2A1WL

Anti-cocaine antibody 7.5.21, crystal form i
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
216
Chain Sequence
DVLMTQSPLSLPVSLGDQASISCRCSQSIVKSNGHTYLEWYLQKPGRSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQGSHIPWTFGGGTKLESKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin light chain kappa
publication title Flexibility Of Packing: Four Crystal Forms Of An Anti-Cocaine Antibody 7.5.21
rcsb
molecule tags Immune system
total genus 47
structure length 216
sequence length 216
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a1wL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a1wL01
3ARPA 3RGVB 1W72B 1WVZA 4Q2ZB 5B39G 4EJ1C 5EOCL 3D39B 1LWRA 5IW1B 4OLZH 1MJ7L 5IB1B 4YX2H 3X17A 4FNLH 4RBPK 1LO5B 1IAMA 4R2GC 1Q9WB 4P5MA 4CMMA 4GRLB 3MXWH 5I1JH 1A6TB 2P5WE 3Q6GH 2CXGA 4YFEA 4ZPVA 1NSNL 3QNZA 4BFEA 4CVZB 5KVGH 3LIZH 1HCFX 5F3BA 5D6DA 2RCSL 4MDJB 4UT9H 4ELKA 3SGKA 4Z7NF 1OP5H 1U8PB 1P4IL 2VDKL 2LABA 2VDLL 2R8SL 4JZJA 2VDQL 3SOBH 1A7NL 3DSFL 1T6VN 4CGTA 2P5EE 4Y7MA 3MLRH 1EFXA 1OARL 4OAWB 5D7IB 3E6FB 1EZVX 1Z9LA 3ULVE 1JI1A 3QFJB 1EO5A 3DWTA 4XPAH 3CVHB 4PG2A 2F58L 4E41B 4ZAKC 1JPFA 4DKEH 5DHYA 1BFOB 3FQTA 1T4KA 4NGHL 3ZE2F 1JHTB 4M5ZH 1AE6L 5DD0L 2EICA 1A1OA 4OF7A 4ELMB 2H32B 3AMKA 4PFEA 5JORA 3FONB 3DMMB 4NPYB 3VFPB 3C2SA 4L3AA 2ZKHH 5C0BA 1AY1H 3CMOL 4X99A 4KKCC 4AM0B 5EZIH 1CFQB 2AK4B 5IT2L 3IU4L 2A6JA 2NXYB 3QIUC 4QOKB 2VR9A 2ADGB 4G6KL 5FAAA 2JIXA 3DVFA 5TQ0L 5F9WC 1R6VA 5F71A 2OZ4H 3NCJL 3ZT6A 3TN0B 1KOAA 3PQYD 4XP9L 4WWID 4QF1B 3KXFA 3MZTA 4OZIE 4NBZB 4FABH 3PV6A 2EIEA 4OIIH 4NHCL 4ZFGH 4S1RH 1PKQA 3B2UC 3MA7B 4XVSL 4LSSL 4TULL 5GGTA 1X4XA 5E6IB 5EU4B 3SGKC 3VFNB 3HE6A 1KIPB 4I1NB 5D7SL 2WBKA 1T21A 4JZJC 2NY6C 3SQOH 4QRRB 3OKNA 5IQ9A 5C0DA 2AJ3A 4UIKH 5EORH 4FHBD 3QDME 4DVRL 2VLKD 4HKXA 2E7LA 4ZS6D 2BERA 4PG2C 2F8OA 4Y19E 4PTTB 4MNQD 5DD1H 4WEBL 4Y16B 4CL7A 4PGDB 2ADFH 4HSQA 4KAQL 1AKJB 1OF2B 2EXWC 2ESVB 2VL5B 3EW3B 4YO0A 3TZVA 3OKEA 1E4KA 3OR6A 1LP9A 5HVWA 5L2KE 4KMTH 4D9LH 2HKHH 4JPVH 4Y1AE 1EO7A 5F9JB 4TVSa 5E9DE 1I1FA 1I9IH 5IBLD 1E6OH 1WBYA 4HGKC 4ZS7H 1S9WB 4ERSL 4KK9C 5D7IF 3ZYZA 3KAAA 4NZDA 5IESH 4ZXBA 4PY8J 5HHXH 3C6LD 3F7VB 4PJBE 4Y8AA 3MGOA 2ZCHL 3ET9F 1FNSL 4UOW1 1I3GL 2GTZB 1LNUB 3X3GL 4WIQA 3HE6C 5ADPH 4YIQB 1QRNE 1TQBC 4R9HA 5F88A 1JFQH 4PGBA 4XVUC 2X40A 5A2IH 2MSPA 3KPSB 4PTUA 3FFCB 3HI5L 4H25B 5C0CD 1JGEA 3B9KB 1CDCA 1NGYA 4XNUH 5TGBB 1Y6MR 4M7ZB 4GXUM 1ULVA 4IOFD 4H0GA 3BDYL 1QLFA 2CUMA 1INEH 1KT2B 3QXTA 1JP5A 2JCCA 1D7FA 1KJMB 3R0NA 1FNFA 4JG0H 4U6VH 4WI5A 4HC1H 1HYSD 5DURB 4WFGE 3FQRB 5IJVB 4N0CD 4YE4H 1IGML 1JPST 4GT7A 2HLAB 3Q2CA 4P23A 4K7PX 5CILL 5L6YH 3W2DL 3S37H 5GRZA 3HFML 3VFTB 2A9ML 3ARBB 5CLWA 4IIQA 5JW5B 1DBAH 1AXIB 2DQJH 3NACL 1ZA6A 5TE7H 2CIIA 2DQEH 3PXJA 3JWOL 5GZND 4RGOL 4YLQT 4QTIL 2VIRB 4PJFA 1SYSB 2BCKB 2HJFB 2XXCB 4ZXBC 4QEGA 3DGGB 5TDNA 4JRYD 2DIJA 1UQSB 3QZWA 4P2RD 2QQNL 5LJYH 5KVDH 1QKZH 2R1XA 5I1EL 3EYVB 1PEWA 4XMKH 4O5LL 4PJHA 4KQ3L 4PJGB 4X83A 4NO0A 4PBWD 2YPLB 5I2IB 5JDSB 4G8GA 2G9HB 2G5BA 4KDVA 4KK6C 3IGAB 5CIPA 4FQPA 1F2QA 3T0EE 1ERNA 5AUMA 2LU4A 4K55A 1NL0L 1QR4A 1HKFA 4ZTPH 5T1KD 2AI0L 1JCKA 1FZOA 1G6RH 2MQCA 1S78C 3KLAB 1QEWA 2FR4A 3CU7A 1I7ZB 3TJHC 1NFDB 4OCSH 4PRPE 4IOIA 1KB5B 4G80A 1PG7H 3RVVD 3GKWH 1IEAA 3NMEA 4YWGH 4P23C 1HHHB 4EUPA 2PTUA 1OAQH 1WZ1H 4BK4A 3QUXD 4CVWA 4U6YA 4IIQC 5IB2A 1KCKA 1WUNT 1CDIA 5E8DL 3TBYA 1W0YT 1UFUA 1L7TH 4PB0L 1BF2A 3VMPA 4GAJL 4WJ5A 1FPTH 2HJLA 4F7PB 4IMLB 2IFFL 3KDMA 4NN5B 3BJLA 2GKIA 2WK2A 4LRNH 3QUZA 4MCZA 4MQSB 1NC4D 3EYUL 4KUZL 2FL5B 3FQUA 3MYJA 3BFOA 3MLSL 3V0WH 3A6BL 5FA4A 3PGDA 2DLFH 4GMSH 4ONFL 4UT6L 5K9KA 3FO0H 4HKBA 4N8VG 1DBJH 3OX8B 4BSVA 5DJDB 5JPMA 1HHKB 3QWOA 1A1NB 4I18B 2AVGA 2DQGH 1DLFL 1FLRH 4NZTH 3ZTNH 3MMEB 2FZ3A 1F42A 2GUOB 5I0ZA 1Z0NA 5FK9A 3HNSL 1IZKA 1S7RA 2YEZA 2YHGA 4NCDA 3UBXA 3VDAA 2ZP0T 2J5LC 1G7MB 3QDGD 4OKDA 4RGND 1DDHB 2EZ0D 1KPVA 3K0WA 4PR5B 4FTVD 2D7OA 4XCEB 3HLAA 3SCMD 5LXGH 5F8RC 1YY9C 4NNXB 2DB8A 1JTPA 3C8KB 3LSOA 3WNLA 1A14L 2V6HA 5CZVH 3HZVB 1NUDA 4GAGL 3WD5L 2X4PB 1WWBX 2KKQA 1QA9B 3KNBA 1T7WA 5I18H 4KVCH 3S36L 1OB1B 2Y23A 1OOAA 4N68A 5CGYD 2I60H 3BIKA 2BNQA 1YEKH 3G6AA 5HHVH 1CE6A 1ZLVK 3V6ZA 1IM3A 1KCUH 1KEMH 5F6IB 3SKOB 3D0VB 3MROA 4Y4KA 1L7IL 2PCPB 5IG7B 5LAXA 5B39B 3FO2A 1R3HA 3O3UN 1NFDF 4UZGA 1A6WL 2I07A 3MRFA 4EN3B 1J0IA 1J1XL 2V2WA 5E24E 1CS6A 2LU7A 3UTTD 1QSFE 1WT5C 1MCLA 3DRTB 2Z31C 4CJ0A 4ALAL 1EUUA 1ZV5A 3RVTC 5GGRA 3FQXA 3G5VB 4HFWA 5EUOF 4AT6B 4JFOB 1J5OL 1BAFH 4ZNEA 1BQHG 1RJZA 3O4LA 4RCAA 2Q3AA 5C07A 1F11B 3PHQA 5B8CA 5JO5B 1EJOL 4YDKL 2EDLA 4AG4H 1XIWC 4AL8H 2GK2A 5HY9B 1S9VA 4RAUB 4ZFFB 1WC7A 3SJVD 1I1AB 4NKIH 3IU3B 1YEJL 5GSVB 2HFGH 3QPQC 4XP5L 3X12B 1YDPA 2R2EB 4XB8A 1ZVSB 3MXVH 3MV01 2MTPA 1A2YB 3C5JB 3B5GA 4RA3A 2VO5A 2AJXH 2M26A 3D87B 4Z7UE 5FIEA 1VEPA 4UBDD 5JUEL 4Y2DA 2XZQH 3EYQD 3NTCH 4ZYKB 3U7WH 4Y4KC 1IGCL 3MACH 4JVWA 4G6AD 4TUJB 5B3JF 3LB6D 3RIFF 2ZNWA 43C9A 2PYEE 4Z6AT 5KSBE 2FDBP 1U9KA 1CI5A 5C0NC 2VZVA 1W8NA 5IFAL 3L3IB 3TH3T 3ARFA 1KUMA 4ZPTA 5JMOC 1N7MH 1ZHLB 4I2XA 3VXTA 5I66A 2HJKA 5C0JB 5D2LB 4FQXD 1E4WH 1IQDA 2ITDB 4R6UA 1D5XB 4QNPE 4PRID 3VU2A 5MEND 3L1OL 5EOCH 3MFFB 3MUY1 3O8XB 1FZJB 2XN9A 1MJ7H 5IHUL 5L7XL 3EGSB 2EDQA 3AVEA 4YNYA 2A0LC 1MAJA 5DS8B 2MNUA 2FEEL 3S3SA 3WHE0 1NCWL 3G6JA 4X4XB 1XGQA 2VLRE 4LSPL 2YWYA 5CGMA 4RA0C 4PIRF 5DMKB 2ADIB 3PWVB 1NSNH 3EDEA 1WIOA 5K59E 1OTUC 3B4NA 1IQWL 2RCSH 5JXEC 5EU7C 3W0WB 5IMLA 1P4IH 1QP1A 2VDKH 4OFIA 5IEKB 3CH1A 2VDLH 4JFEB 5HYJD 2R8SH 2VDQH 2HFEA 1A7NH 2BVOA 3DSFH 2GIYA 1IL1B 1DR9A 4DUXA 3CFBA 1KJVA 1OARH 5J1AA 3FT4A 3WLBB 1R3LB 4Y2DC 3H7BA 1NLBL 3LRSA 2CO6B 4UT7L 3VCLB 2F58H 2V7HB 5D1QC 4L3EB 5ADOL 4HX1A 5EN2B 3BQUB 3KPRA 3MQIA 4NGHH 1V7ML 2XI9A 4PREB 1AE6H 4PJIE 3MOAL 5DD0H 2LVEA 1QR1A 4LNRB 5FKAB 4A6YB 3NZHL 1RIUL 4KFZC 3REVB 1YNLL 2AJUL 3ARGB 1ZGLM 3CMOH 1RVFL 4LEOA 5IT2H 3IU4H 4HFUL 1U8OA 4QTHB 2DJUA 5CEXA 4UAOC 3PJSB 4G6KH 5F21B 4QY8A 3OKLB 5TQ0H 3IJHA 1P4LB 3NCJH 2ITCB 5F6HI 4XP9H 3SE4C 4UOJA 3FT2B 4LVOC 5HPMB 4NHCH 4MJIE 4XVSH 4MZ2A 4K7PL 4LSSH 4TULH 5D1XB 1I8KA 2DIBA 4XAKD 4YC2B 3QWRD 5CZXD 5CEZE 5D7SH 3MBEB 3RVWC 3MRDB 1SYVA 1CF8L 3O3AA 1LQSR 2C3VA 3GIVA 4KROD 4ZD3L 5D2LF 1CDJA 4GW4A 5K9JL 4DVRH 2AJZA 2EO9A 2IH1B 4YPGA 1OAKL 5IK3B 4PV9B 3GSRA 1ZMYA 4WEBH 2Q87A 1KYOJ 4JFDD 4KAQH 4KJPD 5I71C 2P5WA 3CFDB 3KJ4C 1CICC 3L3OA 4FN0A 2MWCA 2CD0A 2ZUVA 1QFWL 1AI1L 3MNZB 1CCZA 5D5ME 5T1LB 3HUJE 2VR4A 4Z7VE 4J8RA 3GSXB 3RWEA 3L5HA 1I7RA 2XY1A 1X6LA 4UDUB 3TBTB 4YAQB 3WL9B 5I9QB 4ERSH 1EAPA 1ACYL 2WP3T 4ZUUA 5F1SA 4YFLI 2ZCHH 1NKOA 5EC1A 5DEFA 1FNSH 2ZSWA 1I3GH 3OTTA 5T5NG 2MCPL 2NY4C 3X3GH 4WW2A 5TFSL 2AV1B 3Q48A 3NH7L 4YK4C 3SQBA 3WNKA 4LVNC 4KMQA 5ID0B 4XHJC 2ED8A 1KELL 3HI5H 2FGZA 3O11A 3QJHA 4OIAA 4PJ5E 2YRLA 5I15L 1WCQA 1CG9B 3UBXI 3RL1B 1AR1C 3VH8A 2SEBA 1Z3GL 3BDYH 3L3DA 2FJHA 1XGYL 3PV7A 4I9WD 3A6OA 2IMMA 1JTOA 3STZA 2NQCA 2EC8A 4R7DA 3U6RA 4QRTA 1IGMH 4P49A 2DWEB 2J7LA 4F33B 5CILH 2M2DA 4MNHA 1DN2A 3U9UB 2XT1B 3F62A 3W2DH 2ICEA 1XCTA 3QR2A 5DEGA 2WINA 3HFMH 2A9MH 2EDTA 1NFKA 2OR9L 3NACH 3ULVC 1PW3A 3JVGA 4AIOA 1S5IL 2IH3B 4PGCB 1TMCB 1YZZA 3N1GC 1GOGA 5BRZE 3JWOH 4RGOH 3ROLB 2FIKB 4QTIH 3B3IB 1VSCA 1XGRB 1EEZB 2BNUA 3IDMA 2R29L 3K4AA 1HN1A 4MAYB 2WBJD 1TVHB 4N8VB 2QQNH 3E0GA 4EEEA 3F7PC 4LF3A 3PQYA 3U48A 5JHDE 5I1EH 4P4KD 4QXUL 4OUUB 3ABZA 4MD0A 2HA1A 4O5LH 3BN9C 5A16B 4KQ3H 2G2RA 2IPKA 4C83B 1D6EA 1S7XB 3TYGL 1RZJC 4Z77A 5IB5A 2WIIA 3EOTL 1HILB 4Y1AA 4TSCL 1QSED 4PYGA 5F7DB 3H9ZA 1WBZA 2QHRL 1NL0H 4AEHL 2AI0H 5I73C 1XIWD 4ZUWA 4NYLA 2VLKA 1HOCA 4PJBA 1XGUB 1NCBL 4L4TD 1HH9A 3TYFA 1I4FA 5D2NE 1CGXA 4F7EA 4H5SB 4NP4L 3UYPA 5LQBL 4JY6A 3HZKB 1HQRA 2F9BT 1FYTE 2ZOLA 4M48L 2QSTA 4BFGA 5DUBA 3RWDA 2A6DA 4JFFA 5D7KD 3QXUA 4ZUSA 3QCUL 5E8DH 1UVQB 5ITFB 1MCSA 3I50L 4Y5VC 3GMPA 3N1QC 4PB0H 2NW2B 5IMMA 5B4MC 1NGXA 1VACB 4GAJH 3ZKQD 4G9DB 3QULA 1VPOL 2IFFH 5L8JB 4P9ML 4JZNB 1ZT4B 5KG9B 3EYUH 1FNGA 4KUZH 3P4LA 3VXSB 3OQ3B 5CJBA 1NC2A 3MRGA 3PDOB 5ISZB 3C6LA 3MLSH 1BQHB 1TJIL 3OAYH 2E3VA 3L7EB 1R5VA 2ZOKA 3A6BH 3AUVA 2IAMD 4UT6H 4ONFH 4D0DA 3G5YA 4U3XA 1BOGB 4ZFOB 3T0DA 1Q9KB 3D25B 3ZYIA 4Y4HD 3ARRA 5K9OB 1OCWL 3CSPA 3BZFB 1DLFH 3KJ6L 3VXQB 5I1LB 2XYCA 3LS5L 3GO1L 1U91B 3H2WA 5EG6C 1WTLA 3HNSH 2CKBB 3C60A 3BW9B 1K5NA 3QISA 3VD7A 1OGAA 3GJFB 4LLQA 3WXWL 4WHDA 5LGJA 2A2QT 4X6FA 1KTDB 4LCYA 2HFFB 1X5GA 1FYHB 3D85A 3I2CL 5ICYA 1ZS8A 3RGVD 5IVXE 5SWSE 3GB7A 4ISVB 2YD9A 3VWJB 1A14H 3BPNC 3QNXB 4I3RL 3V7AE 3D39D 4C58B 3T0EA 1FIGL 2FJGA 2EKSA 5FM5O 2W65B 4GAGH 3WD5H 1C5CL 4Z8FL 3PXHA 4HW6A 5TE6L 1I9RL 1IMHC 1EEYA 2EE6A 4DZ8A 2DN7A 4G6FB 4X9FA 1D3CA 3FN3A 4GRLD 4M1DL 1FC2D 1A8JH 4E9LA 4XPTL 1AXSA 4JDZA 1L7IH 2APBA 3QH3B 1K4CA 3NA9L 5FGCE 3PWJA 3QIWB 1LEIA 4FQ2L 1M7IB 4MVBD 1A6WH 4GAYB 3C5ZC 1OGTA 3QUML 1MI5E 4POYA 2PXYD 3LN9A 5FUOL 5E8OA 1MSPA 1C08A 1J1XH 1Y18B 3NCMA 3RUGB 4EI5C 1WFTA 1A1MA 4L4VB 4GBXB 3OJDA 5SX4I 2XQBL 2DDQL 5INCB 1M6OA 3RWHB 5L2JA 3TP4A 1EPFA 4ALAH 3QQNA 1Q9LB 1VFAA 2WMPA 3ES6B 3O0RL 4W4OA 3X11A 5IM7B 1BMGA 4U1MB 5C0AB 1DN0A 2OMBA 1J5OH 3NIFE 5DJ0A 4E41D 2X05A 3C60C 3IXTA 5EBLA 3STLB 4QWWC 4X9BA 5BV7C 5IW6A 4WI6A 2Z4QB 1EJOH 4YDKH 5MEQB 5D93B 5BVJB 3EDDA 4CRPA 5DQJB 1VCAA 3DMMD 1NGWB 1L4IA 2FX9L 2J8UE 3RWFA 4YDLC 1FZKA 2AKRB 2AK4D 3R1GL 4OD1L 1YEJH 3T0EC 4XP5H 5EIIB 2NXYD 4QOKD 3DVNA 1RK0B 3MRRB 1U8HB 2OXHA 2BSTA 1RK1A 3TN0D 1KNOB 2RB8A 3SBWA 5JUEH 5TH2A 1R5WB 4WUUB 4ZFZB 1IGCH 1OTSC 3QUKA 1KCLA 4L5FL 5E6ID 3DX7A 3AM8C 4Y4FB 5F1NB 5IFAH 1KPUB 1MQ8A 1U8JA 4IJ3C 1YMHA 2OL3B 5DVMA 1NC4A 4AQ1B 1JWUA 5D7JB 4OKVB 2ZSVA 5CD3B 1BX2B 2BXYA 4ELME 1OQXA 1NGZB 2Y4SA 3L1OH 4ETQA 1G9NC 5HVHB 3WIHL 5IHUH 3V7MA 5L7XH 1AGCA 5IVZA 2ZUUA 2EYRB 4Y16D 3T77B 1NCWH 1G7HB 1KCSL 4C55A 3S6CA 3WO3B 3ZKMC 1LE9A 5EOCJ 2ESVD 1B0RA 1SEBA 4LSPH 4HS3A 2VKXA 3RU8L 3HMXL 2FECI 3W9EA 3BKML 3WJLA 3LPGA 4V2CB 5EU3A 1MCBA 3ZDYF 1SHMA 1QFWM 3TIEA 1IQWH 3HAEH 3CZJA 4I4WA 1OHQA 5KOMC 2PTTA 3OKYA 3QDGA 3RUGF 4Z95L 4FTVA 3SCMA 3BPLB 3MREA 1HDMA 3SBWC 1MCOL 3SO5A 2O61A 2CK2A 1Q8MA 1FAKT 1QBBA 1PX4A 1D5IL 1NLBH 4UT7H 3WS3B 5J11B 4WV1B 3BEWA 2A9NL 3K8LA 3T4YA 1T2QL 3IJSB 5ADOH 3QYCA 3P4MA 1U2HA 5DVKA 1JPTL 1V7MH 5MERB 3MOAH 4OCWL 1FVEB 4QRPE 3QXDA 1NANI 5DK0B 3BEVA 4QKXB 3NZHH 1RIUH 3KPSD 4PLNC 1RIVL 1YNLH 2AJUH 3B9KD 1RVFH 3BX7C 4HFUH 4X6DA 2JTDA 4JAMB 3ORJA 1UENA 4HXAL 4MHHI 1P53A 4P2CG 3SEPA 4QGYA 5KJRL 4HK0B 4HKJA 2P46B 2ZUQC 2NX5B 2VABA 1D5MA 4L8SB 1SM3L 1U8MB 1WBXB 4E0RA 5KSBA 1YEDB 2R4RL 4RAVB 4K7PH 4XCYB 1A5FL 2YBRA 2I27N 2OQJA 5IMKA 3U0PB 2W60B 4UUJB 2X4RB 4OF5A 3ZKSD 4NRYA 4MA3B 4FQHB 4N1EA 4RDQF 1QLRB 5TDOA 3RBGA 1VKXB 1FO0B 1N5YL 4Q9BA 1CF8H 4F9LA 4XMLL 3TBSA 4ZD3H 2F5AL 5DGRA 4FOMA 5KS9B 2QKIA 3A67L 4C54A 1FL6A 5KVEL 5K9JH 1U58A 1CQYA 1SVZA 1JWSA 5TDPB 4P5KB 2D4DA 5FOJA 3FFCE 5E5MA 4RWYL 2I5YL 4JFHD 5FO9A 1OAKH 3LKOA 4PJEE 3L5JA 4L8CB 5J12C 4U1JB 1X5YA 3S5LG 1JF1A 4U6TA 2ATKB 2IMNA 4Z7WA 4KKLC 4JRXB 1QFWH 1AI1H 5ANME 3I9GL 4KKAD 3TO4D 2CIKA 3DTXB 4XBGA 3EOAB 2YN5A 1P2CA 4HH8A 5INDA 1QHOA 4Z78B 4LP5A 1G84A 4MXWL 3U82B 4FQXA 2IEPA 4PRIA 5MENA 1ACYH 1E28A 4R8WL 2VC2L 3MO1B 4GKZB 3BVNB 4RRPG 3VMOA 3U2SA 2ED9A 2MCPH 3MV7B 5CLTA 5FDYA 3DXAB 1H0DB 5TFSH 1A3LL 4OD2A 3NH7H 3V2AR 1CWVA 1AIFA 4JM2A 3V6OE 3PWPD 5IV2B 5E9DD 5E94B 1JI2A 2P24B 3CVHL 1BJMA 3L9RB 1KELH 3BD3A 2XWJB 4HS6A 5F1IA 2F74B 4J1UA 4IRJB 5DK2B 5FDWA 4PJGE 1DBKL 5T5NF 5I15H 2YPLE 4F7TA 3IDGB 2IPUK 3BISA 4R97C 1Z3GH 1MCWM 3AS2A 4BK5A 3AREB 1XGYH 3QNZB 1K8DB 1X6NA 5GJSL 5F3BB 5GS0D 4BQBA 1IM9B 5BVPL 3HE7B 3DHJA 1AD9A 1S7UA 2BNRB 3P30L 4MLSA 3VRJB 4CUCA 1C12B 4WVRA 5IROC 5IMOB 1BZ9B 4OUOA 1T1ZB 5J9PB 5DQDL 1RHHA 2OR9H 5KS9F 1S5IH 1YEEL 3S4SA 2KPNA 2VITB 5DD3L 5SWZA 5E8PA 3VFSA 3BN3B 5DHYB 1LDSA 2FH6A 3KPOB 4O51A 4G8IA 2P48B 2R29H 1QOKA 4L8DB 4I13B 1VHPA 4S0SD 4N9GB 5EBWB 1T7VA 4G43A 4JM2C 4QXUH 2OR8A 4MXQD 1NEZG 5D5MA 4X6BB 1NBQA 3HUJA 3AXLB 2CDFB 1U8LA 2P8MA 3PL6B 3VGGA 2NYYD 3TYGH 1FL5B 2BVPB 3LKRB 2X4QA 3G5XA 2HFTA 3QWRA 3EOTH 4LLYA 1G9EA 4U0QB 4K71B 5CSGA 4CMHC 1S7QB 4TSCH 3WUZA 3BKCL 3TVMC 1B6UA 4NOFA 1OP3K 1NDGB 4NQED 3RI5K 3IFOA 1ADQL 2QHRH 4AEHH 1F4XL 5CMAA 3O2VL 1TQCC 5DRNA 3VGAB 4Q6IC 5C0IA 4J3WA 2RR3A 5M95B 1NCBH 3CX5K 5DYOB 2QLVB 1U8NB 1CXFA 3JV0A 3T2QA 4DZBB 5B3JE 4M1CD 3BH9A 2VDNL 4NP4H 5LQBH 2YK1L 3QNYA 4JHWL 4JFDA 2DM4A 4XWOC 4M48H 2VZOA 1AFVL 4HKXB 3DROA 3I85A 4Q74A 1J1OL 4KRPC 2R1YB 4NSKB 4M7JL 3QCUH 1RZ7L 1N26A 3EBAA 3VA6A 3I50H 4KK8C 2LU3A 4OSUL 4PRPD 1AO7E 4UV7L 4P5TA 1VFBA 1YQVL 2FHCA 3QUMA 4OD3L 4U1IB 1VPOH 1CL7I 3RTQD 1OAZL 3ULVL 1C5DA 4P9MH 2APWA 1DQML 1S8DA 4JVUA 3MRHB 3GMOB 3DX9B 3OR6B 43CAA 4GW5A 2MQ0A 4NO5B 1WAAF 3GMNB 3DI3B 3CPLB 2BVQA 4PJCB 3HN3A 4FG6C 4XWGL 3P0YL 1I1AD 4HV8A 1BLNA 4NHUA 1TJIH 4F37F 2ZCLL 4JRWA 4LPVA 2WUBL 1RY7B 4NDMA 3C6SB 3DX8A 3G9AB 3X13B 3RDTB 4MX7A 4HIXL 2V5TA 3AS3A 4ODWA 1OCWH 4PRHB 2J8HA 3KJ6H 4TNVK 3VXMA 5KSAD 3LKQA 3LS5H 1Z2KA 3GO1H 3VFGL 4Z76B 5FXCH 1S9XB 1DLHA 3H9HB 5D72L 4ZQKA 3VXUA 5JHDA 3T2NL 4XMPL 4WO4B 3WXWH 3CSYB 4K94C 1FFRA 5IBTL 2J1KA 1R3JB 3T8XB 1JGEB 4FS0A 3I2CH 1P9MC 1G6RB 1MFDL 3PGCB 4D8PA 1AGEB 4I3RH 2XPGA 1PY4A 3EO0A 1FIGH 5ITBL 1Q9OB 3O8XD 3MLPA 3U36B 1C5CH 4Z8FH 4P46D 1QFWI 3Q1SL 3WDIA 2JCCB 5TE6H 1I9RH 3LN4B 3CSBA 5CP3H 1S7TB 4M1DH 4F15B 4XPTH 3PIQB 4NQCE 3ZDXF 2V2XA 3NABL 1S7VA 3MJ8A 1UT9A 4HG4K 3NA9H 1LHZA 5IHZA 4ONHA 1A9EA 4FQ2H 1ZEAL 2NTFB 3D3VB 4OB5L 5LCVL 3QUMH 5IB3B 5IOPA 5JNYA 4EDXA 5FUOH 1KJ2A 2WBJA 3W0WD 3WIHA 2VNCA 2A6KA 1DQTA 1MHEB 4JFED 3KPPB 2ORBL 2BJML 1N4XL 2XQBH 2KUTA 4JFYB 2DDQH 2VAAA 1JN6A 3NPSB 3AC0A 4Y5YB 3BI9X 3DIFB 2WIMA 1HXYA 4LK4A 2IQAA 1XF1A 4KXZI 3O0RH 1X5FA 4JHZA 2R2CA 3HMXA 8FABA 1MWAL 1J0ZA 1QSEA 4LLWA 1I1CA 4G8EB 3RWGB 3BQUD 5DC0A 2ZG2A 1XCQA 1NMCC 5HI3D 3ARUA 1YEIL 5DVLA 3UTZA 1JHKL 2NR6D 4P2OB 2CJUL 2HT2D 4P4RA 1Z6JT 2VSDA 3TC9A 3U0TA 4L4TA 2XTLA 3H42L 2FX9H 2Y72A 1HCVA 1NFIA 4OCMC 5JIPA 4PJCF 1XR8A 3WFBL 2HTLC 3R1GH 4OD1H 2V17L 4WY7L 3HB3D 2X89D 5ILTL 5CJXA 1A02N 4YBLC 3RA7L 4HH9B 1EBAA 2OTWB 4AIXA 4X4MA 1ED3A 1CFNB 5GS0L 3C2AL 3WEXA 1CDGA 1YPZE 2QADC 4LPUA 5D2NC 3WE6B 4XBEL 5DMIL 4L5FH 3CDFA 1HI6B 2PW1B 2E8ZA 5M94B 5F7UA 1ODAA 3LKPA 2V2TB 3G5ZA 3VWKC 4DGIL 4U6YB 4LCCC 3MBED 1VB9A 4LCWA 1A6VL 4RMUA 1FFOA 3NIGE 2EDDA 1F6LL 5IVXA 1G7LB 4JCMA 4NKDA 1M05B 4JREC 3S34L 1K3IA 1UXWA 3T4AB 4WRLA 1JNJA 4NT6B 4DQOL 3WIHH 1KGCE 1G0DA 2PYED 1NJ9A 1UB5B 5F7NC 2IAMA 4BFBD 3OSKA 1GPOL 3L5WB 1C5BL 4MCZB 1J18A 1DBBL 1KCSH 1MHCB 2Y7QB 4Y4HA 3LAFA 3UTPE 2VDML 5HI4C 3RU8H 3ULUE 3HMXH 1E4XI 3BKMH 1WTGT 4NIKB 4NO3A 4DVBB 5FB8B 1G0XA 2UYLA 1G1CA 3FB7A 3O4OC 5FCUL 3BD4A 4HIHA 1LEKA 5C0EB 4U4BA 1EERB 2BC4B 4RZCA 5CP7A 3AAZA 1U93A 1KPRA 3DV6B 5CJXC 2DIAA 2NY1B 1DUYA 4LP4A 2GJ6E 2VLRD 3JSSA 4LOUD 4Z95H 5DRXB 3UTSD 2FX7L 3S5LB 5EIQA 3RGVA 1W72A 1MCOH 4Q2ZA 2O93L 2X70B 1D5BB 3D39A 4U6XB 5C08B 3SGJC 3QAZB 4V2BA 1D5IH 4J4PD 5IB1A 3WSQL 2A9NH 4XVTL 1T2QH 2FNBA 1LO5A 2ZUXA 2W0LA 1Q9WA 4C56D 3QEQE 1JPTH 5T3ZD 2JB5L 3VI4F 4GRLA 4OCWH 3B83A 4M5YL 3ZKNC 2VN7A 4NZRL 1RIVH 3EOBB 4CVZA 4IS6B 3RFZC 1JZ2A 4MDJA 3QIBB 3QI9C 3JUZA 1U8PA 2EO1A 4JGUA 3OV6A 3MRNB 4HXAH 5E2WL 5DHXB 1I9JL 1CTOA 2OK0L 2UUDH 3IDJB 1URLA 5KJRH 2B1HL 2VLLB 4OAWA 5D7IA 3E6FA 1G9NL 4MAUL 3KPNA 1SM3H 5ECJE 2BDNL 2WWMC 3MRLB 3QFJA 3EJZD 3KPMB 2R4RH 2IANB 1OQOA 3CVHA 1BBJB 1A5FH 4G8FB 4XI5C 4DFIA 4E41A 1A7BA 3OXSB 3TJEL 1BFOA 2EYSB 1JHTA 4WFHD 3C5SB 1N5YH 2H2PD 4XMLH 2H32A 2F5AH 5GGRY 2NNAB 3FONA 3DMMA 5MHSD 5GGRB 4KHXL 4NPYA 4WI3A 5FYJE 3VFPA 3A67H 3U4AA 5KVEH 2LVCA 1U6AL 4AM0A 5KANG 1CFQA 3O4LB 2AK4A 1OD9A 4RWYH 2I5YH 1CXEA 1MCIA 1VENA 3PHQB 3SKNB 4PRBB 4QOKA 2ADGA 1T7XA 3RZCC 4FQLL 2O5XL 1ZLUK 1JL8A 3TN0A 1NCUA 4QF1A 3QFDB 1A4JB 1AH1A 5E08L 3MA7A 3CFKB 4ZO6A 3QUYB 2MHAB 5IGXL 2CSPA 3GRWL 2ZUYA 2EDRA 3I9GH 2WM0A 5E6IA 1CQKA 5EU4A 1FNEB 4F9PA 3THML 2FGWL 3MRKB 3WJJA 1BD2D 3VFNA 1KIPA 1KULA 4N1CA 4WGVB 3N85L 4QRRA 4MXWH 1AXTL 3GMLB 4HULB 1NEZB 4R8WH 2YD3A 2VC2H 2EDNA 1BEYL 1NLDL 3P9LB 4K9EC 4PTTA 4KC3B 4X9GA 1UH3A 3DURB 1JZ6A 5DSCB 1G6VK 4M93B 5C09B 3VXTB 2F8XC 4PYHA 3F6IA 4Y16A 4PGDA 1A3LH 5DZNA 4LLDA 4D2NA 1AKJA 1OF2A 2R2HB 5DTFB 4LFHD 1UJ3B 2ESVA 3WFHB 15C8L 2VL5A 3CVHH 1ADQA 4NQVB 1OSZB 4L3CB 1DBKH 2VAJA 3K1DA 1GGIL 4JB9L 4N5ED 4HCRA 4QYOB 1E27B 5EU5B 1MRDL 1PY9A 2DTSA 4A6YL 4EVNB 5F9JA 1HZHL 4S1SL 1EIBA 1S9WA 2YD4A 4K3GA 1L6XA 5GJSH 4X5XB 3OKMB 3T08A 3F7VA 5BVPH 4GMTL 3GZKA 5IFJB 3HAEG 4MDIB 4Y2OA 2GTZA 1LNUA 2XOTA 3P30H 2UZXB 1BWMA 1F97A 4QXTB 1I1RA 2XICA 4YIQA 1JYVA 3M17B 4KI1A 3UDWC 1QO3B 3H7BB 4R3SB 5DQDH 2CLRB 3KPSA 1U92B 3FFCA 1PD6A 1KSRA 1YEEH 4H25A 3B9KA 5DD3H 4A2MA 4Z18A 2OJEB 3RZWA 5TGBA 4ODVL 1GH7A 1D9KB 1NCAL 1FFPB 4TSBL 4WNQB 5GRJL 1LO4L 1KT2A 1KLFA 1TNMA 5LBSL 1KJMA 5HI5C 2GITB 3BP5B 4KK5D 5BRZD 2XACC 5IJVA 3FQRA 3VXSE 4PGEB 4QGTA 4LSDA 2HLAA 5ISZE 1EHNA 2FWOB 3TEUA 3BMWA 3SDCC 3EYFB 3BKCH 2DBLL 1N8ZB 3CFJA 3FB5B 3UP1A 3VFTA 4P2QE 3ARBA 5JW5A 4O4YL 1ADQH 4KTEL 1F4XH 4L1DA 3O2VH 5EZJB 5HHPA 1ZGLB 1CD0A 1H15B 2QJDA 4U1LB 3OG6B 2VIRA 5E00B 1SYSA 4JKPL 2BCKA 4J3VA 2FLRT 2HJFA 4O00A 3CX5J 5HHNB 3DGGA 2VDNH 4ZNCD 2C3VB 5K9QI 1UQSA 2YK1H 1J8HE 4JHWH 4L4VD 2OR7A 3VE0B 4GBXD 5JIKA 3HPJB 5HVGB 4TUOB 4WI2A 1AFVH 2NY3B 3EYVA 4M7LL 4NNYB 2V5RA 1J1OH 4PJGA 4M7JH 2YZ8A 1RZ7H 4APQD 2B0SL 5JDSA 4EIZC 5I2IA 4OSUH 2Z8VC 2G9HA 4P3CL 4UV7H 4NQDD 3IGAA 1RD6A 5C0AD 5T3ZL 4PP2B 4M7ZC 4I3SL 1YQVH 4OD3H 3ULVH 1OAZH 4UINL 1DQMH 3BH8B 4UMGA 3KLAA 3CIQA 2R1WB 4J8RB 1I7ZA 2FBJL 3TT3L 1NFDA 1JHLL 1KIRB 3W11D 2OTPA 4L1HA 4XWGH 3P0YH 3TA3B 1KB5A 5DFWH 2ZCLH 1HHHA 1NAML 1W0WB 2WUBH 4R4BB 1QBML 3T3PF 3NA4A 5BW7A 2YA1A 2NZ9D 3ARBC 1RJLB 5GGVY 3U83A 3RUGE 5FM8A 2OI9B 4HIXH 4YBQC 3SDAC 1GHFL 5EC1B 5EUOA 5FYKD 3HNVL 3N1MC 1GGTA 4BQ6A 3VFGH 3DOSA 1WCBA 5I1CL 3L5XL 5D72H 3WXVL 3LQAL 4F7PA 3V6OC 4IMLA 4JHBA 2R2BB 3T2NH 4XMPH 2E5EA 4PRAB 5IBTH 3T0AA 3O9WD 5DJYB 3O11B 2EE2A 2FIRT 32C2B 4ZOEA 2ICWJ 2FL5A 4HDIB 5DUML 4BKLA 1MFDH 4POUB 2IPUG 1MRCL 2BOCB 5ITBH 2FRGP 1Q94B 4OLUL 1T80A 3U7YL 3Q1SH 5AAWA 3OX8A 5DJDA 1HHKA 2B4CL 1AGDB 3OAUL 4DW2L 4DKDC 5C0FB 2VLME 1WEJL 1UA6L 1A1NA 4I18A 5ETUB 1A4KB 4JKLA 3NABH 1FH5L 1O5DT 3MMEA 2I24N 2JJTA 2E7HA 3UZEA 4OZHE 5JR1L 4WUUE 1ZEAH 4KGLA 5DJ8B 4OGYL 4OB5H 5LCVH 2J2ZA 1CN4A 5D4QA 4OZ4B 1G7MA 1NMBL 4X6CE 3BP6B 1I7TB 1DDHA 2ORBH 2BJMH 1N4XH 4PR5A 4XCEA 1GJIA 5GS1B 5HD8C 3C8KA 5GPRA 4M6AA 2Q8AL 1EXUB 4N8PA 5JMRA 3HZVA 4LPYA 1VESA 5F6HJ 2X4PA 1MI5D 1MWAH 3DO3A 3LEXB 3PABB 1U8KB 4HUWB 1GC1C 1OB1A 1YMME 3REWB 5E4IA 1S7WB 1TZGL 1YEIH 2DI7A 1JHKH 1V8HA 1D6EB 2HT4D 2CJUH 4AK1A 3SKOA 2V7NB 3D0VA 2OTUB 2PCPA 5IG7A 5B39A 4FFWC 3H42H 2DLGA 1N6VA 3KHQA 4EIGB 1AP2B 2H8PB 3WFBH 4U31A 3MJ6A 4MNGE 4EN3A 2V17H 4WY7H 1T0MB 2BZDA 4TN9A 1WLHA 5ILTH 3SDXE 3RA7H 2NMSA 1MPAL 4UB0L 2APTA 5GS0H 5MI0B 3C2AH 2VXSL 3DRTA 3HA0A 2NX5D 4I18C 2F54E 4V1DE 3VXRB 4MNQB 2XTJB 4Q9CA 4XBEH 3DNKA 3G5VA 4XAWL 5DMIH 4AT6A 5FFLA 4JFOA 5CJ8A 3DRQB 3QXAB 5DJZB 3B5HA 3H9SB 4DGIH 3LEYL 3WN5C 4TYUA 5CBEB 1F11A 3WYRA 1JYWA 5JO5A 4OGXL 3IDYC 1A6VH 1U8IB 4HBQA 3SDDC 5HY9A 1PZUB 5GISL 3HNTL 1ITBB 4WWKD 4Z7QF 3OPZL 1FG2A 4Y5XC 3AB0B 4ZFFA 1A6ZB 3S34H 3RNKB 2EEBA 4AIZB 1NBYB 5DVOA 1I1AA 3IU3A 4DQOH 1WFNA 5GSVA 3X12A 1BZ7B 1QRKA 2R2EA 1ZVSA 2HKFL 1GPOH 2ZNXA 1A2YA 3C5JA 1C5BH 4S1DC 3CX2A 1DBBH 5GRXG 4HGMA 2LFGA 5DR5L 2VDMH 4NUGL 4JQIL 2VUYA 4ZYKA 4MJ5B 2YD7A 4TUJA 4YR6B 4HUVB 2UVFA 3MSPA 2QSVA 5H94B 5FCUH 3D1MC 3TWCL 4OF6A 4EN3C 3MCLL 1IGFL 3L3IA 3SKJL 2K7PA 1ZHLA 4XC1L 2WZPD 5C0CB 5CS7A 4JN1L 5C0JA 5D2LA 4O58L 2ITDA 2FX7H 1D5XA 2F5BL 2VKWA 4QHKJ 1V3LA 1REIA 1FFNB 3MFFA 3FZUC 1FZJA 2YD6A 3O8XA 3RVUC 3WSQH 2X4TB 1BQUA 4XP6L 4JPKL 4N0FB 3EGSA 2QV2A 2UWEE 4XVTH 3C8HA 5DS8A 3TLRA 1IAOB 1WJ3A 5I8KL 4X4XA 5CSZB 2JB5H 2OJZL 5ICYB 3G08A 5EU6B 3TFKC 1A22B 4UU9B 2XRAL 3LRGA 4M5YH 3WNNA 5HSFA 3RWJA 2DI9A 2KQMA 3MV8E 5DMKA 2ADIA 3PWVA 4P57B 2EKSB 4NZRH 1MAKA 1A64A 3VFWB 1JMZA 2DMBA 5CGTA 4JRXE 5F7MC 3W0WA 3I6GB 1FSKC 5IEKA 5E2WH 4JFEA 1I9JH 3IDIB 3BDBA 4PBXA 4R96B 1IKNC 1Q1JL 2OK0H 2X5PA 4G9FE 1IL1A 4PBVC 2B1HH 2VH5L 4U33A 3ARED 5HHOB 1R3LA 1VADB 2D7TL 2MKLC 1G9NH 4MAUH 1LEIB 4KI5E 2BDNH 4U2YA 4JRYB 5AZ2L 4UTAL 4P2RB 1OTTC 4PUBL 3V6FB 2V7HA 4L3EA 3TJEH 5EN2A 4PJ8B 3BQUA 3O6FC 5IFHL 1NUFA 4PREA 1A9BB 3MV7E 5JHLL 4N1HB 5E99L 4WI4A 5JZ7C 5FYKL 4LNRA 4G6JL 5FKAA 4A6YA 3CXHK 1P7HL 4KHXH 3REVA 3X11B 3C9NB 3ARGA 1MFNA 1U6AH 2DQHL 3HAEB 2X89A 5T1KB 1RAMA 3PJSA 3GKZA 3OKLA 4FQLH 2O5XH 4ENEC 4JZOB 2ITCA 1CDYA 1CVRA 3C8DA 3DVGB 3FT2A 1DCLA 5HPMA 1JYXA 2VDRL 5E08H 1FZKB 1T2XA 4X7FC 3MRBB 2APFA 3HHRB 5EULV 1H5BC 5D1XA 5IGXH 3GRWH 3PL6D 4TVPD 5A2JH 3RBSA 3DVNB 3THMH 5CBAB 2FGWH 3HKFA 1PG7X 2I9LB 3QUXB 1XF3B 5TPWL 1C1EL 1JRHL 3PE9A 2BRQA 1QLEL 3MBEA 2I9TB 3MRDA 2RHEA 4HKZB 3N85H 4MA1C 2M8XA 1WICA 1AXTH 2DBJA 3QUKB 3WNOA 2ARJQ 2MPAL 3PG2A 2IH1A 3H3BC 4YPJA 4JQVC 5J7CC 3BYYA 4IRSD 1BEYH 5EB9A 1NLDH 5IK3A 1FE8L 1YMHB 1T20B 4PV9A 3R06A 1BHGA 2VOTA 4P9HC 3CFDA 1T66D 4ODXB 15C8H 4ODBD 3SKMB 2C4FT 5BS0D 4N0UB 4W4NA 3Q6FB 5C0BE 4K7PY 4F3FB 3LZFL 3MNZA 1UZ6F 3ARGC 4MWFB 5FYLE 1T5WB 2YD1A 2GQHA 5E1HB 1MFCL 3GSXA 1NQBA 1I8LA 2EE3A 5DQ9B 1IEHA 1GGIH 1RFDL 1S5HB 4JB9H 2YPVL 5FGSA 5C1MB 4UDUA 3TBTA 2FEDC 1Q72L 1MRDH 4A6YH 3NCYS 4YAQA 3W9EB 1PGRB 1HZHH 3FFDB 4S1SH 3UTSA 3KXFE 3ULUC 3LVEA 3IAQA 3WL9A 5EU3B 2X9WA 1M1SA 1JZ8A 3LD8C 1X5ZA 3BYTA 1Z9OA 4UIMB 1ZA3B 1KTLB 1MFBL 4I4WB 3QRGL 5D1XC 5HXMA 3VD9A 1DSFL 4GMTH 2YOCA 4GRMB 1DVFD 1G7PB 4DN3L 4JKWA 2AV1A 4LHJB 1IC5L 1UADC 5DJCB 2HMIC 3RDTD 8CGTA 5ID0A 2RIKA 4R90L 4I0PC 3KPTA 4PRHD 3BEWB 3JBG7 4EQ2A 3HTLX 4BH7B 4U0RB 1FO0L 2Z9TA 4ODVH 1CG9A 1NCAH 4PD4K 4TSBH 3RL1A 1CFTB 5GRJH 3K4DA 2OBGA 1LO4H 4LU5L 4HJ0D 5LBSH 2X09A 4OI8A 5LGKA 1K9TA 4JJ5B 3TCLA 5BQ7B 4WI7A 3OAZK 3OGOE 4YHLL 4K9EL 3QIUB 2R4SL 3UTTB 4PJ9C 2H26B 4F33A 1CXIA 3U9UA 3ARDC 2DBLH 4JO2L 2QSQA 3RKDD 3I84A 4LLVA 3TF7C 4O4YH 1F45A 4KTEH 5ESAB 3ZHLA 4PGCA 5C8JB 4CVXA 4FMKA 4LMQI 2NZIA 4X6EB 3ROLA 2FIKA 3B3IA 2E9JA 1XGRA 1EEZA 4JKPH 1AHWC 3D3VD 1OD7A 3BWAB 3CDGB 1YN6B 4MAYA 1IILE 1UH2A 1TVHA 4N8VA 3EJYC 1DE4B 2HTKD 2VN4A 4PJAB 5J0BA 3SJVB 1ZANL 3G04B 4OUUA 5C86A 4M7LH 4C83A 1S7XA 1HQ4B 2Y5TB 4K3JL 2Q20A 2B0SH 3L3GB 2FYYB 4EI6B 1HILA 1BD2A 4P3CH 5T3ZH 3FAWA 4FXKB 5F7DA 5JW4Q 4I3SH 1H3XA 4URTB 4KDTA 1GL4B 2Q1EA 3OKDB 4B7IA 3S97C 3DUUB 2JCCE 2ADJB 2YXMA 4UINH 4P2OD 3TPUB 3V0AC 1GGUA 1XGUA 1OAUL 2FBJH 3TT3H 3DBXB 1I8MB 1J05B 4OZGB 4J2XA 1JHLH 3GSVB 5ERWB 3EHBC 2R0ZL 1AO7D 5DWUL 4H5SA 4KVNL 3CLFL 4LBEA 5IKCB 3IETB 3HZKA 1NAMH 3UAJD 1G9ML 4FQXB 4JO3L 4R0LC 5MEPB 1HYRC 1QBMH 1TPXB 4PRIB 4YXKL 3DLQR 3QEHB 4TQEL 1UVQA 5ITFA 2DM2A 5J1TC 1GHFH 3HNVH 4PJFE 2NW2A 4FFVC 3T3ME 5I1AB 4ZUTB 1VACA 5I1CH 5CUSL 4G9DA 3L5XH 5I30L 3W9DB 4PJXB 1TQBB 3WXVH 1JGVL 3LQAH 5GGSY 4MAYC 5GGSB 4JZNA 5E95B 1ZT4A 1NCDL 3BRFA 5KG9A 4PJHE 3NPZB 3FB6B 5DUMH 3RL2B 5ISZA 5AYUL 1MRCH 1INQB 1BQHA 4G8GE 5HYJB 2AJVL 3L7EA 4YXLL 4OLUH 2X10A 3U7YH 2WW8A 2KH2B 4LSQL 1BOGA 5DFVC 4ZFOA 3D25A 1Q9KA 3OJMB 2B4CH 4KDTC 3OAUH 4X8XA 4DW2H 1WEJH 4TVPL 4CW1B 1UA6H 3MZGB 1JYNA 3MV9B 1RU9L 3ELAT 4QLRA 4UV4L 5K9OA 5L0QB 1GGYA 3BZFA 2BOBB 2NXZC 3VXQA 1R5IB 2IQ9L 5I1LA 2Z91A 1FH5H 5J6GB 4L29B 3HI1B 1G1YA 5I76B 1U91A 5JR1H 1F5WA 1MCPL 1UG9A 3ALXA 4OGYH 2CKBA 1HXMB 4N90D 1MY5A 3BW9A 4S2SA 3GJFA 1NMBH 3VFVB 3MBXL 2NY1D 2HFFA 2PN5A 3WIFB 1KJ3L 5IVOA 4CJ1A 4ISVA 3VWJA 3QNXA 2Q8AH 3PWNB 5JA8B 2W65A 5HGBB 4KJWC 4R4NC 3P40A 4U1HB 1MCCA 2A83B 1TZGH 4LLMB 3LQZB 2JKXA 5CJOL 1YEFL 5F7YC 3S35X 3GHEL 3QH3A 4U7SA 2YA0A 2NY7L 3KYOB 3QIWA 3T0BA 1M7IA 2WBWB 4OZGF 4XPFL 2ICWB 4GAYA 2AS5M 4KROB 3QDJD 2X42A 3VDBA 1Y18A 2EDFA 3RUGA 4XX1G 4L4VA 1K6QL 3Q5TA 1MLCB 3BDXA 4GBXA 3OG4B 1MPAH 4NRZB 4UB0H 1CGSL 3NN8B 2VXSH 2GSGB 3RWHA 4BFIB 1FCCA 1KN4L 1BFSA 2EXYC 4APQA 4HLJA 3DHMA 3ES6A 2IAND 2V9QA 5IM7A 4XAWH 4U1MA 5C0AA 4NQDA 3RI5F 4JFDB 2C3HA 3WS6A 4XH2B 4AMKL 1JMXA 2R9HD 3STLA 4NN6C 3LEYH 4ZSOB 2OP4L 4PJXF 5C6TL 4FA8A 5DMGD 1DEEB 2DLEA 3ALPA 4OGXH 4ONOA 5MEQA 5BVJA 1NUGA 5ID1B 3QEGL 1SBBA 3HNTH 4X7CC 5DQJA 5GISH 1NGWA 3OPZH 4JR9L 3NCBB 4U49A 2HLFD 4PRDB 3VWJC 2AJYL 2QEJA 3RX8A 2AKRA 1N5AA 3GJFH 5EIIA 5TE4L 2HKFH 1RK0A 3MRRA 12E8L 4EDWL 1CD1B 1U8HA 4GW5B 2BNQE 1KNOA 5DR5H 5A1AA 3M07A 4GG6B 4NUGH 4H88L 4JQIH 3VGFA 4WUUA 4ZFZA 4MQXD 2F53B 2Y07L 3CK0L 3QIWC 1UKSA 1KGCD 4XGZA 2GYSA 4GLRH 4CNIB 4YHYB 1GC1L 1HNGA 4NDMB 3AGVA 1C16B 3TWCH 3DX8B 2Q8BL 4Y4FA 3GEWB 5F1NA 3MCLH 1KPUA 1IGFH 3SKJH 4PJ7B 4XCFL 5E8EB 4NRXB 4H1LH 4XC1H 1ZGLP 4JN1H 4OKVA 5D7JA 4O58H 5CD3A 1BX2A 2F5BH 5DD5L 5FM5M 1NGZA 3KPLB 3UJIL 4JHAL 4X80L 2YUWA 4DOHE 1NPUA 5ACLA 1IARB 4ZNEE 3O4LE 4XP6H 4JPKH 2J5LB 5C07E 3P9WB 3TH2T 4WHTB 5C09D 2EYRA 3T77A 1G7HA 4TNVF 5I8KH 2OJZH 3PHOB 2P7TA 2XRAH 4OGAC 5L88L 4Z5RB 4NFCA 1MH5B 4XNYL 4WTWA 4Z9KB 4K8RC 1UZ8B 1WFOA 2HVKB 3CDCA 4HUUB 3QEQD 4CU7A 4GO6B 1Q1JH 4IDLA 3BZ4B 2VE6B 2QSCL 1T89C 2R0WL 2VH5H 1LD9B 3OXRB 5H8DA 5IHZB 2D7TH 4LRIC 5F72S 1TXKA 5IOPB 1A0QL 5AZ2H 2GJZB 4UTAH 4MXVE 3WS3A 4WV1A 4PUBH 5GGQL 3IJSA 5FV2A 4HLZH 4P4KB 4Y4FC 4BSWB 4RAHA 5IFHH 5MERA 4I2XE 2JJSC 5J13C 4XTRD 1TCMA 1FVEA 1R24B 1EH9A 2Z31B 4PV8B 5E99H 3PNWB 1J0JA 1XT5A 4ZOBA 5FYKH 4G6JH 5D7JC 4NNPL 4KJQD 5DD6B 1OPGL 3BGMB 3CXHJ 4J3TA 3QXWA 2GSIB 1ZAGA 2DQHH 4PLJC 3EAKA 5HVHC 4OIBA 2W59A 4JAMA 1RZIB 1XZ0B 2VLJD 3VRLE 4EXKA 2QQLL 5FYJU 4PRNB 4PY8I 2I25N 1PQZB 5C7XL 1XIWB 2NY5L 3G6JE 3VXOB 3MX0A 2MCG1 4I48B 2PUQT 4HK0A 1FVCB 1LEGB 1P84J 5BOZG 4GKOA 2NX5A 1ETZB 4L8SA 4GG6F 2VDRH 1U8MA 1WBXA 1YEDA 4R4FL 3JTTB 4RAVA 4K23L 2ZZUT 4JDVB 4XCYA 3ZL4L 2A73B 4E42B 3U0PA 5MEOA 2W60A 2OSLB 4UUJA 2X4RA 4GQ9L 4MA3A 4OCNC 1YJDC 4FQHA 5TPWH 1QLRA 1C1EH 5EO1B 1JRHH 4HPYL 1QLEH 1DZBA 1FO0A 4GKNB 4LQFL 1PYWB 2DF3A 3K81A 4PJ7F 4YUEL 1BIIB 5KS9A 2XA8L 1ZLWK 3UJTL 3WLWC 5HDBF 2MPAH 5JOFA 4MZ3A 4HWEL 5TDPA 1RZ8B 4P5KA 5BZWB 4ZUVA 1FE8H 3V4VL 2H6PA 3BGFB 9CGTA 3KPRE 1JZ5A 4NKDB 4L8CA 4YZFE 3V5KB 2W0FB 1BVKB 1MCEA 1L6ZA 4U1JA 4WFFE 2ATKA 4JQXC 2X9XA 3LZFH 1MFCH 1RHFA 2DQIL 3EOAA 4LGPB 3P9MB 5F7HA 4MS8C 2H2SC 1RFDH 4TPRL 2YPVH 3MUZ1 1Q72H 2MOVA 4Z78A 3AY4C 1JZ7A 2J8OA 5DJ6B 5E03A 4PJDB 3GBLA 1RJCA 2VXVL 1ORSB 3EYSL 2IPTL 4JO1L 3MO1A 1MFBH 1J1PL 3QRGH 3BVNA 4GKZA 3RWCB 1DSFH 2PO6D 3MJ9L 3TA3D 3DXAA 1H0DA 4DN3H 4S1QL 1IC5H 2OZ4A 3L3HB 4U05A 2N56A 4JGJA 5IV2A 4RBPH 1MJUL 3EDFA 5E94A 1TCRB 2P24A 2Q76A 3RAJL 2AXGB 4HT1L 4R90H 2CDGB 3L9RA 4X7TA 2XWJA 2F74A 5I1DB 4IRJA 5DK2A 5D1QB 1N59B 1FO0H 3SE3C 5AD0B 3IDGA 4D9QE 3S36X 3K3QA 4PD4J 1BFVL 4HWZB 3WFZA 4LU5H 3AREA 4Y8DC 1K8DA 4GRWB 1WAAA 1MOEA 2J88L 2GK0A 4PLKC 1IM9A 2PXYB 2VTFA 3I3EA 3PWLB 4YHLH 4K9EH 3HE7A 4MA8L 1IRAY 1OAYL 3C09C 5GGUB 2R4SH 4UAOB 2BNRA 3VRJA 1C12A 5IMOA 4JO2H 3KR3L 1BZ9A 4KJWD 5A3IC 1T1ZA 4LVOB 5J9PA 3KPNB 4KI5C 1K8IB 2J6EL 4D0BB 2ID5A 4HAGA 2VITA 2F8VA 2DAVA 2WANA 2CKNA 3KPOA 1CBVL 1KCRL 2GCYB 2BVYA 4DGYL 1KLGB 4L8DA 4N9GA 1YA5A 5EBWA 1SJVA 3OF6D 4ZODA 4LSTL 1ZANH 2W0KA 2YUXA 2Q7YB 3ILQD 3NCEB 2QHLA 4X6BA 5DXWA 3AXLA 2CDFA 3KLHC 3PL6A 4K3JH 4GKSB 1FL5A 2BVPA 2ICES 4KV5F 3LKRA 5KVFL 4IRJC 4ESKA 1S7QA 1T0NB 1J8HD 3ZLQC 3LKSB 5D7LD 1NDGA 1JGDB 3KJ4B 3RVXC 3S35L 1IC4L 1OLLA 1X7QB 1Z5LB 4PJDF 4LIQL 2X4OB 1LK2B 1WGOA 5J8OA 5D6DC 1OAUH 2HT3C 5DYOA 1U8NA 1FP5A 1M7DB 2VZUA 4IRSA 3NIDE 2R0ZH 4DZBA 3HE7C 3BPOC 5DWUH 4KVNH 3CLFH 2AEPL 1G9MH 1MJJA 4JO3H 1MNUL 2CRIA 4QCIB 4YXKH 3V6BR 1A6AB 2R1YA 4HC1A 4NSKA 5DHVH 4TQEH 5DI8B 3VXRD 4JKKA 2XTJD 3KLSA 2NY4B 5HHMD 4LLDB 5CUSH 4YK4B 2FH8A 5I30H 3IFPB 3H9SD 1JGVH 1CR9L 4F58L 4AYFA 1AQDA 4LVNB 4U1IA 3PQYE 3K8KA 3MRHA 3GMOA 3DX9A 1NCDH 4NCC1 4BZ1L 4GRWF 4NO5A 2RJMA 2JF1A 3GMNA 3CPLA 4PJCA 1T83A 3O6ML 4U3CA 5AYUH 4B0MM 1OY3B 1MREL 1DQLL 3KS0J 1ZVYA 1RUML 2AJVH 1ONQA 3TV3L 3K7UA 4YXLH 4K71C 1II4E 4LSQH 5KAQF 3C6SA 1H8NA 3X13A 3RDTA 4QHMB 2DJSA 1MRFL 5JW4M 4TVPH 1RU9H 4G3YL 4UV4H 4OFKA 2VLKE 4PRHA 3O41B 2IQ9H 1AGFB 3RHWF 4OF8A 2JJWA 4Z76A 1EBPA 1S9XA 3H9HA 3S3JA 4CN4A 1MCPH 4MNQE 4PS4L 5I75B 5F97E 2P5EB 5DJXB 1I9EA 4MQTB 4OCRL 4WO4A 2ENYA 3CSYA 3MBXH 4YDJB 4FMFA 1R3JA 2BSED 4LKXB 3T8XA 4U6HB 3SY0B 2AXHA 4JFFE 3QG7L 1G6RA 2E7LC 1KJ3H 3PGCA 1AGEA 1DQQB 1ORQB 1X44A 3I6KB 1Q9OA 1KACB 3U36A 5D1ZD 1KTKE 3ZE1F 3LN4A 2ZWLT 1ZT7B 1LK3L 1S7TA 5EU6D 4XC3L 1QFUL 2YUVA 1YEFH 3PIQA 2VXTL 5CJOH 3TZVC 4POZD 1E4KC 3U79A 1HHGB 1ZK9A 3GHEH 2NY7H 4DFHA 3DETC 2NTFA 3D3VA 4XPFH 3CFJB 3GMMB 5IB3A 3UROR 1YMMD 3HC0B 4OZIB 1MHEA 1IKFL 1K6QH 3KPPA 5HHPB 4NJ9L 4JFYA 4WW1B 5AWNL 1CGSH 1F4AA 5HHOD 1B88A 4Y5YA 4XP4L 5C0CE 1KN4H 3ARZA 3DIFA 3OL2A 5T3XD 5DO2C 4KTDL 4BH8B 3LRHA 4AMKH 4G8EA 5GGVL 4PJ8D 4ORGB 3RWGA 1NBZB 1OGAE 2OP4H 3MCG1 5C6TH 3ZE0E 5AYQA 4WO4C 3OKOB 3QDMB 3LMJL 4P2OA 5ESVB 3CC5A 3TNNB 3QEGH 3TO4B 4BA8A 4Y5VB 4I0CC 4JR9H 4Y19B 5E1AB 4MGXA 4Z0BL 5ICZB 4G7VL 2AJYH 3I3DA 5IIEA 4PPTA 4YHIB 5F1KC 5TE4H 3TH4T 1ACZA 1HH6B 1FLTX 4WU7B 12E8H 4HH9A 4EDWH 2OTWA 1CFNA 5HYFA 3GI9L 4F15C 4H88H 4GXUN 5I1IL 1CDBA 5L2KB 3WE6A 4J3UA 1SEQL 2Y07H 1HI6A 2ED7A 2PW1A 3CK0H 3RY6A 4I3GA 3BZDA 2V2TA 1MWAB 2BSRB 1GC1H 3PWPB 4L8BA 2Q8BH 5E9DB 4P2RE 4E5XB 4XCFH 4XVJL 5SWQB 3CCHB 3ULVF 1G7LA 2HWZL 5EUOB 1M05A 5DD5H 1U0QA 1CGVA 2E7MA 2NY2C 1WCBB 3T4AA 1U3HD 2DKUA 4NT6A 3UJIH 1Y6KR 4JHAH 3O45B 3T1WA 4X80H 1QRNB 3J7HA 5CCKL 1UB5A 3L7FB 3L5WA 5GHWL 1NMAL 2P49B 2D03L 3MV11 1B4RA 1MHCA 1BJ8A 2Y7QA 3SGEH 1K85A 3MRPB 4BKLB 4WI9A 3FCTB 5L88H 2FJFB 1UB6B 3NGBC 3BPNB 4I5BB 4HD9A 4JANB 4XNYH 2ZUSA 4DVBA 5FB8A 1FVDB 4EBQL 1RZKL 5C0EA 2BC4A 4R2GD 4LDEB 2XQYG 3DV6A 2XKNB 1FC1A 4NOBA 4OZIF 2AP2A 5DRXA 3LDBB 2YKLL 3FL7A 1VEOA 2QSCH 2R0WH 3EZ8A 3S5LA 2X70A 5F7WC 1D5BA 3QHTC 4U6XA 2EDKA 3HG1D 5C08A 1A0QH 3C5ZB 3CD4A 4W70A 3L95B 4AENB 3UEZA 1DUZB 2CUHA 5GGQH 4EI5B 4M9OA 4TTDC 5GRWA 2RQ8A 5EFIB 1QFOA 1CXKA 3UZQA 4G9FD 5E2TL 3VI3E 4X5LA 5IB4B 4HIIB 4NNPH 4KZEL 5H37G 1ZLVH 2V9RA 1GRWA 3EOBA 1OPGH 4IS6A 3QRFM 4RRPA 3HCVB 3QIBA 4LPCA 1J10A 1QBLL 4ZAKD 4NQEB 5SX5K 1WQVT 5EO0B 2QQLH 3W39B 3MRNA 5DC9B 1WITA 4JE4B 4LFHG 1U3ZA 3QUZC 5J3HC 5C7XH 4QHUB 2NY5H 4WHYH 3IDJA 4UQ3B 2VLLA 2DD8L 2C1PB 1BP3B 3KG5A 4KKCD 5I8CB 3MRLA 5CD5C 4RNRA 4YDLB 3KPMA 2IANA 4R4FH 4K23H 1BBJA 3BMVA 5E56A 1KN2L 3ZL4H 4G8FA 2YRPA 3CVIL 3QIUD 1P1ZB 4JY5L 4GQ9H 3OXSA 3AS1A 1CU4L 2EYSA 1TNNA 4HPYH 3T65A 3QDGE 3C5SA 4RGNE 1K4DB 4LQFH 4FTVE 4YUEH 5D8JL 1N2RB 2NNAA 1I75A 2DYPD 2XA8H 5CEYB 1MFEL 2E8YA 3B2UD 4PRPB 3FN9A 3UJTH 2FO1A 1QVOB 3CZFB 3QO0B 4DKFL 4HWEH 3OB0K 2Y6SC 4KKBC 4H8WC 5DA4A 3IKCB 1PSKL 3SKNA 4PRBA 3RTQB 3V4VH 2BMKB 2EDXA 4OZFH 2MFNA 2EIZB 2BY1A 2NY6D 4KMLB 1FG2B 4XCCL 4PGJA 3QFDA 1A4JA 1WISA 3V0VB 1IGJA 4XNMB 4M7LT 3BUYB 3CFKA 3ROOB 3QUYA 2BVEA 2MHAA 5EO9B 4Q58C 1K2DB 2J6EA 1FNEA 2DQIH 3QIBC 3MRKA 4X6DE 3F7QA 4MJ6B 2EE9A 4WTZG 5I16B 5JQ6L 4TPRH 3UTTE 4HJGB 2EXWD 3GMLA 1NEZA 5KSAB 4Z7OE 1F13A 3MLYL 3BD5A 3CDYA 2VXVH 3EYSH 1QPPA 1RURL 2IPTH 4JO1H 5FYLD 1YECL 2IC2A 1J1PH 1FGNL 7FABL 3P73B 3MJ9H 3P9LA 4U3HA 3DURA 5DSCA 5C09A 2JIXD 4S1QH 2R2HA 1HSAB 5T3XL 4H1LG 1ZWIB 4KPHL 1MJUH 1U41A 1UJ3A 5DTFA 3WFHA 1DEDA 4OBRA 4KK9D 2FO4B 3RAJH 4PJAE 4DK6A 3F8UB 4NQVA 4HT1H 5SV4A 1OSZA 3B8YA 4P46B 1OW0A 4L3CA 1XGTA 2X1OA 1A7QL 4MQ7B 3INUL 3HE6D 5FM4A 5B8CC 3JTSB 4QYOA 4D9RD 1E27A 3G08B 1G7JB 5EU5A 2ZJSL 4XVUD 3RWJB 1BFVH 1SY6L 4EVNA 2VDPL 3FN0L 3K8MA 1X3DA 3D69B 1AGBB 3H3KA 5C6WH 1EGJL 4X5XA 3OKMA 2J88H 4Z7WE 3QUYC 2BFVL 3K46A 4MA8H 4N5UA 1OAYH 5IFJA 4MDIA 4Q9QL 2UZIL 2BY0A 4QXTA 3KR3H 4MMXC 5ACMA 3M17A 2ZUQB 1QO3A 2EH7L 4B53A 3H9YA 4R3SA 2CLRA 3QBTB 4PRIE 2J6EH 1U92A 1MIEL 3MV9D 5MENE 3OGCB 3KPQB 1BVLB 4HUKB 2OJEA 1CBVH 3I02B 1EV2E 1KCRH 1D9KA 1QSFB 3ARFC 5D9SB 4DGYH 1FFPA 4WNQA 4MCYB 4HLZG 4B50A 4OV5B 3EFFB 4LSTH 3WFEL 2GITA 1UJ3C 1YY8B 3BP5A 1CFSB 3S88L 3C87A 4ZXBD 3ZKXC 3JV4B 4RDQG 4PGEA 1RZGB 4IRZL 5KVFH 1NKRA 5T5FL 3TIDB 2FWOA 4P99A 1MVFA 3EYFA 4QT5B 5FUCE 2EEDA 1N8ZA 3FB5A 3NCFB 3WHXB 3S35H 1IC4H 5DRWB 4BQCA 1AR2A 5EZJA 4LIQH 3BXNB 1ZGLA 3WIIL 1CD8A 3ZDZE 3MLWL 4HZAA 1H15A 4U1LA 5E00A 5HHNA 4KK6D 1F90L 1G7QB 2DRUA 1ZHKB 4Z7UB 2AEPH 3JV6B 3VE0A 3HPJA 2XNAB 1MNUH 2X41A 4YHNB 4TUOA 4MSWB 4NNYA 4BQ9A 1S78D 4QHNB 3V7AG 3TJHD 2PYEB 3M45A 5SWZE 2FLBT 3R06B 3QG6B 4P23D 5CKAA 4PP2A 3CLEL 2F15A 1D9KC 3S3PA 1F3JB 5C0GB 1CR9H 1JNLL 2PW2B 4OTXL 4F58H 1EFQA 1IEBB 2CRYA 1JUFB 1MIML 4RFNC 3BH8A 1T6WA 4BZ1H 4LNVA 2XWTB 2R1WA 2GTWB 1KIRA 2ERJC 3O6MH 4M61B 3DYMA 4XAKE 3UTQB 2PO6A 5DDHA 3TA3A 1MREH 1DQLH 5L8KB 2B2XL 1RUMH 1JF6A 3TV3H 1JWMA 2VLRB 4X8JB 1W0WA 3UTSB 4R4BA 1N64L 2GW5A 3EDJA 4NKOB 1RJLA 3NAAL 2AAVA 5DJAB 3BP7B 1TVBB 1MRFH 2Z0BA 4W68A 1F6AB 5BOPA 4G3YH 2V9TA 4U1GC 2EEAA 2HG5B 2F53D 4G8GD 4U1SB 4C56B 2UVEA 4PS4H 3FRPA 3OKKB 4OCRH 2R2BA 3F7YB 4JFDE 5AG9A 2L0DA 3NZ8B 5F9AC 3F12A 3MGAA 4PRAA 5DJYA 2Q6WB 5HGDB 5FO8B 4OLVL 32C2A 2NY3C 3V5DB 2NY0C 4UI2A 3QG7H 4LLUB 4HDIA 1VFUA 4JGMA 2BOCA 3GSUB 3K74B 3FTGB 2ZCKL 4PJIB 1NGQL 1Q94A 1NAMB 4DEPB 1QQDB 5JIIA 1AGDA 3KYKL 1NCNA 3TCLB 5C0FA 1LK3H 1F02I 2DQUL 4XC3H 5FCSH 1YY9D 1QFUH 4JPIB 5ETUA 1KEGH 2VXTH 1A4KA 1H3VA 1CGUA 5GZOC 1I8IA 4KQ4L 4YDIL 5DJ8A 3W82A 3O3DB 3JZ7A 4LLVB 3VFRB 5HYSG 4OCXL 4OZ4A 4Z7UF 4NZJA 3BP6A 1IKFH 1I7TA 1CIDA 1B4JL 4NJ9H 4CVXB 4Q6IB 5AWNH 4OT1L 5FYLL 1OVZA 2OI9C 5GS1A 4KGJA 1MHPL 4K3EL 4XP4H 1NDMB 4U7KA 3VXME 1FL3B 1EXUA 1QTYT 4KTDH 4WW2C 3PABA 3LEXA 5JOPD 1U8KA 3MUGB 4HUWA 5D7LA 3VXUE 5GGVH 4NFBA 2CO7B 2WQRA 3REWA 1S7WA 4QNPF 3LMJH 2GAZB 4I9WE 4KRPB 5GGTL 2Z31D 5IW3A 3G6DL 2V7NA 2OTUA 3FQNB 3FOMB 2YSSB 3RVTD 2C3WA 3WDJA 1BD2B 4Z0BH 4G7VH 1AP2A 2H8PA 5A43C 3MYZA 1T0MA 4XHQA 5D96C 3RPIB 1R3IL 3VGDA 1KV3A 4R26L 3ZT5A 3GI9H 5EOQL 1CD9B 5K59F 4U1NB 4Z7VB 4YHPB 5I1IH 3VXRA 4MNQA 4LBEB 1SEQH 3QPQD 4DCQB 4PLOB 3DRQA 3QXAA 4YHOL 5DJZA 3KLDA 3H9SA 1M71B 1XAUA 5CBEA 2EDOA 1N3NB 4XVJH 2BNQD 3JVGC 1U8IA 3IS1X 4Q6YA 2W9DL 4Y4KD 2HWZH 4ZDHB 1A6ZA 5GS1C 3RNKA 2AGJL 1NBYA 3QT2A 4AIZA 4CDGC 4FZ8L 2IADB 1U95B 1BZ7A 1KIUA 2R56L 5C0ND 4AY0A 5CCKH 5ALBL 4PJIF 1QSEE 4JN2B 5GHWH 1NMAH 2Y25A 3T2OA 2D03H 1SJXA 2C5DC 2YPKB 5E2JA 1NBVL 4X0KB 4MJ5A 4PJ5B 4L4TE 1FAIL 3I6LD 4YR6A 4WCYL 3BAEL 4HUVA 4Z7NE 1KCVL 4BZ2L 5H94A 4EBQH 1QFPA 1RZKH 1TFHA 2A0LD 3GMQB 5T1DL 5FEBA 1WIPA 1QHPA 3D0LB 1BBDL 4X4ME 5C0CA 2YKLH 5D7KE 3MNWA 4R7NB 2Z91B 5MI0C 4ZS6C 1DQJB 2JB6B 4U1KB 4O02L 4XCNB 1MJ8L 1H3PL 1CGYA 3HR6A 1OTUD 1FFNA 4AH2B 5JXED 5BXFB 3J8F7 4S2SB 1EHXA 3P3YA 2X4TA 2QR0B 4N0FA 4S10A 4UDTB 2H41A 3ZE2E 4LCUB 1LO0L 1IAOA 3U30B 1LO2L 3ZSSA 5CSZA 2W9EL 4LCWE 5DRZB 5BRZB 5EU6A 4UU9A 5E2TH 4QRUB 1XF4B 1WIUA 1AQKL 4Y2DD 3BZEB 1FNHA 5HYEA 4P57A 4KZEH 3UTOA 3VFWA 2V5MA 4ZO7A 3VRIB 1P7QB 1T3FB 5GS3A 3S36H 1QBLH 5D1QD 2QTEA 3I6GA 5HDOA 3DV4A 4G42B 1YEHL 1NMCB 4LDOB 4OFYD 5CKGA 3IDIA 5IBLC 1NH6A 4R96A 4H1LB 4FXGB 2DD8H 3CUPB 4HEPG 5HHOA 1VADA 5D5MF 4X7SL 3C6LC 3HUJF 4Z7VF 1CLZL 3NCCB 4RQQB 4JRYA 5K33A 1F4HA 1KN2H 4UTBL 4P2RA 2XN9D 1I3VA 3CVIH 5CINL 3V6FA 1FG9C 4JY5H 4CKVX 2DKSA 4YBLB 4PJ8A 1CU4H 5C0RL 1A9BA 1ZE3C 3HR5B 4UNUA 1FZMB 5D8JH 4TNWK 4APQB 1QSZA 4XNQB 1SY6A 1MFEH 1V05A 5D2NB 3C9NA 4NQDB 4DKFH 4YBHA 1JBJA 5DVNA 3D39E 3RKPA 4IOFC 2YR3A 3HAEA 1FYTB 3VWKB 5J89A 1PSKH 4LCCB 5T1KA 3RVWD 4G5ZL 2D7QA 4JZOA 3EO1A 4FZEL 4RGMC 2YA2A 4XCCH 4JREB 3DVGA 5CHNB 5BJTB 1HYSC 1FBIL 4N0CC 1B0GA 3MRBA 1N5AB 2DOCA 2EC9U 5GSRB 3RRQA 4BUHA 1EHLL 2COQA 4J3OC 3QPXL 1T04B 5CBAA 3VG9B 2I9LA 3QUXA 4MD4B 1XF3A 3UO1L 1BECA 5JQ6H 2I9TA 3KPRD 1IAIL 2NLJB 4HKZA 3BP4B 4I0KA 1CICD 5GZNC 5KSVB 3MLYH 5L9DL 5D7IE 2R39A 4XGZB 1Z9MA 3QFJE 5GRUL 2WQ8A 1UCBL 4G7YL 1RURH 2R0KL 3O4OB 1YECH 3QCTL 1FGNH 7FABH 3IT8D 5C2UB 4E41E 4ETYA 3O3BB 1T20A 1KLUB 3O9WB 3GSNL 3RP1A 5HYQA 3MRMB 3MODL 5T3XH 4KPHH 4ODXA 4CADA 1IT9L 2VQ1B 3RGHA 3SKMA 4N0UA 1V3MA 3Q6FA 1H8OA 4W4OC 4F3FA 4MWFA 1T5WA 2A6IB 1IGIL 2AK4E 3O6KL 2NY4D 1A7QH 5DQ9A 1S5HA 3INUH 4QOKE 2P7TB 2ZJSH 3MA9L 2AQ2A 4F7CB 1SY6H 5SWSB 2B5IB 2VDPH 3FFDA 1UYWL 3FN0H 3GSWA 5J06A 4XHJD 5E4EC 4QXGL 1EGJH 3MLVL 4UIMA 2M1KA 1ZA3A 2DL9A 4JY4B 1KTLA 4H8WL 5DUPL 3RVVC 3QI9B 1AJ7L 3ECBB 2VWEE 1P6FA 2BFVH 5E8NB 1SBSL 4OI7A 1VA9A 4GRMA 1AR1D 1G7PA 3QUXC 4Q9QH 2UZIH 4XZUB 3U7AA 3MLTB 1MF2L 2VRAA 2KZWA 5DJCA 5EBMB 4QRRE 2P5WD 2LQRA 2EH7H 3RJDA 5FGCB 2XFXB 4HIEB 5ESQB 5H2BB 1MIEH 3HRPA 4M1GL 1MI5B 1RULL 4BH7A 4OLXL 3LKNB 5ELIA 3RNQB 2P5ED 5F7FA 3IDNB 1CFTA 3MFGB 4ODUB 4QHLB 4MA7L 3ULVD 2ESVE 4RISL 3WFEH 1WWCA 4JJ5A 5BQ7A 3DYOA 3NOIA 3S88H 4JDTL 3QIUA 4IRZH 3UTTA 2H26A 5T5FH 3RZCB 3EJJX 3VFOB 1MFAL 3GMRB 4WHYG 2DYPA 2J8UB 5ESAA 3BN9D 3WJLC 3ISWA 5C8JA 3WIIH 3V52L 5MEOB 1KF9B 3MLWH 4X6EA 3F65A 2AXJA 3K2UL 3BIBX 1F90H 3BWAA 3CDGA 4RGNC 1YN6A 2EZ0C 3U46B 3FRUA 2A1WL 1DE4A 4WWKB 3SCMC 4PJAA 1HNFA 3SJVA 5JOFB 3G04A 1OP5K 1UXSA 5J6HB 2B1AL 3KPSE 3WO4C 4EZMA 1HQ4A 2Y5TA 4ZUVB 4QRQB 2H6PB 2YC1B 2BK8A 2FYYA 3L3GA 5TJWK 1CT8B 4EI6A 4LSUL 1TZIB 4FXKA 3SE9L 4U0RC 5HYSB 2JJVA 1TITA 5CGYC 2IBGA 3B8SA 3CLEH 4OZFG 5HGAB 4RFEB 1JNLH 5DMJB 2OS7A 4OTXH 3GM0A 3SGDH 5I0DA 3OKDA 1MIMH 3DUUA 3QDMD 2ADJA 5IVXF 2Z92B 3TPUA 3T0VA 4X98B 1Q0YL 5KN5B 4LSVL 2B20A 4Y19D 3DBXA 5FGRA 1J05A 4OZGA 1I8MA 2EDEA 3GSVA 3H7LA 4MB4A 5ERWA 5B4MD 3B6SA 2B2XH 5IKCA 3IETA 4JPWL 3HC4L 5MEPA 1N64H 4LEXL 1FQ9C 4XPGL 3NAAH 2W92A 5GRVL 2DI8A 3QEHA 2Y9RT 2FD6L 4Y88A 5KANI 3LH2L 5L2KD 1A47A 2IF7A 1PVHA 4JFHE 2HN7B 5I1AA 5ENWB 4ZUTA 5MP6L 4Y1AD 3W9DA 4JKMA 4PJXA 4YHML 4F9LC 2Q76B 5GGSA 5HTSA 4J7RA 4X7TB 3IRPX 4OLVH 6FABL 3FB6A 3RL2A 3NIFF 3MRQB 1UM5L 1INQA 5HYJA 4ZG1A 1QRND 2ZCKH 1NGQH 1KYOK 2AEWA 4QRPB 3IB4A 4UBDC 1SJEB 3C08L 3PWUB 4F37K 3EYQC 3KYKH 4M62L 2NCMA 2DQUH 2GK0B 4CW1A 4JFFD 4G6AC 3MV9A 2J8UF 3LB6C 2BOBA 3EIFA 5IVNA 1R5IA 5DHVB 5J6GA 2ARJB 4L29A 1NFDE 3HI1A 4KQ4H 5I1HL 5I76A 4YDIH 3BUTA 5CJ5A 1WZMA 1F3DH 3SDCB 1HXMA 1T2JA 1GZPB 4OCXH 3WNMA 3U4BL 5HGHB 3VFVA 4FQXC 3KHOA 3QB7C 1KC5L 3PWPE 1TPXC 2JK5B 1B4JH 2VERN 2BY2A 4OT1H 5FYLH 5ICXB 3WIFA 4WFGD 1ZHNB 1MHPH 3ZZ1A 1NC2D 1IGYA 4K3EH 3TNMB 1JVKA 5EUOE 4FQ1L 2ZG3A 3PWNA 2CGRL 3C5ZD 4RFOL 5HGBA 2X4SB 3BHBB 3HS0B 4EI5D 1MCKA 2IALB 4U1HA 2FEEI 2A83A 1TTFA 2FSEB 4LLMA 3LQZA 4GQPH 4ELMF 5GGTH 1OP3H 3G6DH 1PZ5B 5LKNA 2RFXB 3QCVL 3KYAA 4TRPL 4NQSB 4HF5L 3KYOA 4PJEB 2ICWA 2PTVA 5FUCC 3C60D 1RMFL 1H8SA 3AMLA 4QWWD 1W2KT 5HJ3B 1OGAD 1MLCA 1R3IH 3BRGC 4NRZA 4R26H 5IWLA 3NN8A 4ODTL 2GSGA 5ANMB 5EOQH 3D85D 5EPMB 4BFIA 4IRSB 3OR7B 1EA9C 5L0QC 4GOSA 3T0ED 1T7ZA 5CWSB 3EYOB 1MJJB 2CDEB 4YHOH 4C57C 5IF0B 4XH2A 4UILL 4ZSOA 4LVEA 7CGTA 1DEEA 5BS0B 1I7UB 5CP3A 3S9DB 5ID1A 2W9DH 4KUCD 3SDAB 5HYIA 3VJ6B 4NBYB 4MJ2A 1OTSD 4PRDA 5JTWA 1TIUA 3PDDA 1DBML 2AGJH 3E2HB 4FZ8H 4K07A 2DM3A 2ZUTA 2R56H 2EDWA 1AQDB 5ALBH 3U0WL 2RBLA 4NQEE 5HBBA 1CD1A 1N6UA 1JK8B 3P4NA 4GG6A 2VDOL 1NBVH 1Z9SA 4LMQE 3RX7A 5LVEA 3SO3C 5KVMC 1FAIH 1ONQB 1DVFB 3BSZL 2F53A 3BAEH 4WCYH 4U2ZA 1KCVH 5CZXC 4F2MB 1ES0B 4BZ2H 4CNIA 1E4JA 1C16A 1MCHA 2QQKL 4KROC 1FJ1B 1WV7T 5T1DH 4PJ7A 2FECL 5E8EA 4NRXA 3ZKMD 1IAIM 1BBDH 4HUNB 2LV4A 1RZJL 4ACPA 5IWLC 4OM0L 4C59B 4O02H 3IKKA 1MJ8H 3ARVA 6CGTA 5I6XC 1R0AL 3KPLA 1H3PH 3QHFL 5E5UB 2YS4A 3IF1B 4WHTA 4KJPC 1T1YB 1LO0H 1LO2H 2EECA 3UJJL 3SHSA 3UPRB 2W9EH 3PHOA 2HVJB 1TZHB 3MTRA 1UKTA 3GK8L 3SGDI 4Z5RA 1T1WB 1AQKH 2R23B 1MH5A 1FN4B 1PDKA 2VQUA 4P5TC 1UZ8A 3SDYL 4PJEF 3ZHKA 5I74C 1Z0MA 2HVKA 1YEHH 5F89B 4HUUA 4GS7B 3BZ4A 2VE6A 3P11L 3GSNA 1LD9A 3OXRA 3QO1B 1YYML 4X7SH 1XGPB 1CLZH 1UEMA 3ARQA 1IGTB 2GJZA 2LTQC 3ARXA 4UTBH 3MRIB 5L8LB 3N9GL 2DKMA 5CINH 5I1GL 3KYNB 4W6WB 4YHYC 4P4KA 5C0RH 4BSWA 2CLZB 3FOLA 1CGWA 2C1OB 1WT5A 2JJUA 2Q86B 4KJYB 1R24A 1X5LA 4PV8A 2Z31A 2E6JA 3PNWA 5D2LE 3OHXB 5E0QA 4RMVA 1QG3A 1HE7A 5DD6A 3T2PA 2P8PB 3BGMA 5CIPH 2H3NB 2Z93B 2GSIA 1G7IA 3RIAK 4WUKL 1RZIA 1XZ0A 5C2BL 3WN5B 3RX5A 1QSFD 4PRNA 2H1PL 3WV0A 4G5ZH 3K2MC 3CC5B 1PQZA 3IDYB 1XIWA 3VXOA 3RWIB 4KH2A 3SDDB 4I48A 1FVCA 1LEGA 3SKUD 4GW1B 4FZEH 4Y5XB 1ITCA 1W0VB 1ETZA 2NW3A 1BVZA 2ZUWA 1FBIH 1AO7B 3O3EB 3JTTA 4PJGF 5IIEB 4JDVA 3MCKB 2A73A 4E42A 1S7SB 1EHLH 4EUPH 2OSLA 1DQDL 1OL0A 3QPXH 1RSFA 3FRPG 2YRZA 3W0WE 3UO1H 5EO1A 1IAIH 4JFEE 3JWDC 4GKNA 1PYWA 1CVSC 1BIIA 5L9DH 3QJFB 4KKLD 1TETL 3K1KC 5JPNB 1RZ8A 5GRUH 1UCBH 4G7YH 5BZWA 2R0KH 1JTTA 4L8BB 3QCTH 4RMRA 5HHQB 2WBJC 3MRJB 4L3EE 1XF2B 1BM3L 1YC8A 2ZG1A 3GSNH 4P4KC 4J3XA 2P42B 3CJJA 3V5KA 3MODH 2W0FA 1BVKA 4HK3J 5FECB 2WUCL 1IT9H 2E7BA 3B9EA 1GYAA 4KKNA 4JO4L 3AU1B 2EIBA 1U36A 1IGIH 2DWDB 3D9AL 4O2FB 3O6KH 1MUJA 3P9MA 3V4UL 3WKML 4GSDL 3DO7B 3E1F1 5FV1L 3UPAA 4F7MB 3MA9H 5DJ6A 2K9UA 4PJDA 3U4EB 5BZDB 3X14B 1UYWH 1ORSA 4QXGH 5KOVC 2P1YA 3MLVH 5DUPH 4H8WH 4WDIB 5JXEA 3RWCA 5BV7L 2X4NB 1AJ7H 3ZYJA 4LVHC 1SBSH 1FSKB 2JLLA 4OZFB 3OB8A 4NQCB 1J86A 1MF2H 3L3HA 4AEIL 2XV6B 1N0XL 5KZCD 1TCRA 2AXGA 1IAKB 2CDGA 2VZTA 3DYPA 4FXLA 4M1GH 2BRRL 1RULH 2X2YA 1I3RB 5I1DA 5D1QA 1N59A 3O6FB 1KG0B 2D9QB 5AD0A 4OLXH 4OFYA 1QSVA 3BGFC 2YD5A 3P2TA 4HWZA 2P44B 4HMCA 5IHBA 4HBCL 4MA7H 1MCDA 4RISH