2A22A

Structure of vacuolar protein sorting 29 from cryptosporidium parvum
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
193
structure length
193
Chain Sequence
DFGDLVLLIGDLKIPYGAKELPSNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNVYIVSGDLDSAIFNPDPESNGVFPEYVVVQIGEFKIGLMHGNQVLPWDDPGSLEQWQRRLDCDILVTGHTHKLRVFEKNGKLFLNPGTATGAFSALTPDAPPSFMLMALQGNKVVLYVYDLRDGKTNVAMSEFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Protein transport
molecule keywords vacuolar protein sorting 29
total genus 51
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12850 Metallophos_2 Calcineurin-like phosphoesterase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2a22A00
3H62B 4UT3B 1IT6A 3K7VC 1HPUA 1FJMA 4MOVA 4O43A 1UTEA 1G5BA 2NPPC 2BCDA 2A22A 2QFRA 2QJCA 4YKEA 3V4YA 4KKZA 4V0XA 1SU1A 2AHDA 2XMOA 3CK2A 4FBWA 2Q8UA 3C5WC 1V73A 4JA7A 1QFCA 1Z2XA 3H64A 3PSOA 4H2GA 5DNYA 3H61A 1XM7A 4H2BA 1Z2WA 2BDXA 2NYLC 2YVTA 4G9JA 3IVDA 2R17A 4ZVZA 1XZWA 3FGAC 4FBKA 3DSDA 1HO5A 3THNA 3K7WC 3QFKA 3QFOA 2IE3C 2WDDA 1TCOA 1AUIA 5INBA 1QHWA 2NYMC 3TGHA 2IE4C 3N5UA 3IB7A 4H1YP 4UT3A 3DSCA 3JYFA 1S3NA 5F3WA 4ORCA 2BQ8X 2O8GA 2HYOA 4MP0A 4ORAA 4UT2A 4UWQA 4HD0A 4B2OA 1HP1A 1S8EA 1KBPA 2P6BA 2CV9A 3KBPA 1WAO1 4V0VA 2WDCA 4TUIA 4O24A 4O5GA 3H67A 4KBPA 4Q7FA 3RQZA 4IL1A 5J28A 3GVEA 3THOB 2WDEA 3ICFA 2ZBMA 4M0VA 2DFJA 1MF8A 4JA9A 4J6OA 1II7A 4O4KA 1M63A 1NNWA 4H2FA 3EGGA 2Z06A 1USHA 4LU9A 3EGHA 2Z1AA 2Z72A 4XPNA 4IYPC 4DHLA 3QFNA 4ZX2A 1W24A 5GTUA 5JJTA 3H68A 5HPEA 2GJUA 4V0WA 1S70A 1OI8A 4ORBA 1T71A 3ZTVA 2O8AA 3P71C 4I5LC 4LTYA 3RL4A 5IOHA 3E7AA 5JPEA 3IVEA 3H63A 3AUZA 5C1VA 2NXFA 3HVQA 3T1IA 3RL5A 3ZU0A 1OIDA 3PSNA 3H60A 2WDFA 3AV0A 5EQVA 2JOGA 3E7BA 4I5NC 4MOYA 4LACC 5JPFA 3QG5C 3RL3A 4DSYA 2HYPA 1WARA 2IAEC 4FCXA 3C9FA 2KKNA 3QFMA 2HY1A 2USHA 3LL8A 4NZVA 1T70A 2QFPA 4FBQA 3DW8C 1OIEA 1JK7A 4F0ZA 1S95A 1S3LA 4H2IA 4WWLA 1S3MA 4H1SA 1UF3A 4TUGA 1U32A 4OR9A 3IB8A 3H66A 3H69A 5B8IA 4DT2A
chains in the Genus database with same CATH superfamily
3H62B 4UT3B 1IT6A 3K7VC 1HPUA 1FJMA 4MOVA 4O43A 1UTEA 1G5BA 2NPPC 2BCDA 2A22A 2QFRA 2QJCA 4YKEA 3V4YA 4KKZA 4V0XA 1SU1A 2AHDA 2XMOA 3CK2A 4FBWA 2Q8UA 3C5WC 1V73A 4JA7A 1QFCA 1Z2XA 3H64A 3PSOA 4H2GA 5DNYA 3H61A 1XM7A 2ZOAA 4H2BA 1Z2WA 2BDXA 2NYLC 2YVTA 4G9JA 3IVDA 2R17A 4ZVZA 1XZWA 2DXNA 3FGAC 4FBKA 3DSDA 1HO5A 3THNA 2ZO9B 3K7WC 3QFKA 3QFOA 2IE3C 2WDDA 1TCOA 1AUIA 5INBA 1QHWA 2NYMC 3TGHA 2IE4C 3N5UA 3IB7A 4H1YP 4UT3A 3DSCA 3JYFA 1S3NA 5F3WA 4ORCA 2BQ8X 2O8GA 2HYOA 4MP0A 4ORAA 4UT2A 4UWQA 4HD0A 4B2OA 1HP1A 1S8EA 1KBPA 2P6BA 2CV9A 3KBPA 1WAO1 4V0VA 2WDCA 4TUIA 4O24A 4O5GA 3H67A 4KBPA 4Q7FA 3RQZA 4IL1A 5J28A 3GVEA 3THOB 2WDEA 3ICFA 2ZBMA 4M0VA 2DFJA 1MF8A 4JA9A 4J6OA 1II7A 4O4KA 1M63A 1NNWA 4H2FA 3EGGA 2Z06A 1USHA 4LU9A 3EGHA 2Z1AA 2Z72A 4XPNA 4IYPC 4DHLA 3QFNA 4ZX2A 1W24A 5GTUA 5JJTA 4DT2A 3H68A 5HPEA 2GJUA 4V0WA 1S70A 2YEQA 1OI8A 4ORBA 1T71A 3ZTVA 2O8AA 3P71C 4I5LC 4LTYA 3RL4A 5IOHA 3E7AA 5JPEA 3IVEA 3H63A 3AUZA 5C1VA 2NXFA 3HVQA 3T1IA 3RL5A 3ZU0A 1OIDA 3PSNA 3H60A 2WDFA 3AV0A 5EQVA 2JOGA 3E7BA 4I5NC 4MOYA 4LACC 3E0JA 3QG5C 3RL3A 4DSYA 2HYPA 1WARA 2IAEC 4FCXA 5JPFA 3C9FA 2KKNA 3QFMA 2HY1A 2USHA 3LL8A 4NZVA 1T70A 2QFPA 3FLOA 4FBQA 3DW8C 1OIEA 1JK7A 2DXLA 1S95A 1S3LA 4H2IA 4F0ZA 4WWLA 1S3MA 4H1SA 1UF3A 4TUGA 1U32A 4OR9A 3IB8A 3H66A 3H69A 5B8IA 3D03A
chains in the Genus database with same CATH topology
3H62B 4UT3B 1IT6A 3K7VC 1HPUA 1FJMA 4MOVA 4O43A 1UTEA 1G5BA 2NPPC 2BCDA 2A22A 2QFRA 2QJCA 4YKEA 3V4YA 4KKZA 4V0XA 1SU1A 2AHDA 2XMOA 3CK2A 4FBWA 2Q8UA 3C5WC 1V73A 4JA7A 1QFCA 1Z2XA 3H64A 3PSOA 4H2GA 5DNYA 3H61A 1XM7A 2ZOAA 4H2BA 1Z2WA 2BDXA 2NYLC 2YVTA 4G9JA 3IVDA 2R17A 4ZVZA 1XZWA 2DXNA 3FGAC 4FBKA 3DSDA 1HO5A 3THNA 2ZO9B 3K7WC 3QFKA 3QFOA 2IE3C 2WDDA 1TCOA 1AUIA 5INBA 1QHWA 2NYMC 3TGHA 2IE4C 3N5UA 3IB7A 4H1YP 4UT3A 3DSCA 3JYFA 1S3NA 5F3WA 4ORCA 2BQ8X 2O8GA 2HYOA 4MP0A 4ORAA 4UT2A 4UWQA 4HD0A 4B2OA 1HP1A 1S8EA 1KBPA 2P6BA 2CV9A 3KBPA 1WAO1 4V0VA 2WDCA 4TUIA 4O24A 4O5GA 3H67A 4KBPA 4Q7FA 3RQZA 4IL1A 5J28A 3GVEA 3THOB 2WDEA 3ICFA 2ZBMA 4M0VA 2DFJA 1MF8A 4JA9A 4J6OA 1II7A 4O4KA 1M63A 1NNWA 4H2FA 3EGGA 2Z06A 1USHA 4LU9A 3EGHA 2Z1AA 2Z72A 4XPNA 4IYPC 4DHLA 3QFNA 4ZX2A 1W24A 5GTUA 5JJTA 4DT2A 3H68A 5HPEA 2GJUA 4V0WA 1S70A 2YEQA 1OI8A 4ORBA 1T71A 3ZTVA 2O8AA 3P71C 4I5LC 4LTYA 3RL4A 5IOHA 3E7AA 5JPEA 3IVEA 3H63A 3AUZA 5C1VA 2NXFA 3HVQA 3T1IA 3RL5A 3ZU0A 1OIDA 3PSNA 3H60A 2WDFA 3AV0A 5EQVA 2JOGA 3E7BA 4I5NC 4MOYA 4LACC 3E0JA 3QG5C 3RL3A 4DSYA 2HYPA 1WARA 2IAEC 4FCXA 5JPFA 3C9FA 2KKNA 3QFMA 2HY1A 2USHA 3LL8A 4NZVA 1T70A 2QFPA 3FLOA 4FBQA 3DW8C 1OIEA 1JK7A 2DXLA 1S95A 1S3LA 4H2IA 4F0ZA 4WWLA 1S3MA 4H1SA 1UF3A 4TUGA 1U32A 4OR9A 3IB8A 3H66A 3H69A 5B8IA 3D03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H62 B;  4UT3 B;  1IT6 A;  3K7V C;  1HPU A;  1FJM A;  4MOV A;  4O43 A;  1UTE A;  1G5B A;  2NPP C;  2BCD A;  2A22 A;  2QFR A;  2QJC A;  4YKE A;  3V4Y A;  4KKZ A;  4V0X A;  1SU1 A;  2AHD A;  2XMO A;  3CK2 A;  4FBW A;  2Q8U A;  3C5W C;  1V73 A;  4JA7 A;  1QFC A;  1Z2X A;  3H64 A;  3PSO A;  4H2G A;  5DNY A;  3H61 A;  1XM7 A;  4H2B A;  1Z2W A;  2BDX A;  2NYL C;  2YVT A;  4G9J A;  3IVD A;  2R17 A;  4ZVZ A;  1XZW A;  3FGA C;  4FBK A;  3DSD A;  1HO5 A;  3THN A;  3K7W C;  3QFK A;  3QFO A;  2IE3 C;  2WDD A;  1TCO A;  1AUI A;  5INB A;  1QHW A;  2NYM C;  3TGH A;  2IE4 C;  3N5U A;  3IB7 A;  4H1Y P;  4UT3 A;  3DSC A;  3JYF A;  1S3N A;  5F3W A;  4ORC A;  2BQ8 X;  2O8G A;  2HYO A;  4MP0 A;  4ORA A;  4UT2 A;  4UWQ A;  4HD0 A;  4B2O A;  1HP1 A;  1S8E A;  1KBP A;  2P6B A;  2CV9 A;  3KBP A;  1WAO 1;  4V0V A;  2WDC A;  4TUI A;  4O24 A;  4O5G A;  3H67 A;  4KBP A;  4Q7F A;  3RQZ A;  4IL1 A;  5J28 A;  3GVE A;  3THO B;  2WDE A;  3ICF A;  2ZBM A;  4M0V A;  2DFJ A;  1MF8 A;  4JA9 A;  4J6O A;  1II7 A;  4O4K A;  1M63 A;  1NNW A;  4H2F A;  3EGG A;  2Z06 A;  1USH A;  4LU9 A;  3EGH A;  2Z1A A;  2Z72 A;  4XPN A;  4IYP C;  4DHL A;  3QFN A;  4ZX2 A;  1W24 A;  5GTU A;  5JJT A;  3H68 A;  5HPE A;  2GJU A;  4V0W A;  1S70 A;  1OI8 A;  4ORB A;  1T71 A;  3ZTV A;  2O8A A;  3P71 C;  4I5L C;  4LTY A;  3RL4 A;  5IOH A;  3E7A A;  5JPE A;  3IVE A;  3H63 A;  3AUZ A;  5C1V A;  2NXF A;  3HVQ A;  3T1I A;  3RL5 A;  3ZU0 A;  1OID A;  3PSN A;  3H60 A;  2WDF A;  3AV0 A;  5EQV A;  2JOG A;  3E7B A;  4I5N C;  4MOY A;  4LAC C;  5JPF A;  3QG5 C;  3RL3 A;  4DSY A;  2HYP A;  1WAR A;  2IAE C;  4FCX A;  3C9F A;  2KKN A;  3QFM A;  2HY1 A;  2USH A;  3LL8 A;  4NZV A;  1T70 A;  2QFP A;  4FBQ A;  3DW8 C;  1OIE A;  1JK7 A;  4F0Z A;  1S95 A;  1S3L A;  4H2I A;  4WWL A;  1S3M A;  4H1S A;  1UF3 A;  4TUG A;  1U32 A;  4OR9 A;  3IB8 A;  3H66 A;  3H69 A;  5B8I A;  4DT2 A; 
#chains in the Genus database with same CATH topology
 3H62 B;  4UT3 B;  1IT6 A;  3K7V C;  1HPU A;  1FJM A;  4MOV A;  4O43 A;  1UTE A;  1G5B A;  2NPP C;  2BCD A;  2A22 A;  2QFR A;  2QJC A;  4YKE A;  3V4Y A;  4KKZ A;  4V0X A;  1SU1 A;  2AHD A;  2XMO A;  3CK2 A;  4FBW A;  2Q8U A;  3C5W C;  1V73 A;  4JA7 A;  1QFC A;  1Z2X A;  3H64 A;  3PSO A;  4H2G A;  5DNY A;  3H61 A;  1XM7 A;  2ZOA A;  4H2B A;  1Z2W A;  2BDX A;  2NYL C;  2YVT A;  4G9J A;  3IVD A;  2R17 A;  4ZVZ A;  1XZW A;  2DXN A;  3FGA C;  4FBK A;  3DSD A;  1HO5 A;  3THN A;  2ZO9 B;  3K7W C;  3QFK A;  3QFO A;  2IE3 C;  2WDD A;  1TCO A;  1AUI A;  5INB A;  1QHW A;  2NYM C;  3TGH A;  2IE4 C;  3N5U A;  3IB7 A;  4H1Y P;  4UT3 A;  3DSC A;  3JYF A;  1S3N A;  5F3W A;  4ORC A;  2BQ8 X;  2O8G A;  2HYO A;  4MP0 A;  4ORA A;  4UT2 A;  4UWQ A;  4HD0 A;  4B2O A;  1HP1 A;  1S8E A;  1KBP A;  2P6B A;  2CV9 A;  3KBP A;  1WAO 1;  4V0V A;  2WDC A;  4TUI A;  4O24 A;  4O5G A;  3H67 A;  4KBP A;  4Q7F A;  3RQZ A;  4IL1 A;  5J28 A;  3GVE A;  3THO B;  2WDE A;  3ICF A;  2ZBM A;  4M0V A;  2DFJ A;  1MF8 A;  4JA9 A;  4J6O A;  1II7 A;  4O4K A;  1M63 A;  1NNW A;  4H2F A;  3EGG A;  2Z06 A;  1USH A;  4LU9 A;  3EGH A;  2Z1A A;  2Z72 A;  4XPN A;  4IYP C;  4DHL A;  3QFN A;  4ZX2 A;  1W24 A;  5GTU A;  5JJT A;  4DT2 A;  3H68 A;  5HPE A;  2GJU A;  4V0W A;  1S70 A;  2YEQ A;  1OI8 A;  4ORB A;  1T71 A;  3ZTV A;  2O8A A;  3P71 C;  4I5L C;  4LTY A;  3RL4 A;  5IOH A;  3E7A A;  5JPE A;  3IVE A;  3H63 A;  3AUZ A;  5C1V A;  2NXF A;  3HVQ A;  3T1I A;  3RL5 A;  3ZU0 A;  1OID A;  3PSN A;  3H60 A;  2WDF A;  3AV0 A;  5EQV A;  2JOG A;  3E7B A;  4I5N C;  4MOY A;  4LAC C;  3E0J A;  3QG5 C;  3RL3 A;  4DSY A;  2HYP A;  1WAR A;  2IAE C;  4FCX A;  5JPF A;  3C9F A;  2KKN A;  3QFM A;  2HY1 A;  2USH A;  3LL8 A;  4NZV A;  1T70 A;  2QFP A;  3FLO A;  4FBQ A;  3DW8 C;  1OIE A;  1JK7 A;  2DXL A;  1S95 A;  1S3L A;  4H2I A;  4F0Z A;  4WWL A;  1S3M A;  4H1S A;  1UF3 A;  4TUG A;  1U32 A;  4OR9 A;  3IB8 A;  3H66 A;  3H69 A;  5B8I A;  3D03 A; 
#chains in the Genus database with same CATH homology
 3H62 B;  4UT3 B;  1IT6 A;  3K7V C;  1HPU A;  1FJM A;  4MOV A;  4O43 A;  1UTE A;  1G5B A;  2NPP C;  2BCD A;  2A22 A;  2QFR A;  2QJC A;  4YKE A;  3V4Y A;  4KKZ A;  4V0X A;  1SU1 A;  2AHD A;  2XMO A;  3CK2 A;  4FBW A;  2Q8U A;  3C5W C;  1V73 A;  4JA7 A;  1QFC A;  1Z2X A;  3H64 A;  3PSO A;  4H2G A;  5DNY A;  3H61 A;  1XM7 A;  2ZOA A;  4H2B A;  1Z2W A;  2BDX A;  2NYL C;  2YVT A;  4G9J A;  3IVD A;  2R17 A;  4ZVZ A;  1XZW A;  2DXN A;  3FGA C;  4FBK A;  3DSD A;  1HO5 A;  3THN A;  2ZO9 B;  3K7W C;  3QFK A;  3QFO A;  2IE3 C;  2WDD A;  1TCO A;  1AUI A;  5INB A;  1QHW A;  2NYM C;  3TGH A;  2IE4 C;  3N5U A;  3IB7 A;  4H1Y P;  4UT3 A;  3DSC A;  3JYF A;  1S3N A;  5F3W A;  4ORC A;  2BQ8 X;  2O8G A;  2HYO A;  4MP0 A;  4ORA A;  4UT2 A;  4UWQ A;  4HD0 A;  4B2O A;  1HP1 A;  1S8E A;  1KBP A;  2P6B A;  2CV9 A;  3KBP A;  1WAO 1;  4V0V A;  2WDC A;  4TUI A;  4O24 A;  4O5G A;  3H67 A;  4KBP A;  4Q7F A;  3RQZ A;  4IL1 A;  5J28 A;  3GVE A;  3THO B;  2WDE A;  3ICF A;  2ZBM A;  4M0V A;  2DFJ A;  1MF8 A;  4JA9 A;  4J6O A;  1II7 A;  4O4K A;  1M63 A;  1NNW A;  4H2F A;  3EGG A;  2Z06 A;  1USH A;  4LU9 A;  3EGH A;  2Z1A A;  2Z72 A;  4XPN A;  4IYP C;  4DHL A;  3QFN A;  4ZX2 A;  1W24 A;  5GTU A;  5JJT A;  4DT2 A;  3H68 A;  5HPE A;  2GJU A;  4V0W A;  1S70 A;  2YEQ A;  1OI8 A;  4ORB A;  1T71 A;  3ZTV A;  2O8A A;  3P71 C;  4I5L C;  4LTY A;  3RL4 A;  5IOH A;  3E7A A;  5JPE A;  3IVE A;  3H63 A;  3AUZ A;  5C1V A;  2NXF A;  3HVQ A;  3T1I A;  3RL5 A;  3ZU0 A;  1OID A;  3PSN A;  3H60 A;  2WDF A;  3AV0 A;  5EQV A;  2JOG A;  3E7B A;  4I5N C;  4MOY A;  4LAC C;  3E0J A;  3QG5 C;  3RL3 A;  4DSY A;  2HYP A;  1WAR A;  2IAE C;  4FCX A;  5JPF A;  3C9F A;  2KKN A;  3QFM A;  2HY1 A;  2USH A;  3LL8 A;  4NZV A;  1T70 A;  2QFP A;  3FLO A;  4FBQ A;  3DW8 C;  1OIE A;  1JK7 A;  2DXL A;  1S95 A;  1S3L A;  4H2I A;  4F0Z A;  4WWL A;  1S3M A;  4H1S A;  1UF3 A;  4TUG A;  1U32 A;  4OR9 A;  3IB8 A;  3H66 A;  3H69 A;  5B8I A;  3D03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...