI5E 1U3HB 4JRYB 4DWHA 1FZKB 2ED9A 12E8H 3BUYA 1E4XL 4L1HA 4LCUB 4JEGB 1AXSA 2WMPA 4NQDD 4R0LB 2A77H 4YXHH 1NGXA 2F8VA 1IM3A 3G6DL 4LVNB 4PRPA 4N1CA 4LPUA 2VYRE 1KENH 1NEZA 5IVNA 2C1PB 4U1HA 1MCDA 1FE8H 4NWUH 5EBLA 3BH8B 1MELA 4HKXA 1EEYA 1HCVA 4J7RA 3BT2L 3KPSB 1HSAA 1QYGL 5C07B 4L5FH 4DKFH 4Z95H 3RIAF 1RVFL 1VESA 4RWHA 4KDTC 5DVOA 1WCBB 3BMVA 2HP4A 4YHKL 4NBXB 2C3XA 4MA8L 1B88A 2Q8BH 1ZVSB 2CH8A 5CEZD 1ZGLP 1TCRA 3E8UL 2CDFA 4OZ4B 1ORQA 4Z0XA 1C16A 1JWUA 2BY3A 4Z76A 5MEND 2HWZL 2ZKHL 4XPTH 4LCYB 2EDLA 1UB5B 1KPVA 2N7BA 3HC4L 2BSTA 3FCTA 4RAVB 5F7EH 5C9JA 3EKCA 2W9EH 5EWIH 3CSGA 4GW1B 3S5LA 1ODAA 2IFFH 4UZGA 5JMRA 3HI6H 2A6KB 4B41A 1U41A 4AIZB 4LVOC 5HYJE 4MAUH 3C6LA 2CRZA 2EH7H 4HPOH 4LDEB 3C2AH 8FABB 1AGCB 4MQXC 4AH2A 3HMXL 1QRKA 3WNPA 3PWUB 2ZSVA 2IH3B 4MD0B 5ALCH 4P3CH 1U58B 1J8HD 1FV1A 1K2DB 4CDHA 3F7YB 1FBIL 4LF3B 1ETZA 2J88L 2PTVA 1BX2B 1RUQL 4G80B 5MEPB 1XCQB 2APFA 4DVBA 5L8JB 1F2XK 1AKJB 5I2IB 5MP6H 1HKLL 2D7PA 3IDGA 5L0QC 3MRPB 4XWGH 3VXMD 5T1KA 3CFKB 4JY6A 4PR5B 3C60A 1S7RB 1A47A 2BOBA 3G6AB 1DBAL 4Y5VB 3FQTA 1YN7B 1D6VL 4JR9H 1J1OL 1DANT 4J1UB 4M3KB 4N0CC 1JWSA 3EYOA 3P73B 3RAJL 4ISVA 4X80L 5CSGA 4ZS7H 2EZ0D 1G7IA 4MDIA 5EFIA 5DVMA 3T8XB 1G0XA 4F57L 1UWGH 5C0CD 4IOIA 2NCMA 4JLRB 3RL2A 3QCVH 1Z3GH 3ALWA 1ZMYA 3LY6A 3BZEA 4WI5A 1FP5A 3EHBC 5DD1H 1W0WA 3I50L 4HQQH 2F53D 1WTLA 4P4KA 1TJHH 3HN3A 3O2VH 4I5BB 4Q58C 3W11C 1P84J 4FQQA 3ZE2F 1RFDL 1GXEA 3F5WB 4QRQA 5C0FB 5EIQA 2Y6SC 3HAEB 1FL5A 5IBLD 5GGRY 2P42B 3MJ6A 1KTLA 4X0KA 3QUKB 5KSBA 3BYYA 2C1OB 3GMRB 5DRXA 1F6FB 4WU5A 5EOTA 5IOPA 1DSFH 4LLQB 2UV3A 5D7LB 1N8ZB 1BM3H 3CSYA 5DEGA 1CXHA 4KUCF 3HS0B 2Z31B 4HKJB 5D1XB 2BJMH 4X99A 4L3ED 1YEJH 1YEEL 4IM8A 2DTSA 2NTFB 4OZFG 2EIEA 1A7NL 4K71B 3QEQB 3U46A 3WLBB 2DQUH 4WU7A 3MRQB 4N68A 3BWAB 3BP7A 3R06B 2R0LH 3O9WC 3THML 5INDB 2WBKA 5IVZA 2OR9L 3GI9L 2ITCB 4G6KL 2OX5A 5D7SH 4EUPH 5FB8A 4QRRA 4L9LA 4ONHA 4G8GD 2R2BA 5C0AB 1P9MC 3EO1A 2VABA 5F7UA 1CFVL 3BPOC 2H26A 3S36L 4XCEA 4RGNE 1Q9WB 2MMXA 4I1NB 5E9DD 1MCPL 3U7WH 1YECL 3QFJA 2XQBL 1T7ZA 3ZDYE 3TEUA 5GRXG 5EDXA 5ESAB 2VWEE 3CFEA 4PJIE 4RNRA 1OGAB 3T2QA 2QQLL 2JELH 2VL4A 4OLWL 1XCTB 5D5ME 3U4BH 3N1PC 5IJVA 5CP3H 1J1PL 4K3JL 2L0DA 3QEUA 3FO0L 4PD4J 5L2JA 4HFWA 1IEBA 4PJBA 2EDRA 1XH3B 3BEVA 3MO1A 4HH8A 5GZOC 2J12B 4NFDA 3UBXG 4DQOL 1DVFA 3M45A 2NXZC 1CVSC 1BD2A 3RY6C 4EDWH 3RBSA 4QTIL 5C2BL 2P1YA 3RZCB 2YD3A 3QG7L 1L0YA 1A4JA 3MV11 1ZHNB 2P47B 2WQ8A 4LSSH 4FRWA 1JHLL 1N64H 1PD6A 5BRZA 2IWGA 3OB0K 1VKXA 1A9BB 5HYIA 3V6OA 4PJ7E 2QQQA 1YEHL 1XIWD 1XF2B 5A2JH 2J1KA 1VPOL 2HJKB 2OMNA 4M7KL 5GS2H 2DD8H 1BQHB 1UM4H 1BMGA 4PJ9C 3GMNA 3DX8B 3D69A 1HNGA 1RIHL 3ZKXC 5E5UB 4G6MH 3MREB 4NKMB 5KSVB 4FZEL 5DJ2B 4KQ3L 1V3KA 5I1EH 3U0WH 4FQ1H 3C5JA 1AJ7H 4E41A 1MCJA 4FQHB 2BDNH 1ZT4B 4AYFA 4HS3B 1AGFA 5T1LA 1ES0A 3H3BC 4EBQL 3WCYA 1UB6B 5JPMB 4ETQB 4HWZB 4JFHE 1OAYH 4Z0BH 2MQCA 3QO0B 4NJAL 1OF2B 4TN9A 5I1HH 5KVEL 1XR9B 1EJ6A 2QHLA 4UAOC 4X7EC 3ARFD 3DX6A 3CIQA 3VH8A 4Z7WF 1YYMH 4P2RE 3K2UH 4GBXC 5KS9F 4LDOB 4V1DE 3HNTH 4MLSA 4LSQH 5FO7A 3EAKA 2ZWLT 5DDHB 3RI5K 1GC1H 3B9DA 4RRPA 4PJIB 5EH1A 5KSUA 3FO9A 3BN3B 2P46B 3FB7A 4M1DL 3A6BH 1J1XL 2CR3A 3BSZL 5BZDB 2V5SA 1TZGL 4ZSOA 4LVOB 4ENEC 5D5MB 2DWEB 5CHNB 1KXTB 4BH8A 2WIIB 2Z91B 1N7MH 3I3EA 3WSQL 3G08B 4A6YH 2HFEB 4HXAH 4P2QE 3C8KB 3IFOA 3RWGA 4KK6C 4AL8H 3RX8A 5JNYB 4LQ1A 1EFXA 5F21B 1LO4H 3K8LA 4C58B 3RVTC 3GSVB 5L0QB 4BK4A 3PHQA 4PJFA 4NHUA 2IQ9H 3C5SA 3ZT5A 2F58L 1NAMH 3RKDC 1O7VA 1MJ7L 2UY6A 3W2DL 3UYPA 4UIMA 1UKTA 3HUJE 4K7FA 5J4MA 1IAOB 1T03L 3LIZL 4G7YH 1MCWM 32C2B 4PJXB 4Q9QH 5TQ0H 2DQGH 2CKBB 2Q6WA 4JZJC 4XCFL 4PJEB 4JM2F 5B3NA 3K0WA 3T4AA 5EU3B 5JQ6L 4Y7MA 3JV0A 3SGJC 3VRIB 1XGTB 1RZGA 2YK1H 4OZIF 1DBMH 2UZXB 4PJAF 1KGCD 3GBNH 1FNFA 1K8IB 3QI9A 1IC4L 3UAJC 2VDQH 1OCWL 3P0VL 5EIIB 4QHMA 4QCIA 3BWUC 3QEHB 3X3FL 3KPNA 2Z0BA 5EZJA 2YPVH 1F4XH 2VDRL 3DLQR 1JZ2A 3MLWH 4F7MB 2CIKB 4ZUUB 4KDWA 5C0DA 3L7FB 3TA3D 2DLHA 2X2YA 3TH4T 5KVFH 2VDNH 2VC2H 4PJCA 4LSPL 2YZ1A 1FC1A 1Q72L 1D3CA 2AP2A 1V7ML 2BNRB 2FECL 2VERN 4LBEA 5F9OL 4JQIH 2CMRH 5ID0B 2W65B 2BY1A 3CLFH 4KK9C 2X70A 1OAXH 1EXUA 4BSWB 2IH1B 3KPPB 2BNQA 3AREA 2F54B 3WNLA 1A21A 3W0WA 3BKCL 5EUOF 4HDIB 1KPUA 3SKNB 1F3JA 5IMKA 2FO4B 1WAAF 1KV3A 3GO1L 2V6HA 2DL9A 3E3QE 5FM4A 5HHOE 3VXSD 1INDH 1R24B 3O4LB 2AEPL 3DSNA 1P4BL 3O3AA 1PDKA 3BPCB 1FLTX 2K9UA 1T83A 4GG6E 5E6IA 2OP4L 4JM4L 4WTWA 3SBWC 4KUCD 5I18L 2BRRH 4MX7A 3HE6C 1YYLH 3OWEA 5HI4D 4N9GB 1QLFA 4S1SL 5BVJB 3CFDA 1WITA 1J11A 1BAFL 4PJ5D 2I9LB 5JW5A 1U8HB 3F7PC 2C7UA 2X9XA 4KAQL 4PJGB 3FZUD 4Y8AA 1IAIM 5DRZB 5ACMA 5DLMH 3D3VA 5B3JF 1S9VA 5J9PA 3IB4A 3CMOL 4L1DA 3UJJH 4R7NB 4KTDH 5IEKB 5KW9H 4Q0XL 3DRTA 3NCJH 2NXZB 4N0UB 4IMKA 2J8HA 4JJ5A 3T3ME 1R3JA 4BZ2H 5DD6B 1BVKA 5EO9A 2WWKT 4XMKH 4D0CA 5F7HA 3O6LH 4M1GL 2VL5B 4WEUD 4ELMF 3RVVD 2F5AL 5FYJH 2XXCB 3FONA 4PG9A 2DM3A 4TSCL 1PGRB 2V7NA 4U1JB 3P4OB 4YXLL 1LP9F 4D0DB 5K9JL 4PJ9B 3CX5J 4M6MH 3PGFL 1KEMH 4KZEL 2A0LD 1EZVY 3WUWB 3OKEB 1MWAH 4DUVA 3H9SA 5DEZA 1KB5A 1I1FB 2I60H 4RFOH 3MLZL 3MNWA 3P9LA 4CN4A 3KHOA 3FAXA 3O41B 4OSUL 1CTNA 2AJYH 5FHBL 5D7KE 5H2BA 5JA9A 1DANU 2Q3ZA 1DBJH 5KN5B 1KFAH 3IXTA 1T89C 1UCBH 5DD0H 1X5ZA 2NY2D 3QDMB 5HHOB 3FQNB 4NOBA 1AGEA 4APQD 1E28A 3BE1H 4UAOB 5B39B 3F62A 2VITA 4L29A 1JNHB 4PGJA 5KSAC 3GB7A 3ISWA 5GRVL 1G6RL 3S88H 3WJLC 3PDOB 1ZT1A 3T2OA 3QDGD 2I5YH 2FH8A 1E4KC 3DXAA 4B7LA 3GMLB 3KPQA 4R26L 4TVPE 5JUEL 3QZWB 5FAAA 2YPLD 1CFBA 1JPST 5L8KB 5K33A 4Y2DC 1H0DB 4CAGA 4R2GC 1S7UB 4FS0A 4G6JH 5SWQA 2CK0H 4EUPA 1AO7B 2ICCA 3WV0A 5C0JA 5GXBB 3MXVH 1RI8A 3NIGF 5CSZB 1T3FB 5LAXB 2NR6D 3BRFA 2VUYA 4Z7VF 1DQMH 2PO6D 4OKVB 1JNJA 4J3TA 4RIRA 2XKNA 5BVPH 4XNQB 5FUOL 4H5SB 1N59A 2E3VA 2X09A 3SJVD 1CGUA 1ADQH 3HE7D 3PHSA 3TBVB 5DJZB 4OZHF 3P0GB 3OKLB 2OCFD 5EO1A 1NUFA 5AG8A 2HLAB 1VFAA 1ZAGA 1GGCL 1PFCA 5CP7B 4NKOB 1LD9A 4NRZB 4JZJB 4XPGH 3L3GB 1U8OA 4LNRB 4U1MB 5L8LB 2AXFA 1DN0A 3VI4F 3IS0X 2Q87A 3STZB 3DTXA 1JHKH 1KOAA 4Y4FA 4HJ0D 5GSRB 3RDTA 4UV4H 4ONGH 5TQ2H 4MQ7B 4MCZA 4QT5B 3BDYH 2ADJA 3O11A 4TUOA 3IS1X 4F7PA 1GPOL 2PW2B 1JN6B 4QHLB 2WUCH 2VE6A 4MSWB 4NO3A 1ONQA 1FVEA 1MIML 2OJZH 1AD9B 2O5XL 1U8NA 3HNVH 2DWDB 5TFSL 5GGTL 5E8PA 1R3KB 1NL0H 3B9EA 3SE4C 1YPZB 3UTPD 2AK4A 3E2HC 3QCTL 2APTA 1PG7L 1A3LL 3T0DA 3LKRB 3BP5B 3H0TB 2D03H 1NJ9A 2W9DH 2P24B 3HI5H 2VIRB 4NCC1 4Q7DA 1U3HA 4JM2D 1ROWA 1HHGB 4OI7A 3HPLB 1B2WH 2DBLH 1AR1D 3A6CL 5CJOH 2FBJL 1DBKH 1JPFB 2GJ6A 3NCMA 1FFRA 4MS8D 2HG5B 2P4AB 1A6ZA 1G7MB 3BZFB 4I2XA 3WIHH 2H8PB 1JZ5A 4R96B 1LMKA 1PAMA 2IGFL 3D48R 2I26N 1UH2A 3WFCH 5ETUB 1K85A 2Z35A 3WFEL 1HZHL 4K07A 1C5BL 2P43B 5DTFB 1OSPH 5IV2A 1T1XA 5GRJH 4KHTL 2ZOLA 1FZOA 3NFPB 1A6UL 2VZSA 4UI2A 4JPVH 1FL6A 2AJUL 4WHTA 3LQAH 1CE6A 5M95B 1FRGL 3HE6B 2NLJA 2IPUK 4PRNA 5CBAB 4KXZH 1MNUH 5D6CB 4NZRH 4M62L 4OZFH 2JJSA 4QEGA 2VLKD 1I85A 1HEZB 1N5AB 1OM3L 4YWGL 4EOWL 2DDQH 1P7HL 3IXAB 5HPMB 1MJJA 4EN3A 1BZ9B 1IGIL 3PWLB 2XWBB 5ICXB 2A6JB 1KN4H 1AGCA 1FNSH 5HGBB 3AS2A 1MCRA 5FO8A 4BFBD 2XRAH 2AJSH 3H3PH 5CJBA 1NAMA 4U1IB 1S3KH 1T0MA 3EYQD 4OLVH 1BQSA 1QACA 3J7HA 1N2RA 3MODH 4KMTL 1QHOA 3GI8H 3O8XD 1RZKL 3KPRE 5INCB 3SPVB 4WO4D 4K23L 3ARXA 5IGXH 3L3IA 4LDLB 1CK0L 5ACLA 1AGDB 4ESKA 1KCVL 2A9ML 5K59E 5F97E 1ACYH 5AUMA 4XMPH 1U8JB 3BRDA 2A6IA 1KACB 2EZ0C 1VFBB 1RULH 2B4CC 1KYOJ 3I02B 4WTZG 1AFVL 1AXTH 4BQ9A 1DQJB 4OZGF 3DV4B 1QLEL 3ARDD 3X13A 3B4NA 3RWHA 3ZSSA 5J6GA 1MRFL 1TENA 1DBBH 4ZUWB 3ZL4L 5I30L 3NA4A 3TBYB 3IKKA 1F6AB 4PB0L 2GHWB 4GUPA 1D5MB 2IPUG 4DVRH 1T5WB 4NZTL 4PGDB 4XP4L 1P7QD 2X40A 3DI2B 4AQOA 2X42A 5IBLC 4NM4L 5DJ8B 3RA7L 1I8MA 5T3ZD 1KN2H 4LHQB 5FKPB 3O6KH 4JO4H 1TVDA 2WP3O 5SWSD 3MA7B 1MSPA 2XKUA 1I9IL 1RIUL 1IM9D 4EI5D 3EBAA 1WFOA 3DMMA 3TN0A 4ODWB 4JANA 1LO0H 1MF2L 3JV4B 3GMRA 4DGVH 5KSAB 3VXNA 2P5WA 4WFHE 2CLRA 4YGAB 3U1SH 1SQ2N 3VD5A 4U7KA 1X6NA 3HI1B 4PYGA 43CAB 1R5IA 2EDXA 5FFLA 1I9EA 5GPRA 4F58L 4RGOL 4QXTB 4JY5L 3TNNB 3L5IA 4YFLI 5ENWA 5IB3B 4HKJA 1UJ3A 2Z31A 4KPHL 2FX8L 3AAZA 3G5XB 1A1OA 3I6LD 2W38A 2NTFA 3MFGB 6FABL 1NCTA 2NX5D 4G8FB 1BFVL 2X6MA 3AY4A 1RJLB 1M7IB 5CEZE 1C1EH 2ARJA 3MRDA 1AHWC 2IPKA 2WWMC 1RQ5A 4LIQL 4TSAH 2E7CA 1I8KB 4NCC2 1FNHA 5KSBF 4YHMH 5HDBE 2I25N 35C8L 2VXTH 4MHHG 2VLRA 1FGNH 3O2DH 2JLLA 5IROC 5BQ7B 2V9TA 4GRWE 4Y1AB 4MJ2A 4Q6IC 1KG0B 3OB0H 4LNVA 5CZVH 3HAEG 5C7XL 4I8DA 1JZ3A 4QYOA 3DVGB 1UJTA 2AABL 1EV2E 4L5FL 4NP4H 4P23D 5HHPB 3VGAC 2W0FB 5DHXB 2BSRB 5FA4A 3H42H 2X4RB 4FXGB 1M05B 1EHLH 3ZE0F 1J12A 3PHOB 4IS6B 5FO9B 1KT2B 5D2LB 3BP6A 3HPJB 1BVLA 2MNUA 3BP4A 2GQHA 1BJ1H 1JGVH 2NY7L 4I9WD 4L8DA 1QR1A 2WQRA 4JRWA 3KXFD 4S1DD 1Y6MR 1QBLH 2DICA 1XGUB 5JIKA 3I75B 3PGDA 5BO1H 3VRLE 3AU1B 5ITBL 4FQJH 4NOFA 2HKHH 2ICEA 1XIWC