2A20A

Solution structure of rim2 zinc finger domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
QEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulating synaptic membrane exocytosis protein 2
publication title A Munc13/RIM/Rab3 tripartite complex: from priming to plasticity?
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2005-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.120 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2a20A01
2CJSC 2A20A
chains in the Genus database with same CATH superfamily
3SGQI 3TO9A 2WCYA 5E3QA 3BJIA 1CHOI 1DS2I 1K7UA 2ODDA 3OXGA 2V1CC 1CT2I 2KMQA 1VDDA 1TGSI 1Q9BA 2WVJA 1IY6A 2LUYA 4AMLA 2E73A 1ULNA 1MJBA 2W0TA 1BUSA 1LR9A 1WGTA 1FAQA 3QTLD 3UGDA 2J9RA 3UOEA 1FARA 2DB6A 1M8BA 4JCVE 1AN1I 2GKRI 2NU1I 3UGLA 2OD1A 2JXDA 2L8EA 1Y1BA 3TO6A 5JHWC 1TBRR 2RC4A 1SGPI 2ELIA 3UGIA 2NU4I 1U5KA 2GIVA 2N71A 1N13A 1ULKA 1V1IA 2GVIA 9WGAA 5E3RA 1HJAI 3UFFA 1TBOA 1TOTA 2ENZA 2A20A 1LR8A 2ORVA 2DIPA 5CCMA 1XX6A 2K9HA 3UEYA 2LEOA 5EX3A 1P9ZA 1W3SA 2PQ8A 2GKVA 2CWGA 2X3TA 2ROWA 2QQ0A 4DNCA 1HEVA 1TBQR 1P9GA 1YTPA 1CGII 2B8TA 3QWPA 3R5AA 3R5BA 1NXUA 2N1AB 4OVOA 1Z7KB 3TOBA 3GOXA 1H0ZA 1TUSA 1UUCA 1UVFA 1X4SA 2QQCA 1UVGA 2JZMA 3QAHA 3R5CA 4B6DA 7WGAA 1KBFA 3OL0A 2M5XA 1M8CA 2KMRA 3CXLA 1DS3I 1MJAA 1XBTA 5EX0A 1FYBA 1HDLA 1CT0I 2X52A 3SEKC 1OYVI 1R0RI 1CGJI 2E5RA 5HI7A 3TOAA 1MT1A 1XA6A 2JA1A 2UZ3A 2VRWB 2SGEI 5HQ8A 1BMOA 2JW6A 5FUXA 2CJSC 2SGDI 1PCEA 1IY5A 3OXLA 1CT4I 2WGCA 3FSYA 1SGQI 4L9MA 3OXFA 4A24A 3FC3A 1RFHA 1FY7A 1OVOA 1V1HA 2DKVA 1CE3A 1CSOI 2ERWA 2V1CA 1TIHA 1Y8FA 1PJUA 2B0UC 1K7TA 1LR7A 1YU6C 2QQDA 1Z2IA 2NU3I 1K7VA 2YQPA 2ENNA 3HH2C 4WP4A 2OU2A 1KMAA 5CCLA 2QQEA 1MJ9A 5DAEA 3E59A 1S20A 3UEJA 3TJQA 4UXIA 2OVOA 2FNFX 1SGEI 2BUSA 1KBEA 1UHAA 2ARPF 2OZUA 3VE5A 3D00A 1W4RA 2XRCA 1SGRI 2KCXA 3KY9A 1WKXA 3RU0A 4UXHA 3R5DA 1R79A 1Y1CA 2KMPA 1PTRA 1X74A 2N52A 2L7XA 3FSXA 4MPIA 3SGBI 3MEKA 1PPFI 5FUVA 4E1RA 1HPTA 2GKTI 4GI3C 3TO7A 2F3CI 2CWFA 5FUWA 5J8CA 3VDUA 1IW4A 2CWHA 4UXJA 2V53A 2UVOA 2ORWA 3E2IA 1SGYI 5E3PA 3B4VC 2JYYA 1OMUA 2KMOA 1NUBA 1WTJA 1TURA 2N17A 3PDNA 2Y0MA 2LB7A 4HGUA 4SGBI 3VDPA 1TBNA 1PTQA 2NU2I 4E1PA 1OMTA 2SGFI 1WGCA 2P6AC 2RIJA 2QPOA 1ULMA 3OVOA 2J87A 1SGDI 2SGQI 2SGPI 2YUUA 4FKDA 2NU0I 5FUYA 5J8FA 1SGNI
chains in the Genus database with same CATH topology
3SGQI 2WCYA 3BJIA 1CHOI 1DS2I 2ODDA 3OXGA 2V1CC 1CT2I 2KMQA 1VDDA 1TGSI 2WVJA 1IY6A 2LUYA 2E73A 2W0TA 1BUSA 1LR9A 1FAQA 3QTLD 3UGDA 2J9RA 1FARA 2DB6A 1M8BA 4JCVE 1AN1I 2GKRI 2NU1I 3UGLA 2OD1A 2JXDA 2L8EA 1Y1BA 5JHWC 1TBRR 1SGPI 2ELIA 3UGIA 2NU4I 1U5KA 2N71A 1N13A 1V1IA 2GVIA 1HJAI 3UFFA 1TBOA 1TOTA 2ENZA 2A20A 1LR8A 2ORVA 2DIPA 5CCMA 1XX6A 2K9HA 3UEYA 2LEOA 5EX3A 1W3SA 2GKVA 2ROWA 2QQ0A 1TBQR 3QWPA 1YTPA 1CGII 2B8TA 4OVOA 2N1AB 1Z7KB 3GOXA 1H0ZA 1TUSA 1UUCA 1UVFA 1X4SA 2QQCA 1UVGA 2JZMA 1KBFA 4B6DA 3OL0A 2M5XA 1M8CA 2KMRA 3CXLA 1DS3I 1XBTA 5EX0A 1FYBA 1HDLA 1CT0I 3SEKC 1OYVI 1R0RI 1CGJI 2E5RA 5HI7A 1MT1A 1XA6A 2JA1A 2UZ3A 2VRWB 2SGEI 5HQ8A 1BMOA 2JW6A 5FUXA 2CJSC 2SGDI 1PCEA 1IY5A 3OXLA 1CT4I 1SGQI 4L9MA 3OXFA 4A24A 3FC3A 1RFHA 1OVOA 1V1HA 1CE3A 1CSOI 2ERWA 2V1CA 1TIHA 1Y8FA 1PJUA 2B0UC 1LR7A 1YU6C 2QQDA 2NU3I 2YQPA 2ENNA 3HH2C 1KMAA 5CCLA 2QQEA 5DAEA 3E59A 3UEJA 3TJQA 4UXIA 2OVOA 2FNFX 1SGEI 2BUSA 1KBEA 2ARPF 3VE5A 3D00A 1W4RA 2XRCA 1SGRI 2KCXA 3KY9A 3RU0A 4UXHA 1R79A 1Y1CA 2KMPA 1PTRA 1X74A 2N52A 2L7XA 3SGBI 3MEKA 1PPFI 5FUVA 4E1RA 1HPTA 2GKTI 4GI3C 2F3CI 5FUWA 3VDUA 1IW4A 4UXJA 2V53A 2ORWA 3E2IA 1SGYI 3B4VC 2JYYA 1OMUA 2KMOA 1NUBA 2N17A 1TURA 3PDNA 4HGUA 4SGBI 3VDPA 1TBNA 1PTQA 2NU2I 4E1PA 1OMTA 2SGFI 2P6AC 2QPOA 3OVOA 2J87A 1SGDI 2SGQI 2SGPI 2YUUA 4FKDA 2NU0I 5FUYA 1SGNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJS C;  2A20 A; 
#chains in the Genus database with same CATH topology
 3SGQ I;  3TO9 A;  2WCY A;  5E3Q A;  3BJI A;  1CHO I;  1DS2 I;  1K7U A;  2ODD A;  3OXG A;  2V1C C;  1CT2 I;  2KMQ A;  1VDD A;  1TGS I;  1Q9B A;  2WVJ A;  1IY6 A;  2LUY A;  4AML A;  2E73 A;  1ULN A;  1MJB A;  2W0T A;  1BUS A;  1LR9 A;  1WGT A;  1FAQ A;  3QTL D;  3UGD A;  2J9R A;  3UOE A;  1FAR A;  2DB6 A;  1M8B A;  4JCV E;  1AN1 I;  2GKR I;  2NU1 I;  3UGL A;  2OD1 A;  2JXD A;  2L8E A;  1Y1B A;  3TO6 A;  5JHW C;  1TBR R;  2RC4 A;  1SGP I;  2ELI A;  3UGI A;  2NU4 I;  1U5K A;  2GIV A;  2N71 A;  1N13 A;  1ULK A;  1V1I A;  2GVI A;  9WGA A;  5E3R A;  1HJA I;  3UFF A;  1TBO A;  1TOT A;  2ENZ A;  2A20 A;  1LR8 A;  2ORV A;  2DIP A;  5CCM A;  1XX6 A;  2K9H A;  3UEY A;  2LEO A;  5EX3 A;  1P9Z A;  1W3S A;  2PQ8 A;  2GKV A;  2CWG A;  2X3T A;  2ROW A;  2QQ0 A;  4DNC A;  1HEV A;  1TBQ R;  1P9G A;  1YTP A;  1CGI I;  2B8T A;  3QWP A;  3R5A A;  3R5B A;  1NXU A;  2N1A B;  4OVO A;  1Z7K B;  3TOB A;  3GOX A;  1H0Z A;  1TUS A;  1UUC A;  1UVF A;  1X4S A;  2QQC A;  1UVG A;  2JZM A;  3QAH A;  3R5C A;  4B6D A;  7WGA A;  1KBF A;  3OL0 A;  2M5X A;  1M8C A;  2KMR A;  3CXL A;  1DS3 I;  1MJA A;  1XBT A;  5EX0 A;  1FYB A;  1HDL A;  1CT0 I;  2X52 A;  3SEK C;  1OYV I;  1R0R I;  1CGJ I;  2E5R A;  5HI7 A;  3TOA A;  1MT1 A;  1XA6 A;  2JA1 A;  2UZ3 A;  2VRW B;  2SGE I;  5HQ8 A;  1BMO A;  2JW6 A;  5FUX A;  2CJS C;  2SGD I;  1PCE A;  1IY5 A;  3OXL A;  1CT4 I;  2WGC A;  3FSY A;  1SGQ I;  4L9M A;  3OXF A;  4A24 A;  3FC3 A;  1RFH A;  1FY7 A;  1OVO A;  1V1H A;  2DKV A;  1CE3 A;  1CSO I;  2ERW A;  2V1C A;  1TIH A;  1Y8F A;  1PJU A;  2B0U C;  1K7T A;  1LR7 A;  1YU6 C;  2QQD A;  1Z2I A;  2NU3 I;  1K7V A;  2YQP A;  2ENN A;  3HH2 C;  4WP4 A;  2OU2 A;  1KMA A;  5CCL A;  2QQE A;  1MJ9 A;  5DAE A;  3E59 A;  1S20 A;  3UEJ A;  3TJQ A;  4UXI A;  2OVO A;  2FNF X;  1SGE I;  2BUS A;  1KBE A;  1UHA A;  2ARP F;  2OZU A;  3VE5 A;  3D00 A;  1W4R A;  2XRC A;  1SGR I;  2KCX A;  3KY9 A;  1WKX A;  3RU0 A;  4UXH A;  3R5D A;  1R79 A;  1Y1C A;  2KMP A;  1PTR A;  1X74 A;  2N52 A;  2L7X A;  3FSX A;  4MPI A;  3SGB I;  3MEK A;  1PPF I;  5FUV A;  4E1R A;  1HPT A;  2GKT I;  4GI3 C;  3TO7 A;  2F3C I;  2CWF A;  5FUW A;  5J8C A;  3VDU A;  1IW4 A;  2CWH A;  4UXJ A;  2V53 A;  2UVO A;  2ORW A;  3E2I A;  1SGY I;  5E3P A;  3B4V C;  2JYY A;  1OMU A;  2KMO A;  1NUB A;  1WTJ A;  1TUR A;  2N17 A;  3PDN A;  2Y0M A;  2LB7 A;  4HGU A;  4SGB I;  3VDP A;  1TBN A;  1PTQ A;  2NU2 I;  4E1P A;  1OMT A;  2SGF I;  1WGC A;  2P6A C;  2RIJ A;  2QPO A;  1ULM A;  3OVO A;  2J87 A;  1SGD I;  2SGQ I;  2SGP I;  2YUU A;  4FKD A;  2NU0 I;  5FUY A;  5J8F A;  1SGN I; 
#chains in the Genus database with same CATH homology
 3SGQ I;  2WCY A;  3BJI A;  1CHO I;  1DS2 I;  2ODD A;  3OXG A;  2V1C C;  1CT2 I;  2KMQ A;  1VDD A;  1TGS I;  2WVJ A;  1IY6 A;  2LUY A;  2E73 A;  2W0T A;  1BUS A;  1LR9 A;  1FAQ A;  3QTL D;  3UGD A;  2J9R A;  1FAR A;  2DB6 A;  1M8B A;  4JCV E;  1AN1 I;  2GKR I;  2NU1 I;  3UGL A;  2OD1 A;  2JXD A;  2L8E A;  1Y1B A;  5JHW C;  1TBR R;  1SGP I;  2ELI A;  3UGI A;  2NU4 I;  1U5K A;  2N71 A;  1N13 A;  1V1I A;  2GVI A;  1HJA I;  3UFF A;  1TBO A;  1TOT A;  2ENZ A;  2A20 A;  1LR8 A;  2ORV A;  2DIP A;  5CCM A;  1XX6 A;  2K9H A;  3UEY A;  2LEO A;  5EX3 A;  1W3S A;  2GKV A;  2ROW A;  2QQ0 A;  1TBQ R;  3QWP A;  1YTP A;  1CGI I;  2B8T A;  4OVO A;  2N1A B;  1Z7K B;  3GOX A;  1H0Z A;  1TUS A;  1UUC A;  1UVF A;  1X4S A;  2QQC A;  1UVG A;  2JZM A;  1KBF A;  4B6D A;  3OL0 A;  2M5X A;  1M8C A;  2KMR A;  3CXL A;  1DS3 I;  1XBT A;  5EX0 A;  1FYB A;  1HDL A;  1CT0 I;  3SEK C;  1OYV I;  1R0R I;  1CGJ I;  2E5R A;  5HI7 A;  1MT1 A;  1XA6 A;  2JA1 A;  2UZ3 A;  2VRW B;  2SGE I;  5HQ8 A;  1BMO A;  2JW6 A;  5FUX A;  2CJS C;  2SGD I;  1PCE A;  1IY5 A;  3OXL A;  1CT4 I;  1SGQ I;  4L9M A;  3OXF A;  4A24 A;  3FC3 A;  1RFH A;  1OVO A;  1V1H A;  1CE3 A;  1CSO I;  2ERW A;  2V1C A;  1TIH A;  1Y8F A;  1PJU A;  2B0U C;  1LR7 A;  1YU6 C;  2QQD A;  2NU3 I;  2YQP A;  2ENN A;  3HH2 C;  1KMA A;  5CCL A;  2QQE A;  5DAE A;  3E59 A;  3UEJ A;  3TJQ A;  4UXI A;  2OVO A;  2FNF X;  1SGE I;  2BUS A;  1KBE A;  2ARP F;  3VE5 A;  3D00 A;  1W4R A;  2XRC A;  1SGR I;  2KCX A;  3KY9 A;  3RU0 A;  4UXH A;  1R79 A;  1Y1C A;  2KMP A;  1PTR A;  1X74 A;  2N52 A;  2L7X A;  3SGB I;  3MEK A;  1PPF I;  5FUV A;  4E1R A;  1HPT A;  2GKT I;  4GI3 C;  2F3C I;  5FUW A;  3VDU A;  1IW4 A;  4UXJ A;  2V53 A;  2ORW A;  3E2I A;  1SGY I;  3B4V C;  2JYY A;  1OMU A;  2KMO A;  1NUB A;  2N17 A;  1TUR A;  3PDN A;  4HGU A;  4SGB I;  3VDP A;  1TBN A;  1PTQ A;  2NU2 I;  4E1P A;  1OMT A;  2SGF I;  2P6A C;  2QPO A;  3OVO A;  2J87 A;  1SGD I;  2SGQ I;  2SGP I;  2YUU A;  4FKD A;  2NU0 I;  5FUY A;  1SGN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...