2A1WL

Anti-cocaine antibody 7.5.21, crystal form i
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
216
Chain Sequence
b'DVLMTQSPLSLPVSLGDQASISCRCSQSIVKSNGHTYLEWYLQKPGRSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQGSHIPWTFGGGTKLESKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin light chain kappa
publication title Flexibility Of Packing: Four Crystal Forms Of An Anti-Cocaine Antibody 7.5.21
rcsb
molecule tags Immune system
total genus 47
structure length 216
sequence length 216
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a1wL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a1wL01
1IGCL 4NOBA 3LKPA 5AYUH 1SYVA 1AHWC 1A7QL 5DRXA 5C07B 1CDBA 3VFMB 4IMKA 2IAMB 4UV7H 1QNZL 2BJML 3QAZC 3HFML 1EEQA 2Z31B 1AGEA 5JIKA 4Z7NE 3P9WB 2GTWA 5FYKD 3V6ZB 1KB5A 1G6VK 2XPGA 4RIRB 1BZQK 1WEJL 1C12A 3AXLA 4EKXA 3NFPB 4O51B 5KSVB 4ZUUB 4RMSA 3BFOA 3C09C 4Y0GA 1CDYA 1NGQL 4FFYL 2FB4L 2EYRA 2I60H 4OZHA 3FMGL 3UYRL 2DQFA 4QTHB 4HJ0D 3SCMD 4UDTA 1JP5A 5I8OL 4XXCA 1AJ7L 4YHNB 5BZDA 2G9HA 3JTSA 4AEEA 1MCBA 4W4NA 1CG9B 4Q6IC 4QY8A 2R2BA 3DX8A 4JDTH 5IVXF 5SX4I 5KSAB 1ZHLA 2H2SD 5D7IF 2IPKB 4PLJC 3H9SB 3NTCH 4LASH 3MUHL 4FQLL 5T3ZL 2BRRH 2QR0B 2IPTH 1PW3A 5JQ6H 2BOBA 3ZE0F 1FGNL 4WEUD 4M7LH 3DO3A 3GMOB 1KJ2L 3CFEB 2BNQB 3WKML 1X4ZA 1KV3A 1B90A 1XIWB 2Y4SA 4LRIA 3FN0H 3DRTA 1DL7H 3P77B 2I07B 3MA7B 4IRSD 2KKQA 5DDHB 3HUJF 3FRUA 3SOBH 4N8VA 4QRQB 4XHJD 5E00B 1MOEA 1ERNA 2X2YA 3EOBB 3LRSA 1N7MH 2P45B 2E27L 3MLYH 3F7VB 1MEXH 4I0PB 4LVNB 3SDXE 2I9TB 3IFPB 5JHDE 1YNTB 4IJ3B 3ARUA 3BMWA 5GJTH 1SM3H 4XC1L 5IG7B 4LSVL 4EIZC 2BC4A 1SJHB 4OZGF 3A6CL 3CD4A 3KLAA 2WMPA 4KJPC 2AI0H 4R97B 4X7CC 4LLMB 4HCRH 2COQA 2ICWI 1QSFB 2NY2C 3VJ6A 1CTOA 1BF2A 1J8HE 4U6YA 5EDXA 2M26A 3QUXA 2NY6D 4PJDA 1JNNL 3AGVA 4IDJH 4OQ1A 3QEUA 2HJKB 3G6JF 4PJXB 1H8SA 5JO5B 2VDNH 3O9WB 2MNUA 5ALCH 1EZVY 1HK6A 32C2B 2VXUH 3L5JA 1KOAA 2J7LA 1KEML 3FTGB 4LVHC 2FWOB 1PG7W 3KXFA 1QRND 1QFOA 3DUSA 1JYWA 4WO4D 1YPZA 4ZUSB 1KLGB 2F5AH 1T7ZA 4R2GD 4RZCA 5CJOL 5T1LD 2VUYA 4XNMB 5D1ZB 5CJ5A 2NW3B 2NPLX 4NZUH 5HYFA 4X8XA 5E94A 3DV4B 3RWHA 5DRNB 1KACB 3DGGA 4ZD3H 3T0WA 3BP7B 1RURL 3O4LD 2I27N 4KROD 5DRZA 1UACH 3B2UD 5I16A 1B0GB 1DCLA 1OAKL 4B5EA 3UTSA 5HDBE 4ZO9A 3MRPB 4JPIA 1KULA 5E03A 4P5TC 4C55A 2C4FU 2C26A 1XGRA 4OD2A 5GS3A 5LKNA 5I1IL 2VR9A 1RY7B 2J3SA 4Y4KD 3O8XD 4ODVH 1YMMB 4YK4C 5F7DB 3DMMD 3MRDA 3CFJB 3IJHB 3ARBA 4H1LG 5CEXB 5C0AE 5KVGH 4PJGA 4HJGA 4A6YA 4HSQA 2ARJQ 2P8PB 4M93B 4E41A 3ARED 4GG6F 1J5OH 2OZ4A 3RPIA 3EFDL 4M7JH 4D8PA 1ZOXA 2EIBA 4FQPA 3CDCA 5ID1B 2FO4A 1NCBH 2PW2A 4P9MH 4XAKD 1YN7B 3JXAA 5HHPA 5D7KD 1KIRB 4P5KB 4K7PH 4HJJL 1RUQH 2OXHA 2VN4A 4FXKB 5AZ2L 4I5BA 4JFDA 1TITA 1WSST 2WW8A 3LEVH 1JZ5A 2MFNA 1X7QB 1ZVHA 1W0WA 5ISZE 2ARWA 3TN0A 5I73B 5CBEB 3GK8H 2QEJA 5DK0B 3LQZA 1WAAF 3ROLA 4LIQL 4GBXB 2MCPH 5EU6B 1RZIA 1A21A 1ZT1A 2YD5A 1FNLA 1L6ZA 2ATKB 5F1IB 3VXRA 3CX5J 3D3VE 3UX9B 1RULH 3QQ3B 4QRRD 5IMOA 1E27B 1JGEA 3REWB 1U8NA 1E4JA 4HMCA 3PDDA 3RGVC 3OF6D 4JFFE 5I1LA 4JFZH 4HKJA 1U95B 5KAQG 4KKCC 4QHLB 1OGAE 4Y2DD 2NY7H 4EQ3A 1R3KA 3ES6B 5EU7C 2DB8A 4GXUM 4TULL 1KEGL 4IRJC 4HWEL 4MNQB 1G9MC 1OW0A 5CAYB 1T66C 1HH6B 3CH1A 1AGBA 4P2QD 2EYTA 2NTSP 4P4RA 2C5DC 4RNRA 4R26H 4MS8C 4UT9L 4MAYC 5DXWA 3MLSH 1FFNA 3C6SA 5SWSD 2LTQC 3GMRA 1U0QA 3VFPB 4XP5H 4U1JA 1JUFB 4Z5RA 3QO0B 4LLVA 3V5KA 5F7UA 4OZIB 5T5FL 3O6FD 4G3YH 2N1KA 2P8MB 3IDJA 4CMHC 3VWKA 3Q6GL 4X9BA 2W9EL 3TPKA 2DBJA 4BSWA 3CC5B 5DHVB 1RSFA 3GDBA 5E5MB 3R06A 3GEWB 1KJ2A 1U8LA 5E2UL 4QHKI 3HMXL 3DURA 3TA3B 4MWFA 3HZKB 4P5MA 3I75A 3RHWK 1SBBA 3M07A 5F9OH 5KSBE 4NWUL 3IDGA 1P7KB 1A7OH 5DJ6B 4NQSB 2XACC 4M8QA 4P46B 3IDMA 1GAFH 4NKMB 2DM4A 4NDMA 2ZNWA 4ZDHB 4OCNC 4U1KA 1FN4A 1S7WA 5IK3B 1RUMH 2GJ6D 4Y4FB 1BFOA 2ZNXA 1Y6KR 4PRPD 4NT6B 3TT1L 4RA3A 4QEGA 1RK1B 5AG8A 1HCFX 3GGWB 3OG4B 4F7TA 2Y5EA 3D2UD 2CJUH 1SY6H 5EU4A 3OKLA 2VIRA 1EIBA 3WFCL 4JLRA 1F6AB 3WLWD 2CLVA 1EAJA 1Q9LB 3IGAB 3N06B 2CRIA 1S9VA 4KHXL 5JXAL 5JW3L 2DLFH 1T1YB 5TDOA 5IKCB 1U8OA 3B5TA 5DD1H 5MEND 4M6AA 2GSIA 1H5BC 3MUJA 1PDKA 5LJYH 4P49A 3MLWL 4U6XB 4DUWA 1AGDB 1QSED 3HC4H 3MUY1 4HKZB 4YHLH 5DUPH 2H9GB 4WNQB 4K2UH 1UB5A 4EI5D 4MD5B 4Q74A 2Y36H 3EJZD 1X3DA 2XWJB 4ZOAA 4PYHA 5DD0H 5EULV 3FO0H 2AKRA 1YY9D 5HHQB 3RKDC 1KCUH 4NM4L 2HMID 2DDQL 1YEEH 4ONFH 1DQJA 4E0RB 5EZJB 4YE4L 4N8CH 4GAYB 2AJVH 4D0DA 2GITA 1ZANL 4PRNB 1BPVA 4DZ8A 5F7WC 3GNMH 4YZFF 5IROC 4FMKA 1OQOA 3ILQD 1N0XL 1M4KA 4HUXB 2YEZB 3K46A 3QCUH 1KF9B 1JN6A 5MEPA 1YC8A 1D5BB 4K7FB 3G9VA 1LO5B 4PP2B 2AXHA 3RVVC 3UTTA 5HTSA 4HXAL 4OGAD 2IJ0C 4WJ5A 1ZLUH 1QBMH 4BJLA 1RZKL 2BY0A 3EYUH 1G6RL 2WUBL 3CSYB 2MKWA 1DLHB 1WK0A 2F54E 1MCQA 4AH2A 2ZSVA 4MA3A 5GZNC 1CQYA 1BMGA 1DUYA 5KJRH 1HILA 4YWGH 5GIRB 3BXNA 1XF4A 5IJVA 1LE5B 1R3IH 2HTKD 4NYLA 3K8MA 3L3GA 4AYFA 2APWA 3LS4H 4PJCF 1X4YA 3N1MC 5B4MC 1VERA 1NC4A 5FCUL 5GS0D 1UA6H 5CGTA 5F7EH 4PV8B 3WFEL 2Q1EA 4PBXA 3IF1A 1A1MA 1N6QH 1Q0YH 4DFIA 3P0VH 3UAJC 2FIRT 3P0GB 1KB9J 3BQUA 3ZHDA 3ZT6A 2EICA 4UINL 5DVKA 2A6IB 5IHLB 3EYQD 1S3KL 4JN2A 3QB7C 4UOW1 4TQEL 3C6LB 5JPMA 1ETZB 2DQTL 2WP3T 1GRWA 5CSZB 2EH7H 3GSUA 1A3QA 3A6BL 3BPNB 3QDJE 5FUCE 2UUDK 5CUSH 3ZT5A 2R15A 2ZOKB 2OP4L 4PY7B 5EIIA 5DJDB 3B3IA 3RIFF 5IQ9B 3KPSB 3LSOB 4I48B 4PJFB 5ITFB 5EO9B 3ILPA 4XCEB 2BNQE 2DICA 3GI9H 5TDPB 3L5WB 1N4XH 3PWVA 4AZ8A 3UDWC 4L3CB 1TVHA 1LNUB 5JPNA 5E08L 3I3BA 1YEHL 5L0QC 4JZJA 5F9WB 1QTYT 2DD8H 5ESAB 2CD0A 3U0PB 1HSBA 3BKMH 4YBQC 1OAYL 2FBJH 4MQ7A 5DFWH 3LCYA 5AG9A 2YD4A 1N2RA 1Q9OB 2VLKD 4LSDA 3X3FL 3LKNA 4WW2A 4N5EC 1YPZF 4RDQF 4MYWB 3WE6A 3ARZA 1IZKA 1YEFH 2XN9B 3ALPA 3O2WL 4F9LC 2NY5H 1ZLSL 3HE6D 3AMKA 4POZC 5GS1A 4LVEA 4XMPL 4N0UA 1OTUD 5H35A 5HHMB 4G42A 4NNPH 2NMSA 4ORZC 3DO7A 2DOCA 1KCSL 2Q7NA 3PWLA 2CLZB 4HH8A 2VR5A 1RK0B 1LDSA 3TYGL 2ZG3A 4GRMB 4X4ZA 1CT8B 3O3BA 4Z78B 2PO6D 4PJXE 5EU3B 4L1DA 2F19H 3HMXA 5KN5B 3FO9B 5FAAA 3L6FB 5HYQB 5IMKB 4XNUH 5BCAA 1GGIH 2DF3A 4OLXH 1IAMA 4PJGF 3HR5B 1R3JA 4G6JH 5BS0A 2FSEB 5GRVL 2NNAB 3BP5A 3HPJA 1RZJC 1W8OA 2ERJB 5GS2D 4ZFFA 2CDEB 3C5ZC 1ZVSB 5F3HB 3QXDB 5IT2H 2V9TA 4J3XA 1D5MB 1W0VA 2JCCA 3D25A 5EBWB 4X6BA 1MHEA 2P48B 3HB3D 3FB7B 1D5XA 1UZ6E 1XF2A 1W72A 3ULVE 4ODSH 1Q72H 3RUGE 4ZXBD 1CICA 3N1QC 3TT3L 4LHUD 1TCMA 3SPVB 4WV1C 3PXHA 3W39A 1X6LA 1IGYB 4OV5B 4H25A 4MDJA 4DOHE 5GRJH 3U1SH 1ZS8A 3WIFB 2X4RB 3D39B 1AXTH 4LGSB 3QUML 4FQXA 5JNYB 1CK0L 1MJJA 4KI5C 4AENB 3VW3H 1P7QB 2AK4D 2ZSWA 2X9XA 4RGND 4NKOA 4FQHB 2W0FB 1X5LA 2VDQH 1H3PH 1V3JA 4Z77B 1U58A 4TNVK 2FATH 1CGWA 4JY5H 1A3RH 4YLQT 5ANMB 1AR1C 2EEAA 4XP1H 5FYJE 4MB4A 2OJZL 5DJ0A 2HJFB 1FO0H 4X6FB 1MVUA 5C09B 1QA9B 5JORB 1CFTA 2CIIA 1WBYA 1HHJA 43C9B 1AGFA 2XTJD 1AO7B 4L3AA 4J3OC 2YD7A 3I6KB 4U1SB 5F9JA 4F2MB 3ULUD 3RL2A 1FHGA 4HWBL 4D0CA 5MI0C 2E8ZA 4OB5L 2BJMH 4N9GB 1S7RA 2YWYA 4OBRA 1KUMA 4KH2A 4GQ9L 4PJ7B 1GHFL 1PSKL 4YPGA 3QJFA 5FGCE 1WEJH 5C71A 4R8WL 3PWUA 3BW9B 1NGQH 4FFYH 3FMGH 4PG2C 3H6JA 3MRMB 3QJHA 3MZGB 4I9WE 5D6CA 5GRUH 2NXZB 1YEJH 3HAEH 2ICWA 5IB5B 1G6RA 2JJTA 5IP4A 1D5IL 4FXGA 2DS4A 3I9GL 3RRQA 4UT7H 2YUWA 2YMXL 1E4XI 3RKPA 1MJ8H 3HI1A 1GH7A 4WI5A 2C7UA 4RAUB 4C4KT 1QO3B 1DEEA 4X98B 4WY7L 2O26U 3S36X 4FQLH 3AUVA 3BZFA 5E5UB 3FFCD 4MAUL 5GQBA 4D0BB 5CD3A 4YDJB 1N59A 3O3DA 1UENA 5A2JH 4JFYA 2J8UB 4LLUA 4MNQE 4GRLA 4M1CC 4FQQB 1HCVA 1ITBB 2R2EB 4HS6B 3UTPD 2C1PB 1XGPA 3KJ4B 4M8VA 3NA4A 5B39A 2Y06L 1FRGH 3QHZL 4OAWA 4ONOA 1OP9A 5HGGS 2Z35A 1IC4H 2QKIA 1DQLH 5E9DB 4OM0H 5DF0A 4L3EE 1NAMB 3O0RL 4KRPC 4EQ2A 3FHAA 3RA7L 1QR1A 3MX0A 4G6FD 1G7HB 5DZLA 3VXOB 3ZDYE 1D9KC 2K7QA 4JDZA 3T77B 4HUVA 1RHHB 4PIRF 4R3SA 2EZ0D 4ODBD 4QRPB 1JWMA 1EXUA 3ARWA 4NKDB 1YYLL 2ITDB 5TJWK 2D7TH 5DJ2B 1WIPA 3FOLB 4XC1H 2Z93B 3HE7D 4LSVH 4GFTB 4KMLB 5D5MF 5CKAA 3V5HA 4MNGA 2EDOA 4NO3B 4LKXB 1HXMA 2F58H 1EEYB 2H2PD 4Z95L 2XT1B 1TVDA 2R56H 3W2DL 3V6OC 4DK3A 5HYIA 2X9YA 4ZPTB 1I9RH 2F53B 4UUJA 2EDNA 4P2CG 1LGVA 5I8KH 4E42B 3GMPB 3QWRA 2ARJA 3A6OA 3K1DA 4OJFL 1GZQA 4JM2B 2E7LA 4F3FB 1JYNA 3THML 5HHOA 5E2TH 1V7NH 4QHUA 5E8DL 1HZHL 4G6KH 2GK2A 2ZUWA 2NXYC 2RB8A 2QSTA 3WO4C 2UYLB 5BQ7B 3L95B 5D9SB 1S7QB 2VLJE 4UDUA 4FMFA 2R8SL 4RISL 2VDPH 3AS2A 4XVSL 3MRBB 2VXSL 2H1PL 3D0VB 4WRLA 1BD2A 3PL6C 3HMWH 1YY8B 2CR3A 2WAHA 3QUYC 2OSLB 3WFHB 5IF0B 1T1ZB 4JZNB 3SCMB 4ZUWA 1I7RA 4R7NB 3MJ7B 3GSVB 4QTIL 4R7DB 2XWTB 5BOPA 4XTRC 3PP4H 4WFEE 2YPLB 4MJ5A 4MVBC 5EOCL 4NNXB 2GCYB 5KS9B 1QFPA 5DJZB 2EXWD 1OAKH 3L3IA 4HIJA 1DBKL 3L7EA 3SDAA 3C8KB 1WTGT 4M6NH 4ODTL 5F1NA 2WUCH 5L88L 2ZUSA 3GHBL 3DECA 4YNYA 3NN8A 3G5VB 3IJSB 3G6DL 4FP8L 2X1PA 4PJBA 3ALXA 4O2FB 1ZXQA 2OL3A 3TH3T 4ZNEA 1JWSA 2MQ0A 3DVGA 1L9NA 3T1WA 4OFKA 4TUOA 3WS3B 5IV2B 4NIKB 3N9GL 4I4WA 3VG9B 4QF1A 3EFDH 4IRSB 4WFGD 1U6AL 3T0EA 1DN0B 1RJYB 1AHWA 5DQ9A 2FIKB 1L4IA 5J6HA 3FZUD 4HWZB 2VLRA 3QUZB 4YGAB 5E6IC 4JO3L 3F7YA 5ENWA 1NFDA 4H8WL 4JVWA 5AZ2H 3TCXA 5JA8B 4HGWB 5F44A 5FO7A 4N90D 3VD7A 3NCYS 2YA2A 2VQUA 4XP9L 4EN3C 3MV9D 3DJ9A 3H9HB 4KV5F 3TZVC 1BVKB 2HFFB 2HVKB 3SKMB 4LIQH 2EDTA 3VD3A 4XGZB 1GGCL 2ZJSL 2CGRH 5I9QC 4LSSL 2FH8A 3VGAC 2X70B 4WU7B 1YMHA 3F58H 4AIZA 4RBPH 5EU5B 5JZ7C 5B22A 4Q6IA 3GKZA 3ZHLA 1U3ZA 2EEDA 2NY6B 1Y18B 2Y07L 3QEGL 5MP6L 1ORSA 3DNKA 5C92A 3BPCB 2FYYB 1E4WL 4I3RL 2WIMA 3QUXD 4QHKJ 3GIZH 4BH8A 1JPGB 3WD5L 2O5XH 4RFEB 4HLZH 4JO1L 2EKJA 4ALAL 3Q5TA 4XT1C 3QI9C 5AAMA 3GSQA 1FCCA 5I6XC 5C9JB 3P9LA 1QRNB 1NMBL 1S9YA 2NZIA 4ZPVA 1B3JA 4WO4B 1CTNA 2UWEE 2FGWH 4X6DB 1CXEA 4R2GB 3G5YA 4KKLD 3KXFD 2HVJA 1KEGH 5E2JA 3NIFF 5CIPA 4AQOA 3OKMA 2BDNH 1ZWIB 4JM4L 3O4LB 3S3SA 4DGIH 4KROB 3BUYB 1FORH 5C08A 5EZOH 2EKSB 3HRPA 3P4MB 2VZVA 3SE3C 1N64L 3BJLA 1ZGLB 1AD0A 1T04B 3IS0X 1I7ZA 1PYWB 2BXZA 3P9MB 4HZAA 4ETQB 4L9DA 4MCYA 1OCWL 1KTKE 4OI7A 5J9PA 5KG9A 1XCQB 3U4EA 1WWWX 3UTSD 3F7QA 3VXSD 3SJVB 1EMTL 4Y4KB 1MNUH 3GMNA 3O8XB 3ARRA 3O41A 4U4BA 1XGYL 4BQBA 1J0YA 3NZHH 4QXTA 5LG1A 4FA8A 4GMSH 5L8KB 3PHQB 3ARBD 1NGPH 5D2NB 5C9KA 3MTRA 1MF2L 4KAQH 3D1MC 1NMAH 1AI1H 4E41D 5EO0B 1KIQB 2XN9E 4I18B 3ZYJA 2JCCF 2ATPB 2JB6A 2IADB 1TZHA 3A0OA 2NY3D 1A6UL 5J8OA 1NC2A 1QHPA 2LVCA 3S5LA 3JV4A 1HEZA 3CNKA 3FB8B 2BHZA 5IBTL 2HLFD 4N0CD 5TF0A 3LQAC 3BO8B 4LSTH 2F74A 3GRWH 4UAOC 3LKQA 4G8GA 4NZJA 1IGIL 1FCGA 1FL5B 2OI9B 1P84J 4WHYH 3ZE1F 1U92A 4TUJA 3V4VH 4NSKA 1FE8H 1QD0A 2AXFB 1VFAA 3WFCH 3IRPX 3PWPE 4WI7A 1I3RA 5EN2B 4PJHE 2VKWA 5H2BA 3D69B 1E4XL 4EDXA 5ERWB 4Y16D 1OP5H 5D1XC 1FYHB 1KBGL 2QQQA 5I18L 1ONQA 2H26A 2AXJA 2WP3O 2J6EH 1FFPA 5L6YL 2X89A 4DQOH 3CMOL 4O00A 1G0YR 1I8KA 2AQ3A 2FJGB 3NFNA 4WFFE 5INDB 5A43C 3FO1A 1FFOA 4IIQC 4NQEB 4LLQB 4GRWF 3B9KC 3GO1L 3TVMC 2E7BA 2VDOH 4ZNCD 3WJJC 4HBCH 5D70L 3BD3A 3OAZK 4BYHA 4DAGL 4OLVL 4LDLB 1I8MB 4GRWH 4CVWA 4RQQB 5EBMA 4EEEA 2NY1C 1F11A 3F12B 1OB1A 4F57L 4M48H 4K9EL 2J2ZA 2V2TA 1LVEA 5FUOL 1N0XH 1R5VA 4X7TA 3BGFB 3BESR 3E6HB 5LGHL 4JPVL 3O6FB 4HZLA 2V5RA 4DEPB 1FC2D 3MRQA 3AB0B 1NJ9A 4EUPH 4JHBA 5EOCJ 5ANME 4JDVA 5GJSH 3VWKD 1MCNA 1BZ9B 2O61A 3P73A 5T3ZD 4NFDA 1B2WL 5C09E 2H41A 4ZUVA 1EK3A 3OPZH 5C0BD 2H32B 1QFWI 3MRNB 1AO7E 3EYOA 2IQ9L 1CD1A 3GZKA 3NGBB 4X83A 2IG2H 1QLEH 3RGVA 1JHLL 5I1JL 5KVMC 1UVQB 3JV5A 5DC4B 2ZCKH 3BT2L 1FDLH 5IR1A 4KHTH 2DQHH 4PJ7E 1UZ8B 4RAVB 1FZKB 2GJ6B 1LD9A 1KIPB 1XMWA 4O02L 4PJIB 4PRPB 4J1UA 1BQUA 3OXRB 5FHBH 2GSGB 1R5WA 4OF3A 1U36A 4R0LB 3D85A 2J8HA 4IRJA 4LSQL 4I2XE 4QXGL 1MY5A 5ESQB 4LRNH 1QP1A 1I1AD 3FQTA 3RZCB 2AEPH 4P2RA 3K7UA 3S98A 1NSNL 1S3KH 1RIVL 2Y1VA 4TOYH 2BNRE 1X5GA 5MENB 1EH9A 3A6BH 2CUHA 3WLBA 3CDGA 5JIPA 3DRQA 4PJAB 4XBGA 1UXSA 3MLRL 1K8IB 2W65B 4ELMB 5BXFA 3FT3A 1DQTA 1QOKA 1WQVT 2BP3A 1XT5A 2HWZH 3TJHD 5FM4A 2J8UE 3INUH 3E6FB 2Q8BL 5EC1B 2AVGA 3K80A 5DYOB 1U2HA 3QEHA 1HNFA 3SGDI 2GY7B 3DETC 4MHHG 1YJDC 3QHTC 4KRNA 5L7XH 4XPHL 2X40A 5E9DE 2P5EA 3PWJA 1ZE3C 3EYVB 1FYTE 4U05A 3VCLA 1OAYH 4Y4HC 3H0TA 4YDLC 5CEZE 1T7WA 5DK3A 3ALWA 1NL0H 3WBDA 3O6LL 3X3FH 1RZJL 2XNAA 4I3GA 2FR4B 1MCWM 4HMEA 3RDTA 4I13B 4JQXC 5MEOA 1U3HA 4FTVE 5F96H 4PUBH 5BV7L 1I75A 2NY4D 2GEEA 1IKFH 3W81A 3SDCC 1J05B 3EO0A 1RU9L 5HI5D 2F53E 1NAKL 4OKVB 5T1KA 3UTTD 1EAPB 1WFUA 5GGRB 5D7IB 1B6UA 2YHGA 1TVBA 1G7JA 1LO3L 1UWGH 3IFOA 5DEZA 5GHWL 4EXKA 4ZO7A 4XVUD 1DVFD 3PE9A 1WZKA 3DV6B 3C9NB 2HN7B 4Z0XA 2Y7QB 1JNLL 1INQB 1T4KA 4LSPH 4MX7A 1G9EA 5I19H 5I1GL 4NQVB 3ARGA 4Y5XB 1DANU 5D4QA 5FYKE 1LP9E 3JZ7A 3K81A 4L9LB 1AQDA 4M6MH 4JO2L 3LV3B 3HUJB 2ENSA 1M71B 3PJSB 4MB5A 4EVNB 2OTUB 4NRYB 5HDBF 3QQ4A 2X7LA 1RUAH 3FCTA 2YZ1A 5FM5M 2AABL 4BFGA 1UG9A 4P99A 1A3LL 2YPLE 1OAUL 2LFGA 3QCTH 1CXKA 3TBWA 3BQUD 2QHLA 5KS9E 2A1WL 1WZMA 1MIML 3NCYP 1NCAL 1NGWB 5IROA 1BFVL 3MCLH 1IAKB 4M1DH 4TPRL 1FG2B 5D1QC 1GC1L 5HGAA 2OR8A 4HPYL 5DEFA 1Q9KB 3QUMH 1OLLA 2R0KL 5DMYA 4PJEA 4PG9A 2AW2A 3BN9D 3BH8B 3MRLB 1P4IH 3MBEC 3TFKC 2EDDA 5IB4A 5IVOA 5HD8C 4F7PA 1RUKH 3U9UB 3IDYB 4PRBA 3G6JB 5EIQA 3VH8A 3S37L 1C5CL 1VA9A 2AJZA 1T22B 1J1OH 2HRPH 2D31B 5A2KH 2IQAB 1IGJA 3QG6B 4M43L 3B6SB 3CZFA 2ESVA 2MQ3A 2BNUB 4FZEL 4CVZB 2PNDA 1JPFA 3PQYA 4HWBH 3RWIA 4FFZL 3QNXA 1P6FA 4IRZL 1CYGA 1FAIL 3LH2L 1XGTA 3OG6B 2V2WA 3IXAA 4V1DA 4ZO8A 1U8PA 4ZUTB 3A67L 4R8WH 5DJ8A 4JKPL 4O5LL 4TSAL 4HFWA 1HOCA 1AQKL 2WZPD 1WICA 1FGVL 2FZ3B 5FDYA 3KPNA 4DZBB 3HG1A 5AYQA 2AS5M 1UJ3A 4IOIA 4UTAH 3QIBC 4JO4L 1U8KA 5J3HC 4WUUD 3HNVL 3WUWA 5JW5B 3FQWA 4DTGL 2FLRT 4OLYL 5I1DB 3PWNB 4JN1H 4KKNA 2QL1A 2VXTL 5E8OB 2K7PA 3TBVB 3GIVA 4DVRL 5A3IC 3KLDA 2PYFB 4WY7H 2EDBA 5HYJA 35C8L 1QRNE 5ICYA 3ZT7A 4GG6B 5IHZA 3O6MH 4X6DE 5F8QC 5BS0D 5T3XE 3S6CA 4YXHL 4ZFZB 1T7VA 4LCWA 4B41A 5DD5H 2YC1A 3ZL4L 3UTOA 4JFEA 1MRCL 1LE9B 3O4LE 4LHUB 2HKFH 3DROA 1JRHH 5I2IB 5KSAC 4K3EL 3PNWB 3V6BR 1CICD 3MCKB 1AKJA 1JGDA 4GUPA 4K7PX 3O0RH 3ULSA 3I6GB 2L4OA 3V95A 3G04B 5FUCC 5HJ3A 4F9LA 4PYGA 4JZOB 3TO4A 4JR9L 3GMMA 1YYLH 2R4SL 2DLIA 3RWFA 9CGTA 5J13C 3EYSL 2AK4B 3HRZB 4J3WA 5HYSA 1N6UA 3RWGA 2ED8A 4FQXD 1XIWC 4X6EB 3KPTA 5D2NE 3O3AB 4KVCL 5T5NF 1KPVB 2ZCHH 1HDMB 3EHBC 4X4XA 1AGCA 1L0QA 4Z95H 4S1RL 1K2DA 1CD8A 3KVQA 1QFWL 3U46A 1S7XB 5D7LB 4XAKE 1MLCA 3VFOB 2ED7A 5D7KE 1CGTA 5D7JA 5J1AA 4HV8A 4S1DC 1MHCA 1YEGH 4K8RC 3THMH 2XTJB 3WHE1 3NCFB 5LQBL 4MSWA 1UC6A 4LVNC 1CDJA 3MXVL 1CE1H 4U1MB 5TPWH 4Z76B 4L8DA 1P4BH 5DUBA 4YAQA 1MRDH 3C5ZA 2R1XB 5FV2A 5EC2B 4LGRB 1NFKA 5IB3A 4R97C 3SE4A 4D9QD 4XVSH 2EDJA 1ZT7A 3MRFB 4G8IB 1PLGL 4YXLL 3HC3L 3KGRA 2A0LD 3BP6B 4M7KH 3HZVA 3F62A 4QRRE 4X0KB 2O5ZH 3DSFL 4BQCA 2BX5A 2VL5A 4BQ6A 4P57A 2PW1B 3GSOA 4MZ3A 4GH7B 4WV1A 4QRTB 4YHYB 4QTIH 3S34H 4U6HA 2Y5TA 2BMKB 1EHLL 5E56A 3GI8H 4KTEL 3GHBH 3SDDA 4XVTH 3L3OA 2D7QA 3FFCB 1MFAL 4PGCB 1BOGA 2R1YA 5HI4D 2X6MA 1I1FA 1JF1B 4OBSA 5DUML 1NBYA 1QLFB 4NC2B 3CCHA 5FO9B 4YJZL 3ULVC 3RVTC 1C16B 3GBML 1A6PA 4GRLD 3T1FA 1MQKL 1A7RL 4P2OB 4G80A 1H3WM 3KYOB 3UZQA 3IU4H 4JO3H 4PREB 5AWNL 3OR7B 4L8BB 1YECL 3WIHL 3FN9A 4FZ8H 1F5WA 3GSWA 3DGCR 4L4VA 5IW6A 5FECA 4XP9H 5HHNB 2D03H 3SY0B 5F8RC 1IEBA 2P5WD 2IBGA 4M93C 3OHXA 5IQ7L 3O2DL 3TBTB 2ADGB 3B8SA 5KVFH 1A4JA 1GYAA 1JIBA 3RL1B 3IDNA 3DX6B 1FVDA 3MNVA 1Z0NA 4NQTA 1A6VL 3U7AA 4CN4A 2BSRA 4FXLA 3QWRD 2GJ6E 4I3RH 1E4WH 5IIEB 4Q9QH 4PJIE 4PRPE 2XKNB 5DRXB 2PCPA 3VXTA 4F58H 5HHVH 1MWAL 4YHOH 5I73C 1BX2A 2DQUH 4AEIH 1H3UA 2R2HA 3RWDA 5HGDB 1BF8A 1K5NB 1IM9D 2CKBL 1BM3L 4BZYA 2YOCA 1RZGA 3FAXA 4WWID 3BX7C 2KH2B 4LCYA 3KDMA 1QG3A 3PHOB 4Q97A 4ESKA 2K9UA 1NDGB 2VR4A 1SVZA 4KQ3L 4OCLC 5MENE 1NKOA 3MV8B 1GPOH 3X13B 5LGJB 4PJAE 2V7NA 1JFQH 1CLOL 4UB0H 1KCVH 4QNPE 5C0FA 1MIEL 1D9KA 3EGSA 1S78C 1ZKAA 3MNZB 2FX7H 3LQAL 2AAVA 1L9MA 2Y23A 5L2KB 2R2BB 4YH6A 5TQ2H 4HIHB 1OCWH 2YSSB 4U0QB 1Z3GH 4ZSOE 2IMMA 4MQTB 2CIKB 3HLAB 4XPAL 4JRXA 5TH2B 5IFAH 1BFSA 1YQ2A 1HI6A 1XFPA 5F1OB 5MEQB 1XGYH 2WLZA 4G8FB 5B38A 4X4YB 3V6OA 1BJ1H 4CBPA 2DI8A 3T0AA 5IHUH 5HYEA 3PDOB 1MQ8A 4PJCB 1OSPL 4K8RH 4P4KA 4IOFC 4K3GA 5ADPL 4ODXA 3BDYL 1UJTA 5EPMA 1NDMB 5D71H 5GGRY 4XXDB 3HZMB 5EWIL 5ILTL 4MAYB 3T0ED 1S9XB 3KYNA 4R6UA 1MLBA 2VLRD 1VGKA 5DQJB 2VZUA 4LHUG 3LRSB 3TV3H 5JW4N 5LCVL 1MSPA 3T8XB 4HD9A 5C0CB 3O11B 4JAMB 4PRDB 4HPOL 5L8LB 2E9JA 3VRLE 5IVXE 3MV9B 5CCKH 1IT9L 5DD6A 3PL6A 4OV6F 3B5GA 5CZKA 1YA5A 5D7IE 1CL7I 3HC0A 5JUEH 1XR9B 4NGHL 3QG7L 3UJIH 3CLFH 5K9QI 2Z91B 2A9ML 3EZJB 1URLA 3RVXD 2AGJH 3STZB 4P46C 2EDXA 4QCIB 3DTXA 2MMXA 3JVGC 5E8PB 5GGQL 1CI5A 3HI5L 3D18B 2XXCB 5EZLA 1SJEB 3BIKB 5A1AA 4OD3L 1S7SA 1KPUB 3TGXA 1K4DB 1CBVL 1UM4H 1IC7L 1IBGL 2OJEB 2YS4A 4LBEB 2E3VA 2J88L 1H15A 4KJYA 1V7MH 1ZLUK 2XWBB 2DKUA 3HUJE 3CMOH 2YR3A 3U4BL 3ULVH 5I76B 2KUTA 3EO9H 5D70H 2FX9L 4YDIH 5I1KH 1NLBH 3IDIA 1IAOB 3MMEA 4LPTA 3LB6C 2VDMH 2J1KA 3H7BA 5HDQL 4OZGE 3T3PF 4C56A 2XG4A 4TTDD 4Y19A 1MPAL 4JQVC 4KK6D 4CMMA 1LHZA 4XPGH 3P2TA 5I1HH 3D87B 3IDXL 5C08D 4QXUH 1PVHA 3QQ9C 5JOPD 1H5BB 3VXSB 1P2CB 4JPVH 1LK3L 2GFBB 5CGYD 3LN5B 1HQRB 5GGVH 2YK1L 3KLHC 1XGRB 4XPFL 5GSVA 4EJ1C 4GMTL 1NGYA 4XMKL 5FKPB 1SYSA 1TXKA 1A6AA 2QQLH 4XCFL 3FL7A 5E2VL 3I2CH 3X11A 5FYJH 2R1WA 4XWOD 4KJPD 1XH3B 1X5FA 4PJGB 3TNNB 5ID0B 2Q76A 3JV6A 3NVQA 3WL9A 4E41B 2NY2D 3MLVH 3GM8A 1DE4A 2SEBB 2NW2A 2GW5A 1BFTA 4U7SA 3JTTA 3C5SB 1MRFL 4GKNA 5I1JH 5IOPB 3ZKSD 3RIFK 4XP6L 4PJ5A 5F88B 2NQCA 3MQIA 2WANA 5TE6L 1P1ZA 4YFEA 3GHEH 5FHAL 1QYGH 2OCFD 3IFNL 1NC2D 1IRAY 1NPUA 1EGJA 4YHKL 3WIHA 4F7EA 1JYVA 2GAZA 2HT4D 3KPMA 4OCXL 2IANB 5FDWB 4ZTOL 5C0NC 2A6JA 3ZTNH 4YO0A 1N5YL 1KENL 43CAB 1VESA 4ZAKB 2G60H 4L8SA 4OZ4A 2VLLB 3OB8A 4G8GD 2WM0A 5FYLL 1U8MA 1NCDL 3O2DA 4UT6H 1NSNH 4NHUA 2WQ8A 1ZT1B 1Q9WA 1FLRL 1NFIA 4NWTL 5HGHA 4Y16B 3VGHA 1RIHH 3DUUA 1IGFH 4GG6E 4CNIA 2V5MA 3BHBA 3QQNA 1HSAB 1U41A 4ODHL 3F5WB 1ZSDB 4OF7A 2Q8AH 3S96B 1I8IB 1FO0B 2VE6B 1VSCA 3RX8A 4TYUA 1SEBA 4NO0A 1AD9A 1MWAA 2LE9A 2AXGA 5GGSB 1MCEA 5EZIH 1F2QA 1YQVL 1RFDH 4HHAB 3RY6A 4XPHH 4LQFH 5IMLB 4NQDB 5HPMB 2CKBA 4I3SL 3C6LC 1N3NB 3Q48A 1EO8H 3L3KA 5AZEL 1E28A 3MGTA 4GS7B 4QLRA 3OJ2C 3BPNC 3WSQL 3EOTH 2BRQA 2EYTB 5DR5H 4U1HB 3IXTA 3QNZB 4JRYB 4TNWK 1S7VB 1MCIA 5BW7A 3EDEA 2AK4E 3HAEB 4L29A 5BV7H 3CMGA 4DGYL 3C6SB 3SDXA 4RGNE 3GMRB 3F65A 5TDNA 5JOFA 5JHDA 3BZ4A 4XNYL 1BBDH 3KG5A 2EYSB 4W4OC 1ZHKB 5D72L 3BZDA 5F9WC 1C5BL 5CWSB 2JF1A 1NGZB 2RHEA 3P4OB 4MLIA 2Z0BA 3MACH 5F3BA 4BSWB 4S2SB 5LAXB 5C0BB 1J8HA 5L0QB 2XTJE 4NZTH 4WIQA 3BOVA 3CX5K 4RWYH 1EVUA 2BFVL 1W0YT 2PXYC 3GMLA 5D1XA 4HT1H 4OM1H 1T0NA 4WWKD 3HCVB 2D0FA 3IDMB 5IW1B 5I1GH 2AJXL 3KAAA 4OGXL 4NDMB 3WUZA 4PS4L 3LZFL 3B9KA 5EUKA 1MUJB 3IB4A 3WJJA 3V7MA 5ESVB 5AEAA 1IQDA 5CP3H 1M7IA 5BOZG 1JWUA 3EO1B 3ZKND 3OX8B 1SMOA 3KPLB 4XMLL 5GRYA 3IJYA 1I1AB 2ICES 1DBBL 4NRXB 4U2ZA 1OAUH 1NEUA 2BCKA 4IRJD 3I02A 1T66D 2A1WH 3RBGA 1T83A 4PRIB 5DVMA 2WIIB 1MIMH 4P9HC 3SGEI 2H8PA 4P2RD 1BFVH 3UCRA 2R4RH 4HX1A 5EB9A 5D5MB 1S9VB 1MCDA 2X4NA 3MBXL 4ZYKB 1A2YA 5TF1H 2WSKA 3FFCE 5TDOB 4HPYH 1U8OB 1MELA 4NO5B 1XGUB 4LEXL 4CN1A 1S7UB 2OS7A 1HKLL 2R0KH 4ZS7L 1H9VA 3LHPH 1EJOH 5I1AA 3UTPE 2BERA 2J12B 4ZS6D 3U9PL 5FB8B 1CFSA 2ZPKL 2NZ9C 3ARDB 3OQ3B 4MD0B 3RP1A 3T0VA 3VXMB 4EDWL 1JZ6A 1UB5B 2E9BA 3ARFB 2X4PA 2LAGB 3ARQA 1H3VA 3C5JA 1JF6A 4WHDA 2JB5L 3LIZL 4LLWA 1PG7H 1REIA 2P5ED 3FT4A 2CXGA 1TJIH 1T03L 3GSRA 2D0GA 2H3NB 4Q9BA 4EI6A 1WC7A 2VUOA 2NTFA 4D0DB 4EOWH 5KSUA 3RNQB 1JZ2A 1KN4H 4JPKL 4ZFGH 5DSCA 2DQJL 3Q5YA 3JV0A 3OKNB 4YX2L 4HS3A 5I15L 4FQ2H 2R0LL 3ZYOA 2EIZA 1LO4L 2NY4B 1M1SA 4RDQG 4BQ9A 1A6ZA 4MXVF 3BGMA 3RDTD 3QXUA 1TZGL 5JHLH 3WXWH 3EFFA 1CDUA 1U3HD 3OAUL 2HT2C 1X5ZA 1F00I 2YKLL 4K94C 1DBJH 4N1EA 1F45A 1CL7L 4RFOL 1BVZA 4EBQH 3A67H 4H88H 3SBWC 2RCSH 1XR8B 4YPJA 3T08A 4J3SA 4TSAH 1UM6H 4LDEB 3MJGX 3TPUB 3KYMA 3MRRA 2OQJB 3NBNA 1WBXA 1F8TL 3T4AA 3OKOA 4G9DB 3L9RB 2WBJC 5T1KD 2RIKA 4P48A 1B4JL 3REVA 2ZSVB 3NOIA 1DUYB 1DVFB 5C8JB 4LF3A 3EYFA 4G9FA 2LU7A 2X4TA 1L7IH 3DBXA 3MRIA 1CLYL 2UWEF 4OLYH 1IQWH 4AEFA 5D7SL 2VSCA 1T20A 4JFFA 3HNSL 1IJ9A 4NYLB 3WN5A 2VXTH 2Q86A 3L3GB 5ABDE 5CZXC 2CLRB 2EEBA 2PTUA 4APQA 1QQDB 3QUKA 1QFWM 8CGTA 1OGAA 3ARGD 3PGDA 1JMXA 2ZG1A 4MJID 4WCYL 4YZFE 3QIWB 3X12B 5FGSA 4PJ9C 3B9AA 4NRZB 2PTTA 5FYKU 4OZHE 4L8CA 1IM3B 3ZSSA 3MV8E 3OZ9L 3L7FB 4LSUL 2DIBA 4QOKB 2IFGA 2V2XB 1SVCP 3SGJC 3C87A 1UXWB 2R69H 1VFBB 3I85A 3MRJA 5EUOF 4JQXA 1VPOH 3FQRA 4OZFH 3W0WD 4HK0A 3D0LB 1RIUH 4KK5D 1A9EA 1KN2L 2FX8L 4OSUL 2E5EA 3P11L 4JPWH 3FOMB 4NC1E 4PJ8C 5EIIB 1TZIA 3SDCA 6FABL 3EYSH 1IAII 2XKUA 3QDMB 5DEGA 3PGFL 1FV1B 3KJ4C 3LPWA 4PJCE 2ADJB 4GAJL 4KJWD 2XZZA 3QIUA 4WFGE 5BRZA 1MJ7L 4PTTB 5FA3A 2H6PA 3QCVH 1XGQB 4KZEL 5EORH 2Y6SC 4X7SL 2I5YH 1Y0LA 2FJHB 1KCRL 1A6TA 1HH9B 5ITBL 1Z9SA 5GZND 5B3NA 3AMLA 4KPHL 2XQYK 3IFLL 1LO0L 3O6KH 1EEZA 1UM5L 5IMMB 2QHRH 1T3FA 1KCLA 2ZKHL 5I8CA 5HY9A 4BQ8A 3CPLA 2HFEB 3MV9E 2PR4L 5F6HI 5I74B 2FD6H 2G75A 4NCC2 1T5WA 4OQTH 5BVJB 3MJ9H 2X09A 5DFTA 2YPKB 3U6RB 4XCYA 4YXLH 2E8YA 3QNYB 1AFVH 4V1DD 1BP3B 3U83A 3MRKA 3DSFH 3WXVH 3HAEG 4P9HH 3DO7B 4JM2C 1KB9K 5ICXB 4H1LA 1U3YA 3V2AR 3PWLB 5FK9A 3WIIL 1JI1A 2VWEE 2IC2A 1FPTH 4WUUB 3RWJB 3HG1D 4AQ1B 5D1QA 2XA3A 3HTLX 2EE2A 1PGRB 1Q38A 5J1TC 4PRHB 1FJ1A 3OXSA 2J4WH 2JJVA 1BVLA 4Y1AD 3RX5A 1WZ1H 2ADIB 2NXYB 5C0RH 1KNOA 2ENYA 3OR6A 5IB2A 3S88H 3LKSB 3RTQA 1F3JB 1FL3B 4RBPK 4M5YH 3MOAL 1YPZE 3SCMC 1G7LB 1YN6B 4HIEA 3ZKMC 2VDKH 4LCWD 2E6PA 3GBMH 3QUYB 3NCEB 4OCRH 1E6OL 4BM7A 2D4DA 4AG4H 5T1MB 4JFED 1XZ0A 5LXGL 2H2SC 3U0WH 4P3DB 1DQML 4YBQD 4LP5A 2FEEI 3UTSE 1F4XH 1EFXA 4UQ3B 3W39B 3VXSE 1AKJD 2IBZY 4OUUA 5DS8A 2RR3A 4MD4B 1A1NA 1BQLH 3ZKQD 1Q0XL 4GOSA 3TO4D 4XBPA 3MV7B 4OLWH 1A7PH 4NZRL 1QZ1A 3GBNH 1U91A 2B1AL 4PJGE 4YR6B 1GOHA 4I77L 1NCCH 4M6OH 4NKOB 4IRSC 4E41E 4RGOL 2F54A 3MLUL 4HDIB 1J10A 3BRDA 4ENED 4K3JH 1FZJB 1U58B 3N50A 5C07A 3VFMA 2YD3A 4Z7VA 3K2UL 2WBWB 2IAMA 2Z92B 1MREL 4J3UA 1MAML 5I1CL 2W07A 4GRWB 5D7JD 2Z31A 1MVUB 3MRHB 4WUKL 2RQ8A 5E6IB 1R3HB 4Z0BH 3SKOB 3BWUC 4RIRA 1A6WL 2ZCLH 3NFPA 2IANE 4O51A 4ZUUA 5IB1A 3I3DA 5KSVA 4Q9RH 5F97E 1J1XL 4K3HA 5T33H 3DI3B 4LAQL 5AUMB 4QTHA 5IEKA 1BM3H 4GLRI 4EN3B 4YHNA 2NLJB 4OGZA 4YPGB 1CR9L 3TZVB 1QKZL 1UH4A 5EOTB 1A14L 1CG9A 2NY6C 5C70A 3IAPA 1LEIB 5KSAA 4EUPB 3QJHB 1CVSC 2GKIA 3H9SA 2ORBH 4GKZB 4LQ1A 3FFDB 3CLEL 2QR0A 1PY4A 1IGML 2DI7A 3C60B 3VDCA 3GMOA 3FRPG 4AJ0A 3CFEA 3HI1B 1KYOK 3WMSA 2BNQA 2P24B 4WO4C 1DEEB 4KQ4L 1XIWA 4R2GC 2HKHH 3BZFB 1KSRA 3QI9B 5JW4Q 3SDDD 3GKWL 2EC9T 3P77A 1G9NC 2I07A 3VE0B 3MA7A 5DDHA 4UI2A 5BO1L 5E70A 3GJFH 1OP5K 4QRQA 5E00A 4KROC 1F58L 25C8L 2DTMH 3B2UC 4P23A 2YPVL 4JRYE 5ADPH 5JW4R 3BDYH 2MPAL 4IS6B 4MLSA 3F7VA 2FJFB 2QKIB 1Z9MA 3B43A 4I0PA 3AS0A 2DWEA 5DLML 1R3LB 4KTDL 3IFPA 3L5XH 1VKXB 1YNTA 3KS0H 2I9TA 5IG7A 4ZOBA 4Y4KC 2DQCH 3O8XC 4K3DH 1SJHA 1V3LA 1R24B 3DIFB 4NKIL 4PV9B 5DI8A 3DMMC 1HINL 1T21B 1K3ZA 1AY1H 1BIIB 5T3ZE 4LLMA 1JWMB 2P5WB 4FRWA 1QSFA 1V05A 3AU1B 3DX9B 5D2NC 1YNLL 3RQ3A 3ZHKA 1MFDL 4JG0L 2CK2A 4YHIB 3HPLB 5C2BL 5C0BE 4AEHL 3V5HB 4ONGL 3VWJD 4OLUL 5J06A 4PP1D 4Y5YB 3H9ZA 4I18C 1LP9F 2HJKA 4PJXA 1MCCA 5JO5A 2FEDD 4UUJB 5FOBB 3O9WA 1FZMB 5FYKH 2W0PA 4RGMB 1GZQB 4YIQB 32C2A 3MO1B 4PGBA 4HLZG 1MCRA 3FTGA 3RNKB 2VITB 2FWOA 3HI6L 3QWOA 1RUPL 6CGTA 4ZUSA 1KLGA 4XCCH 2OI9C 3V52H 2BZDA 1LK2A 3U4BH 5D1ZA 2NW3A 5EA0L 1IM9B 4DCQB 1RZ7L 4U1GB 3TJEL 1RI8A 3DV4A 2FX9H 4UILH 5DRNA 4UAOB 3MNWA 1INEL 4G8EB 2QQNL 4KUZL 3BP7A 4KJQD 3ZDZF 3TEUA 4PRIE 1MH5B 1B0GA 2G2RB 3OB0H 1ZAGA 3MRPA 1OARH 5D5ME 3W5MA 1YEKH 1I7RB 4PTUB 4F80A 3B8YA 4KRPD 1A7NH 3MLXH 3VFTB 1YMMA 1RV6X 5F7DA 4YQXH 3SGKC 3CFJA 3IJHA 4Y2DC 1NGXB 1D9KD 5HI3D 1IAIL 5CEXA 1LK3H 5JR1L 3VXME 5F1NB 2P8PA 4GMTH 3U30B 2R29H 3WFBL 4Y5VA 4IIQB 4JRXD 4NOFA 4XCFH 3C08H 4U3XA 1L7TL 2LU3A 5ID1A 4LARL 2ZUYA 1FNGB 3UPRB 4FQJH 1YN7A 1RZFL 4P5KA 2EE6A 2BVTA 1G84A 4K23H 5TE7L 1F4YL 3OKYA 12E8H 4P4KD 5I0DA 5DQDL 1IL1B 5D2LF 2M1KA 1X7QA 3EOYG 5DQ9B 1X4XA 5J6HB 3O6FC 4DEPC 3JSSA 4M62H 4AIXA 1QBLH 5CBEA 1PQZB 1IZJA 5TE6H 3AB0C 3CVHH 4OIIL 5DK0A 3QWQB 4GBXA 5EU6A 3UTTE 1EZVX 3HZYB 4WHYG 5IBUB 2ATKA 3OTTA 5F1IA 3BZEB 4B53A 1KENH 3QQ3A 3QUMB 2IH1B 1E27A 1KTDB 3KJ6L 5BVPL 4YHMH 3REWA 5E2WL 1I3VA 4JFPB 5BZWB 1JV5B 2R2CA 4GJTB 3NFSL 1MFCL 1R5IB 3CFBB 1J9CT 2VXVH 4AIZB 2R0WH 4Q58C 2ZP0T 1U95A 1PBYA 2W0LA 5E8EB 4KVNL 4K07A 2N7AA 4QHLA 1QBAA 2Z8SA 4ODHH 4Q2ZB 4MCZA 3CFKB 1G9NH 1TJHH 5KVEH 3ES6A 5L9DH 2XY1A 5C0GB 4R0LC 1GGYA 3F8UB 2ZG2A 2X4QB 4MNQA 1A8JH 1HH6A 3WS6C 5ISZB 3F6IA 5HGBB 4GKSB 5A2LH 3P9LB 5C6TL 4IBLT 4ZPVB 3WLWC 1A0QL 3OJDB 4I3SH 3HHRB 4X99B 4OFPA 2IF7A 4G6MH 4LIQE 3S8WA 1KT2B 3VFPA 4F9PC 4DKFL 2FEEL 5GRVK 5EO1B 4NO2B 1JGVL 1CGSH 1JUFA 4ERSL 4KV5E 3QO0A 5HDLA 4KDTA 4OZIA 2AV1A 2A73B 2AEQL 3QPXH 4QWWD 5GSRB 2P8MA 2R39A 1I3GL 4OLZL 5E1HB 4C56D 4Y19D 1QFUL 1NUNB 2A74B 4DN4L 4EI5C 1JBJA 3CC5A 5DHVA 3U7YL 1OP3H 2IWGA 4XC3L 3TWCL 3KLSA 5E5MA 3U4EB 4OCSL 3HNTL 2MJWA 5D72H 2CRYA 3TA3A 3HZKA 1GIGL 5SV3A 2HMIC 4LPCA 1BHGA 1OAQL 4ZO6A 4D2NA 4Q9CA 2XQBL 4CU7A 1P7KA 3UC0H 5DJ6A 2LVEA 4NQSA 3VXQB 5LWYH 3PF2A 2NX5B 4NKMA 3JVGA 5IWLC 2Q7YB 2XFXA 4LNRB 4MXQC 5KANG 3ILQC 3O2VH 1CF8L 2BFVH 4O58H 4AMKL 5IK3A 1S8DB 4Y4FA 2X1XR 1EHXA 3DVFA 1MFBH 2X4OB 2DQGH 4BA8A 4KK8D 3NIFE 4MA7L 15C8L 1RK1A 4U1LB 3V0WH 3TLRA 3GGWA 5J11C 2MWCA 4GW4B 4PJ5D 4OCWL 4PS4H 3TCLB 4OGAC 4HUMB 4JFHD 1U93B 1F6AA 4JFXB 3IGAA 1Q9LA 3NZ8B 4U6VL 3HN3A 3IETB 3OL2A 4XMLH 4HFUL 1GVIA 1JGUH 3KR3L 4WUUE 1T1YA 2HTKC 5IKCA 1HHIB 3DWTA 1WBZB 5CJXC 1PKQA 1XCTB 1NCWH 4C83A 4JQVA 1KC5L 1WITA 4U6XA 1AGDA 1I3RB 4HKZA 3SO5A 2BVOB 3LS5L 4OKDA 4K94L 2H9GA 4WNQA 2V9RA 2BXYA 4L9LC 5BS0E 4LEXH 4MD5A 1M6OA 1HKLH 2XWJA 5CINH 3SQOL 2ZUUA 1SBSH 2UY7A 1ND0B 2JCCE 5HHQA 4YHZH 2ZPKH 4Z7VF 3UPCA 3LKOB 1CIUA 1I8KB 3T04D 4E0RA 3UBXB 3NIDE 5EZJA 2CSPA 3EYQC 4GAYA 4JHWL 4AL8L 4XVJH 2ZOLA 2FO1A 4PRNA 5ALBL 1HQ4B 4HC1L 3LPGA 4MA8L 3JWDC 5DWUH 5ACZB 3LIZH 5TFSL 4PB0L 5DMKB 3JWOL 3S7GA 3DHMA 4HUXA 2L7JA 4HW6A 5SX5H 3MOBL 5ACLA 8FABB 4DKDC 3ZE1E 1D5BA 5GGTH 4K7FA 4XAWH 1LO5A 5C6WH 4JPKH 4X80H 2RGSA 3D9AH 1EVTC 2V2TB 2ZUVA 3S36L 4R4FH 4N0FA 3OAUH 3C2AH 3DARA 4A6YL 3CSYA 1DLHA 3IDYC 3HS0B 2C3GA 4JRWA 3X3GL 1F90L 2YD2A 5GIRA 4R96B 7FABH 1CFVL 1LE5A 4ZTPL 3BPLC 3R1GL 1Z2KA 3S35H 4HAFA 5MHSD 1CU4L 2IGFH 1HYSD 3SKJH 4NBYB 1TMCB 4LK4A 5ADOH 3NA9L 3K8KA 2UVFA 5HVHB 5K9OA 1UWEH 3GUTB 1CLYH 4NBZB 4S1QL 4WWKB 2XZQL 4D9QE 1ZTXH 1KFAL 1OTUC 4X9HA 3MA9H 1NBQA 1W8NA 3T0DA 1F4WL 2CK0H 3OKDA 4BH7B 3QULA 4IEFB 1B0RB 4HULB 4OFDA 2BY2A 4TUKL 2A6IA 2VDLH 2F5BL 2CDFB 2M2DA 5FF6B 4P3CL 5CEZL 5KVDL 3C6LA 2XZCL 2KQNA 1ETZA 1AP2B 4JVPA 5F6HJ 5E8NB 1K6QL 5CSZA 3V4UL 3CX2A 3BP4A 2DYPB 2ZOKA 4PY7A 1BWWA 2DMBA 1DZBA 5IQ9A 3KPSA 3LSOA 4I48A 5IBUG 5TE4L 3QIBB 1JHKL 4PJFA 5ITFA 5EO9A 4XCEA 3L5WA 1QBBA 3P11H 4M3JA 5DZOA 4W4OA 5GISL 3HB3C 2EH8H 4CADB 5ESAA 4QHNB 4ZXBC 4GAJH 4B50A 4P0DA 3U0PA 1SJXA 4KI1A 4LCCB 1JHTB 5B8CB 3RGHA 5KTEL 1Q9OA 1KJVB 4ELKB 3SE9L 4RMRA 5GRWA 4KZEH 4HK3N 1GJIA 5TGBB 4Y89A 3ROOB 2P5EB 3ELAT 3V0AC 1FL6B 3VRLF 3VFVB 4XP4L 3RBSA 3VCLB 1UM5H 2XOTA 1G7IA 4OI8A 1GCFA 3BYYA 2ICEA 5IEHB 1FSKB 1KPRB 1MJUL 3QDJB 2YA0A 2P5WE 4EIGB 4RGNC 1GGTA 1K8DB 4I1NB 1U3HB 1E4KC 1V8HA 2MKLC 2CLZA 3SDYL 2UZIH 1RK0A 2HG5B 5J13B 5E24E 4Q0XH 2BHYA 4WEBL 2KL6A 2PYED 2Q6WB 4GRMA 1CT8A 3OGCB 4Z78A 4M1GL 5EU3A 5KN5A 3FO9A 4LLAA 3L6FA 5IMKA 5HYQA 5GS0H 4MQXD 1R6VA 2AJSL 4HKXB 3BSZL 2XTJC 1MCFA 3HR5A 3M17B 4JJ5B 5TQ0L 3BKCL 1HE7A 3N85L 1TVBB 2FSEA 1JGLH 3FB5B 5KW9L 2CDEA 5DD3H 1ZVSA 5HHXL 3SHSA 3QXDA 4G9FD 1XEDA 4ZMAT 1D5MA 3VG0L 5EBWA 3RAJH 5AD0B 4JFFD 5DMIL 2MCG1 3ARGB 3M8OL 4MJIB 4APQD 2R0ZL 1PX4A 4QXWA 2APTA 3ECBB 1I9JH 3JWDH 2XY2A 3SPVA 1OTSC 4NQCB 2BY3A 4UTBH 4WI9A 3DSNA 4YHYC 1IGYA 4OV5A 2VC2H 4LPUA 2PKDA 2O93L 3QQ4B 2A6KB 4UZGA 2D9QB 4YFLI 3S5LG 2DAVA 2DWDB 2X4RA 3FONB 2W0KA 3D39A 4PR5B 4X5XB 5FUZH 5H94B 2QSQA 3MUGB 3W0WB 1LEKB 5JNYA 1TCRA 4AENA 1P7QA 1BEYL 5FYLD 3FQNB 1BJ8A 4FQHA 2W0FA 1A1OB 1D5ZB 3EAKA 3V9FA 4Z77A 1I8LC 2L7UA 3SBWA 5ANMA 1A5FH 3BEVB 5D8JL 5FGRA 3SDCD 5CBAA 3STBA 4HXBL 1YEIL 3G5XB 3U7WL 1JPTL 2HJFA 4RGOH 5FOJA 5T5NG 4X6FA 5C09A 2CXKA 4O9HL 1QA9A 4P2OC 3JBG7 1CLZL 5GGUB 2APXA 3NABL 3QIUD 2MQCA 5BRZD 1AO7A 1U3JA 5CJQH 3RUGB 3WJLA 3T0EE 4LU5L 4TSBH 3TM6A 3I6KA 4U1SA 4F2MA 4GAGH 3ET9F 4HC1A 2VLRE 3QH3B 4M5ZH 5F93C 5CZVH 2AJZB 1EERB 4N9GA 1UQSB 2B2XH 3UBXG 4DOHB 5C0JB 2EC8A 2EE3A 5T3XL 1HHGB 3WDIA 4F33B 1C8PA 3HE7C 4HQQH 1EUTA 1JE6A 1P9MC 3CZFB 1U8IA 4YBLB 2H2PC 3MRMA 4GXVH 4OZIF 5IB5A 3H3PL 3LEYH 3E8UH 1ZEAH 4P59L 5F89B 1CR9H 4O4YH 3UJJL 5DJ8B 1CQKA 4XWGL 5J4MA 4DN3H 5DJCB 3SGEH 5GS2H 1QO3A 4X98A 3HG1B 1QACA 4X6CF 1AE6H 1UJ3B 4IOIB 2VZ3A 1K9TA 3RZWA 3MREB 4D0BA 5K9KB 4YDJA 4HG4K 1XF5B 5BMFL 4Y1AB 4PB9H 2J8UA 4JKMA 1RZ8A 1KXQE 5IESH 2YUVA 4DKEL 1S7TB 3M45A 4FQQA 4GAFB 2R2EA 4HS6A 2C1PA 1M7XA 1ADQL 1EUUA 2AJ3A 2DIJA 3GKWH 3X14B 2JKXA 5HD8D 3MODH 5C0IB 2EDYA 4OCYL 3RTQD 1NANI 4LLDB 5FGCB 4BZ1H 3WHE0 1NAMA 1YUHB 1FH5H 5DJAB 4DW2L 1F58H 4XXCC 1NEZA 1BQHA 1FG9C 2XV6B 1G7HA 2EXWC 3VXOA 3ZO0A 2MPAH 1KCKA 3T77A 1RHHA 5C08E 3RU8L 3L3HB 4QRPA 4IHOB 5JOPE 2DQIH 5DLMH 4NKDA 4N0YL 2ITDA 4KTDH 1UCBL 3PDGA 4NFBA 1AKJB 5DJ2A 3FOLA 4TSCL 3KPPB 2Z93A 1EFXD 1YYML 4KZDH 4NC1C 4AY0A 4NO3A 3TO4B 1EEYA 3ULUF 5DRWB 3UJTL 4G5ZH 3WO3B 3QFDB 3RWFB 1ZA6B 2F53A 2WWMC 1YNLH 4ZPTA 3S4SB 2BHUA 4WHCA 4E42A 2NX5E 3GMPA 2B7DT 1JTTA 1CFBA 4AEHH 2AJYH 4JM2A 4ONGH 2NR6D 4OLUH 4Z7WF 3ULUH 4JHAH 4F3FA 1V3MA 1MCPH 1DLFL 1IAIM 1SEQL 4Z9KB 3RX7A 1G7PB 3U46B 1FBIL 1OOAA 2UYLA 4PGDA 5C07D 4FQIL 4S1SL 5BQ7A 1IFHL 3L95A 1S7QA 4L3EB 5D9SA 1DDHA 3SE8H 5ICZB 2IAMD 4NN6C 3MRBA 3D0VA 2Z31D 1FVCB 5MERB 1KTLB 1MI5B 2OSLA 2VLMD 3WFHA 3MOQA 5IF0A 3V8CA 1T1ZA 2ADFL 3NH7L 4JZNA 5EA0H 3SCMA 4G8GE 1RZ7H 4WW1B 4X5WB 5LGKA 3MJ7A 2Y9RT 5BV7B 5IB3B 3GSVA 4D9LL 2XWTA 3CFDB 1TNMA 5DHYA 4R4BB 2YPLA 2HLAA 2GCYA 5JXED 5KS9A 1CDHA 5DJZA 1OLZA 4YXKH 3VA6A 2F54B 1EBAA 3STLB 2B4CC 3C8KA 3QUXC 2IFFL 2VWEC 3RJDA 3MR9B 5KSAD 2W9LA 4FNLL 4IMLB 3G5VA 3H9SD 3IJSA 4FQCL 3T2NH 4JKKA 4HUWB 4O2FA 2Y5TB 4BKLB 3BN3B 4BK4A 4L4TA 1LDPH 1DSFL 4NUGH 3WCYA 3WS3A 5IV2A 3WNMA 3KPRB 1W72L 4FABL 2YUXA 4MGXA 2VLJB 4KKLC 3CK0H 3SDDB 3U0TB 2NY5C 2BNQD 1ZV5A 4IRSA 3QR2A 1TQBC 1DN0A 1RJYA 3DX7B 4LCIL 2FIKA 5F1SA 2CMRH 4HWZA 5E1AB 3MV01 3OWEA 3QUZA 1RZFH 2KDGA 3VI3E 4TN9A 4CRPA 3GSNL 3BWAB 3EOAB 4OD1H 3OJVC 4HGWA 4P23D 4S1DD 1ZA3B 4LKCB 4G80B 1KELL 1BQSA 2OX5A 4I0PD 3RWEB 3H9HA 4KU1A 4OFYA 4TRPL 3EUUA 1BAFL 2HFFA 2G5BB 2HVKA 3MXWL 3SKMA 5C0EB 3GSWB 4JHZA 2X70A 1AR2A 4WU7A 1HIML 5EU5A 2QQKL 3VWJB 4HS8H 4M7ZC 1QSFD 1Y18A 4XNZB 2VMFA 3P30H 2B39A 3NFSH 2XZAL 1BZ7B 3W11C 3BPCA 2FYYA 2V7HB 3SKNB 1JPGA 2NY3C 3MNVB 1I9IH 2X42A 1OAXH 4U33A 4NNYA 4RFEA 5I71B 2X44D 1U8HB 2HLFC 3O3EB 3O9WD 4UV7L 4OZHF 5C9JA 4CJ0A 4LVOB 4N0CC 1KB5H 1QRNA 1ACYH 3MGOB 4HAGA 4WO4A 4B7LA 3W9EB 1CIDA 4JQIH 4KKBD 5K9JH 4LOUD 5J89A 4ZAKC 3C8DA 5JMOC 4ONHB 3JWNC 2I60L 3QEQB 5D1ZD 1VHPA 1ZWIA 4NJAH 1PG7X 4RMVA 5CILH 5J57B 1MCSA 1YNKH 1NBZB 4P2RE 4Y16C 3RVTD 3P4MA 3CDYA 4D3CL 3AM8C 1ZGLA 4HF5H 1T04A 3KDMB 1PYWA 4BFIB 3TIEB 1FFRA 2EECA 4S0TD 1XCQA 2EDFA 3UTQB 3QXAB 3EDJA 3SJVA 1OHQA 4OLZH 3KNBB 3O8XA 4XPBH 1G1YA 5C0FB 3VXUD 2BRRL 2EDKA 2IPTL 4DN4H 5JQ6L 4HGKC 5F7HA 4M7LL 3U7YH 1YMMD 1S5IL 3TWCH 4GW5B 2CO7B 3PHQA 4WDIA 5D2NA 4JG1H 1OM3L 2GUOB 3FN0L 3PG2A 1DL7L 2P5EE 2BOCB 2DBLH 2UWEB 4GS7C 5EO0A 3V0VB 1KIQA 1ADQA 4I18A 1OW0C 4ORGB 1DUZB 2ATPA 2F9BT 4UIKL 3QDHA 3SOBL 4NN5B 2B0SH 3NCJL 1ITCA 1N7ML 5EPMB 1VEMA 5FO8B 1VCAA 2VJXA 3MLYL 4NJ9H 1MEXL 3KYKL 4X9GA 3BO8A 3PV6B 1FL5A 5GJTL 1SM3L 5SWZB 1QLRB 2G5RA 4MNHB 3VWKC 5HXMA 4OZFB 4PJDF 3FQUB 1TTUA 2APVA 2AXFA 4LSRL 5FGBC 5EN2A 4GBXD 4XPTH 4OTXH 4HCRL 5EU6D 3MRGB 3G6AB 1E6JH 3D69A 4LMQE 2B4CH 5EUOB 3FQXB 5ERWA 1IILE 1Q1JL 2C9AA 1I7UB 2VH5H 5HVGB 4G43B 4AM0B 1X5KA 5DC0A 1DBAH 4IDJL 3T3MF 5B3JF 1KC5H 2X1OA 4OGYH 2AK1H 4CN6A 3S4SG 3DTXB 3QFJD 5ETUB 2FJGA 2PXYB 4NM8H 5ALCL 1K4CA 5I17B 3BKYH 4NQEA 1CGYA 2HJLB 4LLQA 4MJIE 2IH3B 2VXUL 2OTWB 2GJZB 2A77H 1H15B 1C1EH 4FN0A 4NQCE 4Y8AA 1OVZA 1I8MA 1JPST 2F5AL 3V4PH 1WFTA 2VKXA 2VERN 1I1AC 4X4ME 1CS6A 3UPAA 3VD5A 3OBAA 4NZUL 3G5ZB 3NAAH 3WNPA 3QO1B 4X9IA 4ZD3L 3V5DB 3W0WE 1CVRA 2MSPA 1CCZA 3N1PC 4IOFD 4WI3A 2PF6A 3PWPB 5C7XH 4PJHB 1MHPH 3E6HA 3O6FA 3TJHC 4H5SB 4FFVD 4LPYA 4Y19B 1J1PH 2FBOJ 5F7YC 2OL3L 1OF2B 4PJEE 4ODVL 3ARDC 3S36H 3LMJL 1DFBH 1IC5H 3S3JA 3DHJA 1BZ9A 4A6YH 1G0XA 5DVOA 2Z9TA 1UYWH 1ORQB 4NHCH 1LO2H 2C3WA 3ARFC 4L5FH 5GZOC 2OZ4H 5KVGL 3K3QA 4Z8FH 2H32A 2A6DA 1F90H 3MRNA 1J86A 1J5OL 5IGXH 4CKVX 4M7JL 5EFIB 3TA3D 4BZ2H 4RA0C 3WDJA 1BGXL 1RQ5A 3VD9A 1UVQA 1NCBL 1JK8B 4YUEH 3KWWA 4Y2OA 1PX3A 5EBLB 3CVIL 4P9ML 3BD5A 2EXYD 5GGVY 3FJTA 1UZ8A 4QYOA 1FZKA 4K7PL 1RUQL 1KIPA 2NY4C 3GSNA 1ZT4A 4IM8A 3R0NA 2AEWA 3OXRA 4G7YH 4PBWD 2GSGA 4Y4FD 5C3LD 2VZOA 1X5HA 3K4AA 5DJYB 3VFUB 5HI5C 4R0LA 2DKSA 3T3PE 1BWMA 4V1DE 4JB9H 2VQ1B 5E0QA 5ESQA 3WS6A 3RZCA 4JFOB 1N8ZB 4NZDA 5F7MC 2XRAH 2MCPL 1XF3B 3J7HA 5M94B 2GAZB 3Q0HA 1T2JA 3QDGB 3BD4A 3ESUF 1YDPB 3EZ8A 4PD4K 1RULL 3CXDH 4Q7DA 4H26B 4XVUC 1DVFC 3HG1E 4M7LT 1IGCH 1U8MB 1K8IA 1YC7A 2W65A 2WBJB 4ELMA 3LB6D 2X1WL 1A7QH 4K55A 4Y1AE 2GJJA 1Q9WB 4HUUB 3V8OA 5M95B 3E6FA 3MZTA 5EC1A 4JFZL 1P6AB 5DYOA 1QNZH 3HFMH 2DJ4A 4NPYB 3BHBB 2DJSA 4BSVA 3UZVB 1WZLA 3QIWC 2NY7L 3Q6FA 3EYVA 4LCWE 3KLHD 1QEWB 4AT6B 2Z8VC 3BH9A 3LPFA 5FV1L 2FB4H 4CUCA 3UYRH 3BQUC 2J5LC 3K2MC 4PJ9B 5I8OH 1AJ7H 5IWLA 1GL4B 2WLYA 4XI5D 2FR4A 4R26L 4I2XB 2E9IA 3FT2B 1B88A 2WWKT 5A2IH 4XP5L 4UIMB 2ICWJ 4KGLA 2BNRB 3FN3A 3BN9C 5T3ZH 1MJUH 1CFNB 5ELIA 3KPOB 4G3YL 1HXYB 3AAZB 1FGNH 3LN4B 4XCNB 4OKVA 1EAPA 3V7AG 3TNMA 1KJ2H 4JGMA 4PJ8B 1G7MB 5D7IA 3WKMH 4P3WA 3VRJB 2X4SB 1L6XA 4M1GH 5J12C 4I0CC 3PXJA 4OF0A 4JZJC 3MSPA 4HIIB 3DV6A 3C9NA 2HN7A 5F9OL 4WI2A 1A7OL 2Y7QA 3BSZH 4J4PA 1FYTB 4NQVA 2NY0B 1GAFL 4U7KA 4CW1B 3BKCH 4Y5XA 1T5XA 3EDFA 3D48R 1WWAX 4YGVB 4RX4A 2JIXB 3GJFB 1NMCB 2E27H 5I74C 1MI5E 3LV3A 1T0NB 1NH6A 3QA3B 1M71A 2R9HD 4FTVB 3PJSA 4RAHA 1IKNC 2OTUA 4NRYA 2R0ZH 5IBLD 3A6CH 2CJUL 1SY6L 2X10A 1S9WB 3PGCB 1HHHA 1NGWA 4Z7UA 1GZPB 5A2FA 4HCRA 3MFGB 1IAKA 3LOWA 1FG2A 1JNNH 4OZFG 5DD1L 4G6AC 1Q9KA 4U6TA 4J23A 3UTZB 2VISB 1KLUB 2QV2A 1UADC 2IALB 3QPQD 3HC4L 4YHLL 1ZGLM 3KPSD 3KPRE 3MRLA 3W9DA 4HX1B 4NCDA 5DUPL 4K2UL 1M05B 5SWQA 3U9UA 1KEMH 3B5HA 2OMBA 1LP9B 3G6JA 4AK1A 5DD0L 2HTLD 1ULVA 3FO0L 5CJOH 1KCUL 5D6DC 3VGDA 1YEEL 4ONFL 1CWVA 2D31A 2IQAA 3NABH 1IVLA 3QG6A 4C58B 3B6SA 1RURH 4CVZA 2BNUA 3OMZA 3VXPB 3GNML 4F8TA 3VMPA 1F6LL 2NYYD 4C59B 4YC2B 3GSRB 3L3DB 3QCUL 4EI6B 4UQ2B 1WC7B 2C3VB 5I1IH 4ZUTA 3J8F7 1PJ9A 4HS3B 2IEPA 2W59A 3GJFK 1WF5A 4LHJB 5HHMD 5AAWA 1A02N 4OI9A 4JY4B 2FZ3A 3BE1L 3EFFB 2PYEB 4QT5B 4UBDD 3U36B 4DZBA 3EYUL 2HYMA 5INCB 5DGQA 2FL5B 1JNHB 1UB6B 5CD5D 5KJRL 5JW5A 4YWGL 1C08B 5CHNB 5I1DA 3PWNA 5M7QA 1R3IL 1RAMA 3OKOB 1G7QB 2GYSA 5E8OA 3TBVA 3LS4L 2PYFA 4OFVA 4X9FA 3RVWD 3QRFM 3CXHK 3I84A 4HJJH 5IVZB 1UA6L 3MRIB 5CLWA 5BMFH 5F7EL 3BVNB 2BVEA 1N6QL 3ABZA 2DIAA 2Q86B 4DKEH 4HUNB 1Q0YL 2A0LC 3P0VL 3QEQE 1G9ML 4APQB 1LE9A 1J11A 4LHUA 2GK0B 4YFDB 5I2IA 4OCYH 3PNWA 5D2LB 3CVHB 3TBYB 3MCKA 4GW1B 4MXVE 3GMQB 3V7AE 4ODUA 3I6GA 3E0GA 1S5HB 1RZKC 1WTLA 3G04A 2JJTC 2EH7L 1WAAA 4JZOA 4WTZG 3C60C 4GG8B 1P4LA 2FGZA 2AK4A 3D39D 3HRZA 5A16B 1QPXA 1CLCA 5HI4C 2VRAA 4X6EA 1E4KA 3O3AA 4DWHA 3GI9L 1KPVA 1P7QD 1N4XL 3CAFA 2EO9A 3OB0K 5H8DA 4WW2F 1S7XA 5D7LA 5T1LB 1EBPA 1WCBB 3OKKB 2DD8L 4TULH 3T09A 4HWEH 3BKML 4J7RA 2FBJL 2P7TB 1I85C 1T7YA 5C09D 1UEYA 4U1MA 4UT9H 4Z76A 2BVPB 1FBIH 2YWZA 3QBTB 2B8OT 3VFRA 2R1XA 4FQIH 4S1SH 4CU8A 1IFHH 1YEFL 3IU3B 5EC2A 5SWZE 2P42B 2NY5L 1T3FB 3MRFA 4G8IA 4CVXB 5T5FH 4HEME 5D93B 3E1F1 3BP6A 3Q6GH 5DK2A 1F6FB 3DMMB 4X0KA 4D9RD 3WYRA 2ADFH 4MB3A 1MHHB 2W9EH 4NNPL 3EKCA 4M00A 5EUOE 3GSXB 2PW1A 4Y5YC 3AREB 4D9LH 5E2UH 3HMXH 2NXZD 2B5IC 3V6FB 2BMKA 1A4KB 2F19L 4NWUH 4RGMC 3ARSA 4XNUL 4LAJH 2E7LC 4KWUA 5E6ZA 4OLXL 1R0AL 1PFCA 3NIDF 2FLBT 3FFCA 3AROA 1Z5LB 4G6JL 5D96B 4JY6B 4QO1A 3UMTA 1UWXH 5IT2L 4JFDD 4U1GC 1W72H 3BDXA 3TT1H 4U1NB 1C16A 3OGOE 4CL7A 4XRCA 3TN0D 4ODSL 1Q72L 4P2OA 3RTQB 2BK8A 3M1BB 4KRMB 3KYOA 1I7TB 1SY6A 4QRRB 4R4ND 4QRUA 4PREA 2Y6SD 5SX4H 4KHXH 3VXRD 5GRJL 5JW3H 5JXAH 3P40A 3OSKA 3OR7A 4L8BA 4W68A 4Y19E 5CEZD 3U1SL 5E95B 4P5TA 1FAKT 1TFHA 1AXTL 5HHNA 2YXFA 5CKGA 4S11A 2DMCA 3MLWH 4QRPD 3SY0A 1FVEA 1PAMA 3Q3GB 4M9PA 2EDLA 3U30C 3TBTA 2ADGA 1QSVA 1BAFH 2LV4A 4Y2DB 1K85A 3MXWH 1CE6A 3RL1A 2VDQL 1H3PL 4ELMF 2LAAA 3DX6A 4F15B 2BSTB 3L5IA 1P5UA 2K1MA 2QQKH 1ZHNB 3S97C 1A3RL 5DMGD 4XP1L 4NM4H 4RCAA 2QADD 2F53D 2DDQH 2DJUA 3EW3B 4P2QB 4KTYA 4YE4H 1FO0L 1T0MA 4JM2D 5IIEA 3T0EC 1ZANH 5L2JA 3FO2B 2XKNA 5SWSB 1OP3K 4X8JB 1AIFB 2C4FT 4Z7VB 1J8KA 2YBRB 3WKNA 3GB7A 3RJQB 4PJ5E 4JFHE 4NQXA 5HGDA 1OTTD 1K5NA 3MRCB 3ME0A 3VGEA 2V5YA 1VEPA 4XZUB 1VACB 1G1CA 3PHOA 3QDGE 2FRGP 5IB1B 4HXAH 2I25N 4YFLF 1NDGA 3MFFB 3RVXC 1RZKH 3I50L 3MV8A 1G6RH 2WUBH 3X13A 3IVKA 5LGJA 1WV7T 3D6GA 4XB7A 5GRUL 4URTB 5IEKB 1YEJL 2W1NA 3G08B 4GQPH 3ZKMD 4D3CH 3MNZA 4UT7L 2YPLD 5L2KA 1B0WA 2P44B 4HIHA 2YSSA 1VEOA 1MJ8L 1EHNA 3VRIB 2CIKA 3MYJB 1T0PB 3HLAA 4PLNC 1N5AB 1VADB 5TH2A 5FCUH 1QSZA 3L3JB 5MEQA 3WFEH 1MCOL 4G8FA 3DYPA 4X4YA 1FQ9C 3ARVA 1S5IH 2DL2A 3PDOA 4PJCA 3B9VA 1OM3H 4L4TD 3RVUD 1OT2A 1PZ5B 3D2UB 4U7MA 4RRPA 4UINH 1FRGL 3S35X 1NDMA 4ISVB 4JCMA 1IC4L 4XXDA 3HZMA 1GOFA 1DQLL 4TTDC 4OM0L 4MAYA 4UIKH 4CVUA 4TQEH 3BRFA 4KK6C 1EA9C 1S9XA 3TO2B 3RY5A 4BFBD 1OPGL 2DQTH 3NCJH 5DQJA 3WFZA 3QUZD 4P23B 1LQSR 3T8XA 3U4AA 2D7OA 4MJ2A 1ZLWH 1T2XA 1MAJA 2OP4H 5C0CA 5CGYC 3KYKH 3O11A 1QSEB 4JAMA 4PRDA 2DWEB 2QJDA 3MV9A 2D7TL 3LDBC 2VTFA 3P4NB 4Z7UF 1XR9A 2XG5A 2ZUXA 4ZSOB 4EI5B 5DI8B 3U2SB 2EIDA 2Z91A 2DRUA 4XWOC 4OFYD 4V2BA 4HH9B 2F58L 4LSRH 3STZA 2L0DA 2R56L 1NLDL 5E08H 4QCIA 5MHSE 1YEHH 5SX5K 5E8PA 1I9RL 3D18A 5I8KL 1SJEA 3BIKA 4ZQKB 1KPUA 1Q1JH 1K4DA 3KPQB 2OJEA 4HEPG 3BAEL 4LBEA 2EIEA 2I9LB 5E2TL 1V7NL 3GJEB 3OJMB 1C5DB 1T1WB 2XWBA 5KANI 4MJ6B 4G6KL 3ZKXC 2P4AB 1GXEA 3O2WH 3MJ8B 5I76A 1ZLSH 2VDPL 3LEXB 5FKAB 2R23B 2HT4C 4PGBB 1DP0A 1N0LA 4KK9C 4XMPH 4MZ2A 4JFQA 3QWOB 4OIBA 5J11B 1IAOA 5J6GB 1J88A 3HMWL 3KYAA 4WVRA 1NANH 1LK2B 1LWRA 1RJZB 5T3XD 5IVXB 1KCSH 3FB6B 3T65B 3VI4F 1KJMA 3TYGH 3EJYD 1U8QB 3MNWB 2ITCA 3PP4L 3BJ91 2HAZA 3KHQA 1PZUB 1RMFL 4PJBF 2VABB 3RI5F 4X5LA 1N26A 4LEOB 1AH1A 3BYTA 1U9KA 1H5BA 3VXSA 1IEHA 1P2CA 1RJLB 1V3KA 2GFBA 2FECI 3LN5A 1HQRA 4M6NL 1QVOB 2WWKO 3VXUB 2WUCL 1JNJA 2OL3H 1ES0B 1TTFA 5FKPA 3SJVD 4U31A 4FG6D 1DR9A 7CGTA 3MROB 5IVNA 1Q94B 1NC4D 3LMJH 1MFEL 3IYLW 4F7CA 1ZLVH 4HK3J 3ZLQC 3BUTA 4LP4A 3VMOA 1XH3A 5DTFB 3TNNA 5ID0A 3RIAF 4X7EC 4LCUB 5I66A 4MDIB 1NFDF 4ZFOB 2SEBA 2K3TA 2JK5B 4Y5VB 3TT3H 4XX1G 2X05A 1BGXH 1U8JB 3C5SA 4MXWL 2BSSA 5IOPA 3CVIH 5F88A 5EBGA 4KXZI 3T2QA 1C7TA 4WHTA 4OZGB 2EDEA 3ZDZE 1VGEL 3O81A 5IW3A 2MOVA 2IANA 5CJBA 5FDWA 1CK0H 3RWCB 2PYEE 43CAA 4ZAKA 2GT9B 2VLLA 2P8LA 2OYPA 5HSFA 3VFNA 1QPPA 3IT8D 2CGRL 3OKEB 3C8HA 3F58L 4U0RC 4Y16A 5I30L 3AM8A 3UROR 1O7VA 2GTZB 4NUJB 2OJZH 3BPLB 5HVHC 2A9NL 2VLKB 2WNGA 1HSAA 5FFLA 1FZOB 3F5WA 4WWKC 1ZSDA 4G9FE 1NCNA 4E5XB 3S96A 1I8IA 2P1YA 1FO0A 2VE6A 3QFJB 5CP7B 1I4FB 3GIZL 3LD8C 2O5XL 1KG0B 1OGTB 1AXSB 1PY9A 2IPUK 4OB5H 2X4UB 3HE6B 4PRAB 5GGSA 3VDAA 3F6LA 4H8WC 4HHAA 3ETBF 4GQ9H 3MLTB 4U3CA 4NQED 4BUHA 5C0DB 1GHFH 5DFVC 3DXAA 4MCZB 4NQDA 3ZKNC 5IMLA 5HPMA 1CFQA 1PSKH 4O2CB 3O45B 2FGWL 5D2LE 3PUCA 1ED3B 1N3NA 4W6WB 3FHQA 4YHPB 5CIPH 1N6VA 3VFSB 1UKQA 3IKCB 5CMAB 4U1HA 2BDNL 2PO6B 3QNZA 4JRYA 5KBNC 4DGIL 4MA1C 1S7VA 1CGUA 1D5IH 1FORL 1OQXA 5EZOL 3I9GH 5K59F 5FYLE 4OF8A 3HAEA 2YMXH 1P7HL 1NUFA 2CO6B 5FA4B 2EYSA 4POYA 1FNEB 4H20L 2AV1B 4ZS6C 1ZHKA 1MNUL 4NP4L 4MAUH 5CWSA 2HFTA 2O5YL 1NGZA 3P4OA 3UDWA 4LCCC 3NZHL 2KBGA 5FGBA 5B8CC 4S2SA 3WFDL 5K9QG 4L4JA 5HDOA 5DJXA 4GMSL 5LAXA 5C0BA 1A9BB 3AVEA 3G9AB 1NGPL 5BRZE 4X6CB 4ZXBB 3SEPA 2Y06H 3QHZH 4J8RA 3CSPA 4KAQL 1IMHC 1NMAL 1AI1L 3CUPB 4JGJA 1A22B 4XHQA 5IJKC 3HCVA 5IW1A 3B9DA 3RA7H 1FSKC 2A83B 2RFXB 2XFXB 3UZEA 2W9DL 3RDTC 5IM7A 1IGTB 1GOGA 1MUJA 1U3HC 5ESVA 1AC0A 4PY8I 3EO1A 3OX8A 2UZYB 4LSTL 4RGNB 3KPLA 3GRWL 5HVFB 2BY1A 4NRXA 1I1AA 3V4VL 3F7RA 3QRGL 3W2DH 3WEXB 5IFHL 1FE8L 1NCTA 3AC0A 3RZCD 4PRIA 2WIIA 4Q6YA 3LKRB 3RY4A 4OJFH 5D5MA 1Z9OA 1F3RB 4ZYKA 5JIIA 4NO5A 1XGUA 5DC9B 1S7UA 4XX1E 5E8DH 5DHXB 1PKQB 4C83B 2J6EL 3VA2C 1HZHH 3BGAA 4F7MB 3ARGC 5FB8A 1TPXB 4DQOL 3ARDA 3TIDB 2R8SH 4MD0A 4RISH 4TVPL 4Z7WB 3VI3F 1ZHBB 3VXMA 3L1OL 1BBJA 3ARFA 2VDOL 2A2QT 1M6OB 2H1PH 2VXSH 3NIGF 1DQQB 4HBCL 2BVQB 1X44A 5F9AC 4BSJA 5IHBA 2H3NA 2VAAB 2Z4QB 3DYOA 1JRHI 2CKNA 2ZOLB 3RNQA 3T0XA 3OKNA 3T4YA 4KK5C 5EOCH 4M48L 4O2EA 4K71C 4MXQD 1BLNB 1DBKH 1GSMA 4ODTH 1FLTX 3UO1L 1FIGL 5L88H 4F37F 5GPRA 1XR8A 3G6DH 4FP8H 4WI8A 4JKWA 4KJWC 4HIXL 3TPUA 2OQJA 2IPUG 3FRPA 2AERT 5GJSL 3HKFA 3BE1H 4G9DA 3L9RA 4N0FB 1M7DB 1QRKA 4P2QE 5I1EL 4XNQA 3N9GH 4ZOEA 5I75C 1DVFA 5C8JA 3OPZL 3AS1A 5C07E 5SWSE 1U6AH 4LLYB 2IG2L 4Z7VE 1QLEL 3DVNB 1HHKB 2CLRA 4D94A 1I1YB 4G6FB 1QQDA 4J4PD 3LRHA 4H8WH 2ZCKL 1CD0A 1FDLL 4M61A 4KHTL 5F1KC 2DQHL 1J18A 2XYCA 3PABA 1EGJL 3WNOA 2VN7A