2A20A

Solution structure of rim2 zinc finger domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
b'QEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulating synaptic membrane exocytosis protein 2
publication title A Munc13/RIM/Rab3 tripartite complex: from priming to plasticity?
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2005-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.120 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2a20A01
2CJSC 2A20A
chains in the Genus database with same CATH superfamily
1KMAA 2Y0MA 2K9HA 3TO6A 2SGFI 5FUWA 1WTJA 5E3QA 2SGPI 2P6AC 2GKRI 2VRWB 4HGUA 3UEJA 3UFFA 2SGQI 2W0TA 5FUYA 4UXHA 2GKVA 1TOTA 3OXLA 2ROWA 2KMPA 1HDLA 2NU1I 4E1PA 1IW4A 5E3RA 1SGRI 2DIPA 4OVOA 1V1HA 2E73A 1K7VA 1YU6C 2L8EA 3E2IA 3TJQA 2LB7A 1HJAI 3D00A 1LR7A 1H0ZA 3UOEA 5JHWC 1UUCA 2JZMA 3R5DA 2KMOA 1RFHA 1Y8FA 1HEVA 2UVOA 1LR8A 3QTLD 4GI3C 3TOAA 3UGLA 3VE5A 2SGDI 2N17A 1WGCA 1KBEA 2N52A 3R5CA 2X52A 5DAEA 3TOBA 2J87A 2UZ3A 3OXGA 1MJAA 3OVOA 3SEKC 1KBFA 2JYYA 1P9ZA 4A24A 2NU0I 1YTPA 2BUSA 2NU2I 2NU3I 1IY5A 2J9RA 2LUYA 5FUVA 9WGAA 1CT0I 1XX6A 1M8BA 1SGYI 2CWFA 1SGPI 1BUSA 3HH2C 1CT2I 1MJBA 1R79A 2FNFX 2NU4I 1CGJI 1PTRA 1X74A 1SGNI 2KMQA 2B0UC 2ORWA 3R5BA 3SGBI 1Y1CA 1CT4I 1Z2IA 3CXLA 1DS3I 2E5RA 5J8CA 1OMTA 2DKVA 5HQ8A 1TURA 1U5KA 4JCVE 5FUXA 4MPIA 1W4RA 2XRCA 5EX3A 2GVIA 1CE3A 5E3PA 1OMUA 1TIHA 5CCMA 1TBNA 5EX0A 1PPFI 2RC4A 2N1AB 2SGEI 1VDDA 4UXJA 3FC3A 1FAQA 1R0RI 2ENZA 2V1CA 2ODDA 3KY9A 3MEKA 2M5XA 1IY6A 2QQDA 2JA1A 2V53A 3UGIA 1OVOA 1Y1BA 1SGQI 1TUSA 2N71A 3TO9A 4FKDA 1SGEI 1OYVI 3UEYA 2ENNA 1M8CA 1CHOI 1FYBA 1Q9BA 2RIJA 1PTQA 1ULKA 1NXUA 2A20A 2X3TA 2OU2A 2YQPA 2YUUA 3BJIA 3VDUA 1DS2I 1NUBA 1ULMA 2JXDA 2WGCA 4DNCA 3R5AA 4UXIA 1Z7KB 2V1CC 2ARPF 2ERWA 4AMLA 2F3CI 1K7TA 1UVFA 4E1RA 3QWPA 3SGQI 1BMOA 1PCEA 1XBTA 4WP4A 3RU0A 1LR9A 2WCYA 3QAHA 3GOXA 5J8FA 2LEOA 1TGSI 2OD1A 2PQ8A 3FSXA 3OXFA 1K7UA 2KCXA 1TBOA 3TO7A 2CWGA 4B6DA 5CCLA 1HPTA 1WGTA 2OVOA 3FSYA 4L9MA 3VDPA 1UHAA 2QPOA 1TBQR 3OL0A 1N13A 1MJ9A 1ULNA 7WGAA 2QQCA 1X4SA 1P9GA 2WVJA 4SGBI 1CGII 1W3SA 2QQEA 3E59A 2B8TA 1SGDI 2GIVA 2ELIA 1PJUA 1V1IA 2KMRA 2QQ0A 1XA6A 2L7XA 2GKTI 2CJSC 1TBRR 1FARA 1AN1I 1WKXA 2ORVA 2OZUA 3PDNA 2CWHA 1MT1A 3B4VC 1S20A 2DB6A 5HI7A 3UGDA 1UVGA 2JW6A 1CSOI 1FY7A
chains in the Genus database with same CATH topology
1KMAA 2K9HA 2SGFI 5FUWA 2SGPI 2P6AC 2GKRI 2VRWB 4HGUA 3UFFA 2SGQI 2W0TA 5FUYA 4UXHA 2GKVA 1TOTA 3OXLA 2ROWA 2KMPA 1HDLA 2NU1I 4E1PA 1IW4A 1SGRI 2DIPA 4OVOA 1V1HA 2E73A 1YU6C 2L8EA 3E2IA 3TJQA 1HJAI 3D00A 1LR7A 1H0ZA 5JHWC 1UUCA 2JZMA 2KMOA 1RFHA 1Y8FA 4GI3C 1LR8A 3QTLD 3UGLA 3VE5A 2SGDI 2N17A 1KBEA 2N52A 5DAEA 3UEJA 1KBFA 2J87A 2UZ3A 3OXGA 3SEKC 3OVOA 2JYYA 4A24A 2NU0I 1YTPA 2BUSA 2NU2I 2NU3I 1IY5A 2J9RA 2LUYA 5FUVA 1CT0I 1XX6A 1M8BA 1SGYI 1SGPI 1BUSA 3HH2C 1CT2I 1R79A 2FNFX 2NU4I 1CGJI 1PTRA 1X74A 1SGNI 2KMQA 2B0UC 2ORWA 3SGBI 1Y1CA 1CT4I 3CXLA 1DS3I 2E5RA 1OMTA 5HQ8A 1TURA 1U5KA 4JCVE 5FUXA 5EX3A 1W4RA 2XRCA 1CE3A 2GVIA 1OMUA 1TIHA 5CCMA 1TBNA 5EX0A 1PPFI 3FC3A 2N1AB 2SGEI 1VDDA 4UXJA 1FAQA 1R0RI 2ENZA 2V1CA 2ODDA 3KY9A 3MEKA 2M5XA 1IY6A 2QQDA 2JA1A 2V53A 3UGIA 1OVOA 1Y1BA 1SGQI 1TUSA 2N71A 4FKDA 1SGEI 1OYVI 3UEYA 2ENNA 1M8CA 1CHOI 1FYBA 1PTQA 2A20A 2YUUA 3BJIA 3VDUA 2YQPA 1DS2I 1NUBA 2JXDA 4UXIA 1Z7KB 2V1CC 2ARPF 2ERWA 2F3CI 1UVFA 4E1RA 3QWPA 3SGQI 1BMOA 1PCEA 1XBTA 3RU0A 3GOXA 1LR9A 2WCYA 2LEOA 1TGSI 2OD1A 3OXFA 4B6DA 2KCXA 1TBOA 5CCLA 1HPTA 2OVOA 3VDPA 4L9MA 2QPOA 1TBQR 3OL0A 1N13A 2QQCA 1X4SA 2WVJA 4SGBI 1CGII 1W3SA 2QQEA 3E59A 2B8TA 1SGDI 2ELIA 1PJUA 1V1IA 2KMRA 2QQ0A 1XA6A 2L7XA 2GKTI 2CJSC 1TBRR 1FARA 1AN1I 2ORVA 3PDNA 1MT1A 3B4VC 2DB6A 5HI7A 3UGDA 1UVGA 2JW6A 1CSOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJS C;  2A20 A; 
#chains in the Genus database with same CATH topology
 1KMA A;  2Y0M A;  2K9H A;  3TO6 A;  2SGF I;  5FUW A;  1WTJ A;  5E3Q A;  2SGP I;  2P6A C;  2GKR I;  2VRW B;  4HGU A;  3UEJ A;  3UFF A;  2SGQ I;  2W0T A;  5FUY A;  4UXH A;  2GKV A;  1TOT A;  3OXL A;  2ROW A;  2KMP A;  1HDL A;  2NU1 I;  4E1P A;  1IW4 A;  5E3R A;  1SGR I;  2DIP A;  4OVO A;  1V1H A;  2E73 A;  1K7V A;  1YU6 C;  2L8E A;  3E2I A;  3TJQ A;  2LB7 A;  1HJA I;  3D00 A;  1LR7 A;  1H0Z A;  3UOE A;  5JHW C;  1UUC A;  2JZM A;  3R5D A;  2KMO A;  1RFH A;  1Y8F A;  1HEV A;  2UVO A;  1LR8 A;  3QTL D;  4GI3 C;  3TOA A;  3UGL A;  3VE5 A;  2SGD I;  2N17 A;  1WGC A;  1KBE A;  2N52 A;  3R5C A;  2X52 A;  5DAE A;  3TOB A;  2J87 A;  2UZ3 A;  3OXG A;  1MJA A;  3OVO A;  3SEK C;  1KBF A;  2JYY A;  1P9Z A;  4A24 A;  2NU0 I;  1YTP A;  2BUS A;  2NU2 I;  2NU3 I;  1IY5 A;  2J9R A;  2LUY A;  5FUV A;  9WGA A;  1CT0 I;  1XX6 A;  1M8B A;  1SGY I;  2CWF A;  1SGP I;  1BUS A;  3HH2 C;  1CT2 I;  1MJB A;  1R79 A;  2FNF X;  2NU4 I;  1CGJ I;  1PTR A;  1X74 A;  1SGN I;  2KMQ A;  2B0U C;  2ORW A;  3R5B A;  3SGB I;  1Y1C A;  1CT4 I;  1Z2I A;  3CXL A;  1DS3 I;  2E5R A;  5J8C A;  1OMT A;  2DKV A;  5HQ8 A;  1TUR A;  1U5K A;  4JCV E;  5FUX A;  4MPI A;  1W4R A;  2XRC A;  5EX3 A;  2GVI A;  1CE3 A;  5E3P A;  1OMU A;  1TIH A;  5CCM A;  1TBN A;  5EX0 A;  1PPF I;  2RC4 A;  2N1A B;  2SGE I;  1VDD A;  4UXJ A;  3FC3 A;  1FAQ A;  1R0R I;  2ENZ A;  2V1C A;  2ODD A;  3KY9 A;  3MEK A;  2M5X A;  1IY6 A;  2QQD A;  2JA1 A;  2V53 A;  3UGI A;  1OVO A;  1Y1B A;  1SGQ I;  1TUS A;  2N71 A;  3TO9 A;  4FKD A;  1SGE I;  1OYV I;  3UEY A;  2ENN A;  1M8C A;  1CHO I;  1FYB A;  1Q9B A;  2RIJ A;  1PTQ A;  1ULK A;  1NXU A;  2A20 A;  2X3T A;  2OU2 A;  2YQP A;  2YUU A;  3BJI A;  3VDU A;  1DS2 I;  1NUB A;  1ULM A;  2JXD A;  2WGC A;  4DNC A;  3R5A A;  4UXI A;  1Z7K B;  2V1C C;  2ARP F;  2ERW A;  4AML A;  2F3C I;  1K7T A;  1UVF A;  4E1R A;  3QWP A;  3SGQ I;  1BMO A;  1PCE A;  1XBT A;  4WP4 A;  3RU0 A;  1LR9 A;  2WCY A;  3QAH A;  3GOX A;  5J8F A;  2LEO A;  1TGS I;  2OD1 A;  2PQ8 A;  3FSX A;  3OXF A;  1K7U A;  2KCX A;  1TBO A;  3TO7 A;  2CWG A;  4B6D A;  5CCL A;  1HPT A;  1WGT A;  2OVO A;  3FSY A;  4L9M A;  3VDP A;  1UHA A;  2QPO A;  1TBQ R;  3OL0 A;  1N13 A;  1MJ9 A;  1ULN A;  7WGA A;  2QQC A;  1X4S A;  1P9G A;  2WVJ A;  4SGB I;  1CGI I;  1W3S A;  2QQE A;  3E59 A;  2B8T A;  1SGD I;  2GIV A;  2ELI A;  1PJU A;  1V1I A;  2KMR A;  2QQ0 A;  1XA6 A;  2L7X A;  2GKT I;  2CJS C;  1TBR R;  1FAR A;  1AN1 I;  1WKX A;  2ORV A;  2OZU A;  3PDN A;  2CWH A;  1MT1 A;  3B4V C;  1S20 A;  2DB6 A;  5HI7 A;  3UGD A;  1UVG A;  2JW6 A;  1CSO I;  1FY7 A; 
#chains in the Genus database with same CATH homology
 1KMA A;  2K9H A;  2SGF I;  5FUW A;  2SGP I;  2P6A C;  2GKR I;  2VRW B;  4HGU A;  3UFF A;  2SGQ I;  2W0T A;  5FUY A;  4UXH A;  2GKV A;  1TOT A;  3OXL A;  2ROW A;  2KMP A;  1HDL A;  2NU1 I;  4E1P A;  1IW4 A;  1SGR I;  2DIP A;  4OVO A;  1V1H A;  2E73 A;  1YU6 C;  2L8E A;  3E2I A;  3TJQ A;  1HJA I;  3D00 A;  1LR7 A;  1H0Z A;  5JHW C;  1UUC A;  2JZM A;  2KMO A;  1RFH A;  1Y8F A;  4GI3 C;  1LR8 A;  3QTL D;  3UGL A;  3VE5 A;  2SGD I;  2N17 A;  1KBE A;  2N52 A;  5DAE A;  3UEJ A;  1KBF A;  2J87 A;  2UZ3 A;  3OXG A;  3SEK C;  3OVO A;  2JYY A;  4A24 A;  2NU0 I;  1YTP A;  2BUS A;  2NU2 I;  2NU3 I;  1IY5 A;  2J9R A;  2LUY A;  5FUV A;  1CT0 I;  1XX6 A;  1M8B A;  1SGY I;  1SGP I;  1BUS A;  3HH2 C;  1CT2 I;  1R79 A;  2FNF X;  2NU4 I;  1CGJ I;  1PTR A;  1X74 A;  1SGN I;  2KMQ A;  2B0U C;  2ORW A;  3SGB I;  1Y1C A;  1CT4 I;  3CXL A;  1DS3 I;  2E5R A;  1OMT A;  5HQ8 A;  1TUR A;  1U5K A;  4JCV E;  5FUX A;  5EX3 A;  1W4R A;  2XRC A;  1CE3 A;  2GVI A;  1OMU A;  1TIH A;  5CCM A;  1TBN A;  5EX0 A;  1PPF I;  3FC3 A;  2N1A B;  2SGE I;  1VDD A;  4UXJ A;  1FAQ A;  1R0R I;  2ENZ A;  2V1C A;  2ODD A;  3KY9 A;  3MEK A;  2M5X A;  1IY6 A;  2QQD A;  2JA1 A;  2V53 A;  3UGI A;  1OVO A;  1Y1B A;  1SGQ I;  1TUS A;  2N71 A;  4FKD A;  1SGE I;  1OYV I;  3UEY A;  2ENN A;  1M8C A;  1CHO I;  1FYB A;  1PTQ A;  2A20 A;  2YUU A;  3BJI A;  3VDU A;  2YQP A;  1DS2 I;  1NUB A;  2JXD A;  4UXI A;  1Z7K B;  2V1C C;  2ARP F;  2ERW A;  2F3C I;  1UVF A;  4E1R A;  3QWP A;  3SGQ I;  1BMO A;  1PCE A;  1XBT A;  3RU0 A;  3GOX A;  1LR9 A;  2WCY A;  2LEO A;  1TGS I;  2OD1 A;  3OXF A;  4B6D A;  2KCX A;  1TBO A;  5CCL A;  1HPT A;  2OVO A;  3VDP A;  4L9M A;  2QPO A;  1TBQ R;  3OL0 A;  1N13 A;  2QQC A;  1X4S A;  2WVJ A;  4SGB I;  1CGI I;  1W3S A;  2QQE A;  3E59 A;  2B8T A;  1SGD I;  2ELI A;  1PJU A;  1V1I A;  2KMR A;  2QQ0 A;  1XA6 A;  2L7X A;  2GKT I;  2CJS C;  1TBR R;  1FAR A;  1AN1 I;  2ORV A;  3PDN A;  1MT1 A;  3B4V C;  2DB6 A;  5HI7 A;  3UGD A;  1UVG A;  2JW6 A;  1CSO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...