2A24A

Haddock structure of hif-2a/arnt pas-b heterodimer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
KTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endothelial PAS domain protein 1
publication title Structural basis of ARNT PAS-B dimerization: use of a common beta-sheet interface for hetero- and homodimerization.
pubmed doi rcsb
molecule tags Transcription
total genus 27
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2a24A00
3UB9A 4HQAA 3FC7A 4R70A 5AVFA 3VE4A 3H9WA 1LSXA 4HP4A 1BYWA 5F6AA 3H82A 3PHYA 5KIZA 1OTAA 5HWTA 4B9OA 2A24B 5DJTA 1OJGA 4XT2A 4WN5A 4HNBA 4HP9A 4L9GA 1S4RA 2PHYA 4GHIB 3NOUC 4HH2A 5HSQA 4EQ1A 2PDRA 1GSXA 3P7NA 1XFNA 5DKKA 4EEUA 3H82B 4WF0A 2PD8A 3SW1A 4YWZA 2V0UA 2QHKA 3BY9A 2B02A 1OTEA 2VV6A 1UGUA 3VOLA 4GS9A 4HHDA 3ULFA 3GDIA 3CWFA 3LIFA 4I5SA 1TS6A 3RH8B 4MN6A 1TS8A 4L9FA 1OTIA 3NOPC 4GW9A 2R78A 2V1AA 2CMNA 1OT9A 4LLOB 5G4ZA 1G28A 3ZQ5A 1Y28A 2HV1A 4HOIA 4NXBA 4EESA 5IS1A 3H7WA 1MZUA 5HZHA 4BBTA 2D01A 3HJIA 3F1PA 2OWJA 1LSVA 2L4RA 3IBRA 4GS9B 3UB7A 4KQDA 2JN7A 3UE6A 2KDKA 4HJ4A 1OTDA 2PR6A 3MQOA 5A8BA 1D7EA 3KX0X 2PR5A 1P0ZA 3T50A 1T18A 2ZOHA 4RQ9A 3E4OA 5I5LA 3MJQA 2L1MA 4EERA 5EFWA 3E4PA 1D06A 2H28A 5HWWA 2YKHA 5J3WA 1EW0A 5IU1A 1S4SA 1WA9A 3H7WB 4I3AA 3BY8A 3EWKA 4H6JB 2QWSA 3F1PB 4K08A 1T1CA 2Z6CA 4M4XA 3NHQA 3UMDA 2PYRA 4EEPA 4I3IA 3MQQA 1X0OA 3FG8A 1XFQA 3LI9A 4NXFA 5AVEA 3OLOA 5J7EA 4R6LA 2YKFA 3K3DA 3UB6A 4HIAA 2OWHA 4WUJA 2D02A 1XJ2A 1F9IA 2GJ3A 1N9LA 4LRZE 3IS2A 3B33A 1VB6A 3LICA 4R38A 2J80A 3C8CA 4PKYA 1V9YA 1XJ6A 1S1YA 4JGQA 1XJ4A 3LIBA 2VEAA 1ODVA 1DP8A 1UWNX 3MXQA 2QJ7A 3LUQA 2M1CA 2W0NA 4H6JA 5J4EA 1OTBA 1JNUA 1OT6A 3IS2B 5F68A 5G4YA 5HD3A 3CAXA 4E04A 1GSVA 4WLAA 3A0RA 4LRXC 5F5YA 2EA9A 2L0WA 2I9VA 3PYPA 4HJ6A 4I39A 4LRYC 3D72A 1S67L 2PD7A 3A0SA 2ZOIA 3LYXA 3LIDA 1DP6A 2Z6DA 3ICYA 5DKLA 5F69A 4BBVA 1DP9A 2K7SA 3E4QA 3GECA 2V0WA 1S1ZA 5DJUA 2WKQA 2INWA 5HDCA 4JGRA 4HI4A 1OJ5A 2QKPA 1LT0A 5HD5A 3C2WA 2V1BA 2P7JA 4HH3A 3CLOA 3F1NA 1KOUA 4BBUA 4JGPA 2BASA 4HY8A 4I3JA 5TBMA 4F3LA 1N9OA 3HJKA 4DJ3A 1T1BA 3MR0A 4KUKA 2V9AA 3BWLA 4EW7A 4EETB 3A0VA 3RTYA 3F1OA 4DJ2A 2OOLA 4LPZA 2JHEA 3NOTC 2W27A 2ZBBA 4HJ3A 4JGOA 1N9NA 1T19A 1LSWA 1TS0A 2VLGA 4XT2B 1V9ZA 3F1NB 1P97A 4EXOA 1F98A 3LIAA 4MN5A 2QJ5A 4R3AA 5TBMB 2KX6A 4F3LB 3LI8A 3K3CA 1LL8A 1DRMA 5HDDA 5HDSA 5HWVA 3LIEA 3F1OB 4L9EA 4WL9A 2VV7A 3VE3A 3UB8A 3MFXA 4KUOA 4NXEA 1GSWA 2A24A 2PYPA 1XJ3A 3UMEA 1UWPX 2WKRA 4I38A 3EEHA 4PKYG 1NWZA 2WKPA 4GHIA 1T1AA 1S66L 4GCZA 3G6OA 4NXGA 2VV8A 1TS7A 3NJAA
chains in the Genus database with same CATH superfamily
3UB9A 4KZ7A 1P9RA 2MJ6A 3W2ZA 3N7WA 3HUOA 3P09A 4D2OA 4OQ0A 1BYWA 1LL9A 2J8YA 3H82A 5KIZA 3BYDA 4DE0A 2ZC6B 3GR2A 1BSGA 1VEUA 3IF6A 3QP6A 3UB5P 2UV0E 5FSRA 1MWTA 4HNBA 4HP9A 4L9GA 1DJCA 4UEYA 4OLGA 2J3TC 4KG6A 4XXRA 4BD1A 4Z9QA 5CERA 1SKOA 5CGWA 3A3IA 3HLCA 4PM8A 1XFNA 4GD6A 2XEPA 1K6RA 1BTLA 2XSSA 5CGSA 2JKRI 4WF0A 2XROA 3PAEA 2HP6A 1PZOA 5DF9A 3V50A 4WEKA 5FDHA 1K57C 4OLDA 1IEMA 4YOFA 3A3FA 2B02A 3QP2A 2E8JA 1NYMA 2WZZA 4G3WA 3T1SA 3KSIA 3BFCA 2UWXA 2K31A 3T4KA 2Y91A 2JKGA 3CWFA 1TD5A 4MN6A 1ERMA 2V1AA 2J9OA 1ONHA 3G32A 3N8SA 3G34A 2Y59A 1NRJA 5FATA 4NXBA 4EESA 5IT5A 5M1AA 5EVIA 1JWZA 1MZUA 4BBTA 1RGYA 2D01A 1MBLA 2B5RA 1LSVA 3GTCA 3VSLA 1YLYA 4X68A 2JN7A 1PI5A 5FQQA 4Z1WA 5GLCA 3UE0A 5GLDA 1OTDA 5GL9A 1S6RA 2PR5A 1FQGA 3E4OA 4EERA 4O0PA 3VP0A 3CHWP 3Q7VB 1D06A 2H28A 2K2NA 5FQMA 2YKHA 5IU1A 1IKGA 3OCNA 2P9VA 3WRTA 3H7WB 2VA0A 3MKFA 4K91A 3CZDA 4H6JB 4MN7A 1ONGA 3ZCZA 2ZD8A 4E3LA 1XP4A 4ZDXA 3OPRA 3F1PB 4K08A 3WRZA 3W4QA 4ARZB 2HDUA 4GJ4A 3DW0A 1U60A 3HCYA 3T4SA 3OLOA 3PBSA 5GLAA 4MBHA 1PWDA 2W1RA 4R6LA 5A90A 2YKFA 4QPRA 4XUXA 5DTTA 3ZVTA 1ERQA 5DF8A 4MMNA 4HIAA 3QP1A 2OWHA 2A49A 1H8YA 4G3VA 3S7NA 1XKZA 1PWGA 5HW3A 3KSFA 2GJ3A 4BL2A 4WM9A 4P6ZM 4LRZE 3CI6A 5HARA 2IWCA 1JVJA 1VB6A 4QD4A 4LV1A 4CPKA 4MBFA 3C8CA 3NIAA 3QP4A 4ZBEA 1EWZA 1V9YA 1KVLA 1S1YA 3CUEC 2FFYA 4GZBA 1CI9A 3IX4A 2W3GA 3IBJA 1J9MA 1ODVA 4O8GA 5TJJA 5FQJA 3Q7VA 4QHCA 4HESA 1IYOA 1YQSA 1YLZA 1KGEA 1O07A 4H6JA 3UDXA 3T4TA 1OTBA 1F5MA 3IHAA 3R7WA 5F68A 5A91A 5HAPA 1HD8A 4L0LA 1GA0A 5AQAA 3HL9A 5F82A 1GSVA 3U4LP 4DMZA 2EA9A 2NUPC 1YLPA 2WZXA 3UY6A 4PM5A 2JKFA 1FR1A 5CHUA 3A0SA 1FOFA 2ZOIA 3DAVA 1N4OA 2EX8A 5HAIA 3UPNA 4C3QA 3ICYA 3IF5A 1MXOA 5DKLA 2Y2GA 4HBTA 5CEDA 3E4QA 4O7DA 5AQ9A 2V0WA 1S1ZA 5DJUA 3VOYA 2HDRA 2Y2IA 2WKQA 4LGWA 1E25A 1NLZA 2CC1A 4HI4A 2DMWA 3C38A 2OLVA 5CGXA 2QKPA 1LT0A 3A3DA 2ZM2A 2JKRM 4WELA 4UA6A 3MBZA 4EU0A 4FH4A 2G2WA 1KOUA 3HLFA 3N4IA 1OMEA 4MBKA 3SS3A 4HY8A 4OQHA 1I2WA 4F3LA 1PW1A 3BECA 4DJ3A 2EX9A 4DKIA 1Y54A 3BQ8A 5E2HA 3MR0A 3K2NA 3C7UA 2VGKA 3CPTA 5BOHA 5EV0A 5GHZA 4RA7A 3HLEA 2ZBBA 4WMCD 1JWPA 2ZMAA 1KGFA 4MLLA 2J9PA 3CMZA 2WKHA 2XDMA 4OVDA 1TS0A 2VLGA 4XT2B 1V9ZA 4OONA 4EXOA 2PRFA 1F98A 4FOFA 1FCMA 5FI7A 3AGDA 1G6AA 2Z2LB 5HDDA 4UQIM 5DF7A 3UPPA 2O9AA 5EVLA 4EBPA 4CLCB 5HX9A 4Y17A 2XK1A 3TJZC 1PNEA 4GNUA 1KDSA 5L07A 1ES5A 2WGWA 3M2KA 3MZDA 1K55C 4Y0TA 3Q81A 2Y2JA 1YM1A 1E4DA 2A24A 1XJ3A 4QY6A 2QZ6A 4I38A 4E3KA 3EEHA 3OZHA 4PKYG 1MWRA 2P04A 5CTNA 1IYPA 1LLBA 1Z09A 3S4XA 1T1AA 4NXGA 3BJNA 4B4XA 1KGGA 4EUVA 4JXGA 5HL6A 3DWZA 3OBFA 2H5SA 4UAAA 2DNSA 5DTSA 4HP4A 3V5MA 2WADA 4RX2A 3MQ0A 1MWUA 1CJFA 4YNRA 4XT2A 3WS2A 4WN5A 5GLBA 1KE3A 4WYYA 3RFBA 3G30A 3G35A 1W63Q 4YINA 4GHIB 3VP3A 2OAQ1 3NOUC 2Y2MA 4GDBA 4EQ1A 4WBGA 4FUWA 5CHMA 4Y0OA 2M7VA 4KQQA 1GSXA 4DN0A 1L0EA 1AWIA 1PWCA 2EXBA 3NECA 3UN7A 3BEBA 3P7NA 3IWQA 1PFLA 5DKKA 4IHQA 1K6SA 3IT9A 3IQAA 5FI6A 1XX2A 2XLNA 3H82B 4B88A 2PD8A 3RJUA 1SDEA 4LFUA 4NEED 1DJAA 1VEUB 3IF6B 1OTEA 4GB7A 5GHXA 2IA2A 3JVUA 4GS9A 1ES2A 4S2NA 4XUZA 4MDZA 3HVFA 1Z6FA 2VJWA 3ULFA 1CK3A 4I5SA 3RH8B 1XGJA 1SKOB 1TS8A 3NOPC 5EOEA 3FPWA 2CMNA 3A3EA 1OT9A 4N1XA 3C30A 4LLOB 4M3KA 4PAUA 2V20A 5G4ZA 2A3UA 3N8LA 1Y28A 2W1TA 5FA7A 3LEZA 5J8XA 5EECA 4DE1A 1SKFA 1MKIA 2FZ0A 5CX7A 2OWJA 2H0YA 3UB7A 3LY4A 2A2LA 2HGVA 5DTKA 3UDIA 4JBFA 4RYEA 3HLWA 3DTEA 5A8BA 3KX0X 1RGZA 3EOIA 4H8RA 2L1MA 5EFWA 5FI2A 2W3DA 4BMWA 2JE5A 4DE3A 3IHBA 5FQ9A 1WA9A 5EVIB 1YLTA 4DE2A 1SDNA 3BY8A 3GSGA 2X01A 4R4RA 3EWKA 4P0MA 2V1ZA 4P6BA 4PMAA 4OOYA 4QWOA 1T1CA 4E3OA 3VSKA 4M4XA 3NHQA 5F1FA 1WE4A 3LGOA 3ISGA 3MQQA 1KE4A 3LI9A 3PBNA 3DTIA 2ZC4B 4Y15A 4FD8A 4KQRA 4NETA 3PBQA 4NK3A 4WUJA 1W8QA 2D02A 1F9IA 2P9VB 2Y8HA 3T12B 3O3VA 4UHUA 3LR0A 1VHMA 1Q2QA 4II7A 4ZJ3A 1BZAA 3IS2A 3IX8A 3B33A 1PW8A 1VQQA 1K55A 2XA7S 4OPZA 5TR7A 4PKYA 2XF3A 3NY4A 4C75A 1K4FA 2V2FF 4JLFA 4EUZA 1XJ6A 3SS4A 4HEFA 4JGQA 4Q0HA 4EWFA 3EQVA 4U0TA 3LIBA 3O5YA 3TSGA 4S2OA 3IH8A 3PBOA 5C5KA 1XGIA 3M2JA 3KSHA 2WKIA 3ZVWA 3WWXA 1ZKJA 3LR5A 5DFYA 3TRCA 1MKMA 3V39A 5E2GA 4R1GA 3CAXA 4BL3A 3NCKA 4R0QA 1W8YA 2VGJA 3UE3A 4WLAA 1XA7A 5F5YA 3HREA 3P98A 4LRYC 1QMFA 2HJEA 2OV5A 1TF1A 3OPLA 4ZTKA 5JYOA 1DP6A 4CLCE 2H0TA 3DTKA 4R3BA 4ZJ1A 1F2KA 1BLCA 3FKVA 4BBVA 4ZRRA 4Q8IA 3IXGA 1CEGA 1Y4OA 3VMAA 3R7WB 2INWA 5HDCA 4WZ5A 1YLWA 2H10A 3ZG0A 3MMHA 3Q7ZA 4OOLA 4MCWA 3OC2A 3BFGA 5HD5A 2ZM8A 1JTDA 1NRFA 5D3OA 3AGEA 3T4LA 1GA9A 5A93A 5TGFA 3CLOA 5FAQA 3PTEA 5AQBA 5E2EA 1O7EA 4P85A 4GD8A 2BASA 2GZAA 3CJMA 4I3JA 5TBMA 1N9OA 3SZTA 5EPHA 2V9AA 3C7VA 3MSHA 3A0VA 3RTYA 3F1OA 2OOLA 4HJ3A 4CLCD 3DTMA 3MZFA 3FKWA 4ZJ2A 2WYXA 5CTMA 4X53A 1FR6A 1BLSA 2WUQA 4X1MA 1ALQA 3C4OA 3BLSA 1LI0A 4ME4A 3GVBA 4R3AA 1ZG4A 2KX6A 2WK0A 3L9KA 4F3LB 3SH8A 3T4QA 4OKPA 4Y0UA 1LL8A 5M18A 2G7UA 1IKIA 2GNXA 2ZMVA 3LO7A 4KZ5A 1GCEA 2R9XA 2Y2OA 3QHYA 3VP1A 3CPTB 2RCXA 2QYBA 4E3IA 5CEBA 4L9EA 4JPMA 4WL9A 3UB8A 5F1GA 3MFXA 4IVKA 4KUOA 3D4FA 3T1RA 1VM1A 1ZHHB 4CLCC 3B42A 4MEZA 1MWSA 2KOIA 5FQIA 2HPBA 4A5RA 1JTGA 1K54C 3UMEA 1MPLA 3QNBA 3JVVA 2PT7A 4S2IA 3SS5A 3ZGAB 2LB9A 5HPIA 4ZAMA 2HJ9C 1GHMA 3E2KA 1EROA 1S66L 2ZL1A 4GCZA 1TEMA 3HUNA 2ACGA 1TS7A 3NJAA 1YSPA 4BD0A 1GHIA 1AXBA 4HQAA 5AVFA 2FFFB 1IFQA 3MXRA 1FCNA 1K57A 2HP9A 3U2AA 3H9WA 1J3WA 5DVAA 3M6HA 2ZQAA 4F94A 3G4PA 3R4KA 5F6AA 1W63M 5HWTA 2WGWB 4B9OA 3LY3A 2A24B 2P08A 5DJTA 2PAVP 4MNRA 5FAPA 2OSUA 1FILA 1TDLA 4QY5A 2XFTA 3SH7A 5HSQA 3IWIA 4S2PA 5FEFA 2PU4A 2PDRA 3RXWA 3D9YA 4PM6A 3ITBA 4EEUA 1BT5A 3LCEA 1N9BA 4FTXA 4O01A 3SW1A 4NG2A 3NBLA 1DJBA 1BLPA 3IX3A 1W7FA 1HTZA 2V8CA 2V0UA 2QHKA 3V3SA 2XFSA 4JF6A 4YFMA 1L0DA 2VV6A 3VOLA 4HHDA 4E3MA 2RL3A 3GDIA 1BUEA 3LIFA 1TS6A 5CECA 4X69A 4GW9A 3UE1A 3MF0A 2O99A 2R78A 2O0YA 1HLUP 2C5WB 2ZQ8A 5E2FA 4OH0A 5EVEA 4HOIA 2HP5A 4PM7A 2B18A 4JXSA 5HZHA 1SCWA 2ZM0A 3ZFZA 2W3HA 2L4RA 3IBRA 4GS9B 2XD5A 2EX6A 3S22A 3N8RA 1NY0A 1L0FA 4HJ4A 2PR6A 2EFUA 3VOZA 1LL5A 3T50A 1P0ZA 5L2FA 5EUAA 5I5LA 4IUHA 4S2KA 3T1XA 5J3WA 4RX3A 1HZOA 4JF4A 1S4SA 2W1TB 4EQIA 4BQMA 2IWDA 1IYQA 3D3OA 3EGXC 1H0MA 4PM9A 3B3XA 1ESIA 2ZC3B 3CUEA 4LCMA 3ZHHA 3T4OA 2VGLS 3JYIA 4N9KA 4GDNA 2BG1A 4I3IA 5L10A 1X0OA 3FG8A 1K56D 4NXFA 2WGIA 1HVBA 3EEAA 1XXMA 3LR3A 1Q2PA 3QP5A 3Q82A 3K3DA 5M19A 2HDSA 5LBRA 1K0KA 2XA7M 3KO6A 2EWVA 3ZG5A 1VETA 1YAXA 3E2LA 5L09A 3HBRA 3IWOA 3ITAA 2R9WA 4UA7A 4D60A 2PBDP 2Y2QA 1IYSA 2VKSA 5DFXA 1ZTUA 1H5XA 3NI9A 2Y2NA 5K5BA 1YMXA 5HAQA 4X6TA 5I94A 1MC0A 1I5QA 3FV7A 2VEAA 4FSFA 4JXVA 3LFVA 4K0WA 3O86A 1DP8A 1UWNX 3C5AA 3HLGA 3LUQA 1KDWA 2EX2A 2V8FA 4DRTA 1P9WA 2M1CA 2W0NA 4IBRA 5J4EA 3LEQA 5FQKA 3IS2B 3G2ZA 3MS6A 1G68A 3W8KA 5TFQA 4EBLA 1G5UA 2JC7A 4E04A 2J7VA 3FPVA 3Q07A 3A0RA 3IXDA 4Y5FA 2ZLYA 2I9VA 4LENA 3C4PA 3UPOA 4GKUA 1S67L 2PD7A 4IJGA 1KVMA 2WKEA 3S7PA 1LI9A 2HZ5A 3LYXA 2J3WA 3KSGA 5EM1A 4Q0IA 1XA1A 2Y2HA 2C6WB 2HF6A 2QMIA 3PBTA 5KSCA 4GN2A 4QU3A 2Q9NA 3ZNTA 4JGRA 3SOIA 3S7OA 1K4EA 4OQGA 5KZHA 3BW6A 4BJPA 3C2WA 4EV4A 3VV4A 1H8MA 3JPUA 2P7JA 3F1NA 4PHTA 4OP5A 1NJ4A 5FASA 4LV0A 2XH9A 2Y2PA 3PAGA 3HJKA 4LV2A 3TE8A 1T1BA 4KUKA 3BWLA 4EW7A 4EETB 4WMCA 4KZAA 3VP2A 3ZG7B 3KYQA 4DJ2A 5G18A 4LPZA 4KZ4A 2JCHA 2P74A 3NOTC 3IXHA 2ZMFA 3HLBA 2O9CA 3HLDA 4JGOA 4G3KA 1ES4A 5EE8A 4FCFA 2XD1A 2ZQDA 3ZDJA 1T19A 2ZQ9A 3BFFA 5FEGA 1IOUA 1L2SA 1P97A 5AQ7A 1QMEA 5TBMB 3ZYTA 2E8IA 3FWLA 2EWWA 1PI4A 3K3CA 1DRMA 4X1LA 2AVXA 4OPYA 1TDGA 4E6XA 1IELA 5HDSA 5A92A 1NZUA 1RCJA 3LIEA 3F1OB 2DRWA 3GMWA 3TOIA 4OQIA 3VE3A 4R3JA 1CQAA 1GSWA 3DBAA 1NYYA 3BFEA 4LV3A 3T1QB 5EOOA 1RP5A 3W4PA 3QP8A 2PBYA 2W3EA 4Y13A 3PR6A 2WKPA 3G6OA 1WYBA 2ZQCA 3FC7A 4R70A 3VE4A 4K0XA 2Y2KA 4E3NA 2W3FA 1LSXA 2GDNA 3ZNYA 3PHYA 1OTAA 3MFDA 3VFHA 1BLHA 5HL1A 1TVFA 3E0YA 1OJGA 3KYZA 3EQUA 1SZVA 4Y7PA 4GLQA 1S4RA 1K56A 4P87A 5IHVA 2PHYA 1ESUA 5GHYA 1FSWA 2PU2A 1PYYA 4KG5A 2WAEA 2ZL1B 5KMWA 4HH2A 4OPRA 3BM6A 2GX5A 3DWKA 3OPPA 3V3RA 5EM0A 4AFIA 2I72A 4N1HA 1FSYA 2JKTI 4BENA 3BLMA 1W79A 3Q1FA 4E6WA 4YWZA 1CEFA 1JWVA 3O87A 3BY9A 2NUTC 1UGUA 5JYPA 1BULA 3V67A 4HBUA 3FZCA 4LCLA 1E3UD 3L7HA 1FIKA 4L9FA 1OTIA 4FH2A 2XGNA 2Z2MB 2HDQA 3PXPA 4Y3IA 5E43A 1K25A 1M6KA 1G28A 3ZQ5A 4S2JA 2HV1A 3HUMA 3BRMA 3S7QA 4KQOA 3MZEA 5IS1A 3H7WA 3BFDA 3HJIA 1OPXA 3F1PA 4IUKA 1G6OA 5AJGA 4ARZA 4X55A 4KQDA 5FAOA 4IVIA 3UE6A 2G2UA 1YKDA 4S2LA 2KDKA 4DXBA 4EBNA 1C3BA 3OPHA 1PIOA 3MQOA 1KE0A 1D7EA 3WS4A 1A0KA 1T18A 4S2NC 2ZOHA 5CHJA 4RQ9A 3G2YA 3MJQA 3E4PA 4KG2A 2VGLM 4KZ9A 5HWWA 2WAFA 4E3JA 1EW0A 4OOMA 2XR0A 2KLIA 3IXBA 4GOGA 4I3AA 3M6BA 4DDYA 3TW8A 2QWSA 2ZQ7A 2LB5A 4PPRA 1NXYA 2Z6CA 5MC7A 1XPBA 3UMDA 2PYRA 4EEPA 3MKEA 2B95A 1XFQA 3S1YA 2VX8A 4JKTA 4N92A 5AVEA 5KSHA 1H3QA 3N6IA 5J7EA 2BTFP 4Y2FA 4QJGA 3UB6A 4R23A 1YPRA 3P01A 1XJ2A 2X71A 3G31A 4DF6A 1N9LA 3WS1A 1YLJA 2WGVA 1L0GA 3I7JA 3RXXA 3LICA 3CITA 4U0XA 4R38A 1STZA 3GV9A 2EXAA 2J80A 4CJNA 1PRQA 4DDSA 2Q0OA 3VP4A 4P6ZS 1M40A 3IF6C 3IH9A 1PZPA 2ZC5B 1XJ4A 4C6YA 5CRFA 5CXWA 3OCLA 3OOVA 1ZC2A 3MXQA 1VETB 2QJ7A 4ESPA 2Y55A 1NLYA 3NC8A 3UDFA 1JNUA 1OT6A 5G4YA 5EVID 5HD3A 3ZG8B 3VFFA 2Y4AA 4U3TA 2OLUA 1YMSA 3ZG9B 1D1JA 4KZ3A 1NZOA 2QPNA 1YSQA 4LRXC 1CF0A 4X25A 2L0WA 2M7UA 1K38A 3PYPA 4IEDA 4HJ6A 4I39A 1CI8A 1FCOA 3D72A 2XQZA 4JXWA 3WS0A 2OAP1 1H8ZA 3LIDA 2Z6DA 3GRJA 5F69A 1DP9A 1ES3A 2K7SA 3GECA 5FL3A 3QNCA 4WZ4A 4BLMA 4S2MA 2VZWA 1L3LA 3CG5A 4KZBA 4JF5A 4ETXA 3LR4A 2ZC7A 1WYCA 2IWBA 5EVIC 2Y79A 3NDGA 3WS5A 4N9LA 1ZG6A 1OJ5A 1I2SA 2VK3A 4KZ8A 2JKTM 1SHVA 1ACFA 4R4SA 2V1BA 2XRNA 3BQAA 3FYZA 2ZJ9A 4HH3A 2X02A 4BBUA 4JGPA 2FH5A 2JBFA 1W5DA 4B4ZA 3A3JA 5HFOA 2Y2LA 1DY6A 1S0WA 3UO9A 3O88A 4Q0JA 4CLCA 2JHEA 4ETZA 5HPFA 1LHYA 4KZ6A 1K54A 2W27A 3W4OA 4RVAA 3NDEA 4UA9A 3NULA 4WZ5C 3MXSA 4CQHA 1N9NA 2EFXA 4BWIA 5FDSA 2BLSA 2O9BA 1LSWA 3AGFA 3F1NB 1E3UA 4IBXA 3EGDC 3LIAA 4MN5A 2QJ5A 3UNWA 4OP8A 4WEJA 4OPQA 3LI8A 1MY8A 5U47A 3SH9A 3T4JA 5HWVA 4QB8A 4NKPA 3GQZA 2VV7A 3B47A 2DCFA 4NXEA 4B93A 4UQIS 1YT4A 3E98A 2PYPA 4ID4A 3PBRA 2Q9MA 1UWPX 1GHPA 2WKRA 2J3TD 5L8MA 4DXCA 1NWZA 5F83A 4X56A 3KYEA 4KENB 4GHIA 1EI5A 2VV8A 3TG9A
chains in the Genus database with same CATH topology
3UB9A 4HQAA 4EUVA 3FC7A 4R70A 5AVFA 5HL6A 1P9RA 1IFQA 2MJ6A 3VE4A 3W2ZA 3U2AA 3OBFA 3H9WA 2W3FA 1LSXA 3R4KA 4HP4A 1BYWA 1W63M 3H82A 3PHYA 5F6AA 5KIZA 1OTAA 5HWTA 4B9OA 3E0YA 3MQ0A 2A24B 2P08A 5DJTA 1OJGA 3KYZA 4YNRA 4XT2A 4WN5A 3EQUA 4HNBA 4HP9A 4L9GA 4GLQA 1S4RA 4UEYA 2PHYA 3RFBA 1W63Q 2J3TC 4GHIB 2OAQ1 3NOUC 4HH2A 5HSQA 2GX5A 4EQ1A 2M7VA 2PDRA 1GSXA 4AFIA 4DN0A 3P7NA 1XFNA 5DKKA 4EEUA 4IHQA 2XSSA 2JKTI 4O01A 2JKRI 3H82B 4WF0A 2XROA 2PD8A 5DF9A 3SW1A 4WEKA 4YWZA 4NEED 4YOFA 2V0UA 2QHKA 3BY9A 2B02A 2NUTC 1OTEA 2IA2A 2VV6A 1UGUA 3JVUA 4G3WA 3VOLA 4GS9A 3KSIA 4HHDA 2K31A 4MDZA 3T4KA 2VJWA 3ULFA 3GDIA 3V67A 3CWFA 3LIFA 4I5SA 1TS6A 3RH8B 1TD5A 4MN6A 1TS8A 4L9FA 1OTIA 3NOPC 4GW9A 3MF0A 2O99A 2R78A 2V1AA 3FPWA 2CMNA 2O0YA 3PXPA 4Y3IA 1OT9A 3C30A 4LLOB 4PAUA 5G4ZA 1G28A 3ZQ5A 1NRJA 1Y28A 2HV1A 4HOIA 3S7QA 4NXBA 4KQOA 2W1TA 4EESA 5IT5A 5IS1A 3H7WA 2B18A 1MZUA 5HZHA 4BBTA 2D01A 3HJIA 1OPXA 2FZ0A 5CX7A 3F1PA 2OWJA 1LSVA 2W3HA 2L4RA 3IBRA 4IUKA 1G6OA 4GS9B 5AJGA 4ARZA 3UB7A 4KQDA 2A2LA 2HGVA 2JN7A 4Z1WA 3UE6A 1YKDA 2KDKA 4HJ4A 1OTDA 2PR6A 3MQOA 5A8BA 1D7EA 3KX0X 2PR5A 1P0ZA 3T50A 1T18A 3EOIA 2ZOHA 4RQ9A 3E4OA 5I5LA 3MJQA 2L1MA 4EERA 4O0PA 5EFWA 3E4PA 4IUHA 1D06A 2VGLM 2W3DA 4BMWA 2H28A 5HWWA 2K2NA 2YKHA 5J3WA 1EW0A 4OOMA 5IU1A 1S4SA 2KLIA 2W1TB 3OCNA 1WA9A 3H7WB 2VA0A 3D3OA 4I3AA 3EGXC 3BY8A 3EWKA 4H6JB 4MN7A 3TW8A 2QWSA 3CUEA 3F1PB 4K08A 3T4OA 1T1CA 2LB5A 2VGLS 2Z6CA 4M4XA 4ARZB 3NHQA 5MC7A 4GJ4A 3UMDA 2PYRA 4EEPA 4I3IA 3MQQA 1X0OA 3FG8A 1XFQA 3LI9A 3HCYA 3PBNA 4NXFA 2VX8A 5AVEA 3T4SA 5KSHA 3OLOA 3PBSA 1H3QA 3EEAA 5J7EA 4Y2FA 2W1RA 3LR3A 4R6LA 2YKFA 3K3DA 4QPRA 3UB6A 5LBRA 4MMNA 4HIAA 2XA7M 2OWHA 3PBQA 3KO6A 2EWVA 4WUJA 1YAXA 3P01A 2D02A 4G3VA 1XJ2A 3S7NA 1F9IA 2Y8HA 3KSFA 2GJ3A 4P6ZM 3LR0A 1VHMA 1N9LA 4LRZE 4II7A 3CI6A 3IS2A 3B33A 1VB6A 3LICA 3CITA 4R38A 1STZA 2VKSA 1ZTUA 2XA7S 5DFXA 2J80A 3C8CA 4PKYA 5K5BA 4P6ZS 1V9YA 1XJ6A 1S1YA 3CUEC 4JGQA 1MC0A 4Q0HA 1XJ4A 3EQVA 2W3GA 3IBJA 3LIBA 3O5YA 2VEAA 4FSFA 1ODVA 4O8GA 5TJJA 3OCLA 3LFVA 3OOVA 1DP8A 1UWNX 3MXQA 3PBOA 5C5KA 2QJ7A 3LUQA 1P9WA 2M1CA 3KSHA 2W0NA 1NLYA 3LR5A 4H6JA 5J4EA 5DFYA 3T4TA 1OTBA 1F5MA 3TRCA 1JNUA 1MKMA 1OT6A 3IS2B 3R7WA 5F68A 5G4YA 5HD3A 3CAXA 4L0LA 3UE3A 4E04A 3FPVA 1GSVA 4WLAA 3A0RA 1YSQA 4LRXC 4DMZA 5F5YA 2EA9A 2L0WA 4Y5FA 2M7UA 2I9VA 3PYPA 4HJ6A 2NUPC 4I39A 4LRYC 2HJEA 3D72A 1TF1A 1S67L 2PD7A 4IJGA 3A0SA 3S7PA 2OAP1 2ZOIA 3LYXA 2J3WA 3LIDA 1DP6A 2Z6DA 4CLCE 3KSGA 4Q0IA 3ICYA 5DKLA 2HF6A 3PBTA 5F69A 4BBVA 1DP9A 2K7SA 4ZRRA 3E4QA 3GECA 5FL3A 2V0WA 1S1ZA 5DJUA 2WKQA 2VZWA 3R7WB 2INWA 5HDCA 4ETXA 3LR4A 1NLZA 4JGRA 2Y79A 4HI4A 3S7OA 2DMWA 3C38A 1OJ5A 2QKPA 3MMHA 1LT0A 4OOLA 4MCWA 3OC2A 2JKTM 5HD5A 2JKRM 3BW6A 4BJPA 3C2WA 4WELA 2V1BA 2XRNA 4EU0A 3T4LA 3BQAA 3VV4A 1H8MA 2P7JA 4HH3A 3CLOA 3F1NA 4PHTA 1KOUA 4BBUA 4JGPA 2FH5A 2BASA 4HY8A 2GZAA 4I3JA 5TBMA 4F3LA 1N9OA 3HJKA 4DJ3A 3TE8A 1T1BA 3BQ8A 3MR0A 4KUKA 2V9AA 3BWLA 3K2NA 4EETB 4EW7A 4Q0JA 4CLCA 3A0VA 3RTYA 3F1OA 3KYQA 4DJ2A 2OOLA 4LPZA 2JHEA 4ETZA 3NOTC 5HPFA 2W27A 2ZBBA 2ZMFA 4HJ3A 4CLCD 2O9CA 4JGOA 4G3KA 4CQHA 1N9NA 4BWIA 1T19A 2O9BA 1LSWA 1TS0A 2VLGA 4XT2B 1V9ZA 1IOUA 3F1NB 1P97A 4EXOA 1F98A 3EGDC 3LIAA 4FOFA 4ME4A 4MN5A 2QJ5A 4R3AA 5TBMB 2KX6A 3ZYTA 2EWWA 4F3LB 4WEJA 3T4QA 3LI8A 3K3CA 1LL8A 1DRMA 5HDDA 4UQIM 2G7UA 2GNXA 2ZMVA 2O9AA 3T4JA 5HDSA 5HWVA 4CLCB 3LIEA 2QYBA 3F1OB 4NKPA 4L9EA 4WL9A 2VV7A 3VE3A 3TJZC 3B47A 3UB8A 3MFXA 4KUOA 4NXEA 4B93A 1GSWA 3DBAA 1ZHHB 4CLCC 4UQIS 3B42A 3E98A 2A24A 2PYPA 2KOIA 3PBRA 1XJ3A 3UMEA 3JVVA 1UWPX 2WKRA 4I38A 2W3EA 3EEHA 2J3TD 2PT7A 5L8MA 4PKYG 2P04A 2LB9A 1NWZA 3PR6A 5HPIA 2HJ9C 2WKPA 4GHIA 1T1AA 1S66L 4GCZA 3G6OA 4NXGA 2VV8A 1TS7A 3BJNA 3NJAA 1YSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB9 A;  4HQA A;  3FC7 A;  4R70 A;  5AVF A;  3VE4 A;  3H9W A;  1LSX A;  4HP4 A;  1BYW A;  5F6A A;  3H82 A;  3PHY A;  5KIZ A;  1OTA A;  5HWT A;  4B9O A;  2A24 B;  5DJT A;  1OJG A;  4XT2 A;  4WN5 A;  4HNB A;  4HP9 A;  4L9G A;  1S4R A;  2PHY A;  4GHI B;  3NOU C;  4HH2 A;  5HSQ A;  4EQ1 A;  2PDR A;  1GSX A;  3P7N A;  1XFN A;  5DKK A;  4EEU A;  3H82 B;  4WF0 A;  2PD8 A;  3SW1 A;  4YWZ A;  2V0U A;  2QHK A;  3BY9 A;  2B02 A;  1OTE A;  2VV6 A;  1UGU A;  3VOL A;  4GS9 A;  4HHD A;  3ULF A;  3GDI A;  3CWF A;  3LIF A;  4I5S A;  1TS6 A;  3RH8 B;  4MN6 A;  1TS8 A;  4L9F A;  1OTI A;  3NOP C;  4GW9 A;  2R78 A;  2V1A A;  2CMN A;  1OT9 A;  4LLO B;  5G4Z A;  1G28 A;  3ZQ5 A;  1Y28 A;  2HV1 A;  4HOI A;  4NXB A;  4EES A;  5IS1 A;  3H7W A;  1MZU A;  5HZH A;  4BBT A;  2D01 A;  3HJI A;  3F1P A;  2OWJ A;  1LSV A;  2L4R A;  3IBR A;  4GS9 B;  3UB7 A;  4KQD A;  2JN7 A;  3UE6 A;  2KDK A;  4HJ4 A;  1OTD A;  2PR6 A;  3MQO A;  5A8B A;  1D7E A;  3KX0 X;  2PR5 A;  1P0Z A;  3T50 A;  1T18 A;  2ZOH A;  4RQ9 A;  3E4O A;  5I5L A;  3MJQ A;  2L1M A;  4EER A;  5EFW A;  3E4P A;  1D06 A;  2H28 A;  5HWW A;  2YKH A;  5J3W A;  1EW0 A;  5IU1 A;  1S4S A;  1WA9 A;  3H7W B;  4I3A A;  3BY8 A;  3EWK A;  4H6J B;  2QWS A;  3F1P B;  4K08 A;  1T1C A;  2Z6C A;  4M4X A;  3NHQ A;  3UMD A;  2PYR A;  4EEP A;  4I3I A;  3MQQ A;  1X0O A;  3FG8 A;  1XFQ A;  3LI9 A;  4NXF A;  5AVE A;  3OLO A;  5J7E A;  4R6L A;  2YKF A;  3K3D A;  3UB6 A;  4HIA A;  2OWH A;  4WUJ A;  2D02 A;  1XJ2 A;  1F9I A;  2GJ3 A;  1N9L A;  4LRZ E;  3IS2 A;  3B33 A;  1VB6 A;  3LIC A;  4R38 A;  2J80 A;  3C8C A;  4PKY A;  1V9Y A;  1XJ6 A;  1S1Y A;  4JGQ A;  1XJ4 A;  3LIB A;  2VEA A;  1ODV A;  1DP8 A;  1UWN X;  3MXQ A;  2QJ7 A;  3LUQ A;  2M1C A;  2W0N A;  4H6J A;  5J4E A;  1OTB A;  1JNU A;  1OT6 A;  3IS2 B;  5F68 A;  5G4Y A;  5HD3 A;  3CAX A;  4E04 A;  1GSV A;  4WLA A;  3A0R A;  4LRX C;  5F5Y A;  2EA9 A;  2L0W A;  2I9V A;  3PYP A;  4HJ6 A;  4I39 A;  4LRY C;  3D72 A;  1S67 L;  2PD7 A;  3A0S A;  2ZOI A;  3LYX A;  3LID A;  1DP6 A;  2Z6D A;  3ICY A;  5DKL A;  5F69 A;  4BBV A;  1DP9 A;  2K7S A;  3E4Q A;  3GEC A;  2V0W A;  1S1Z A;  5DJU A;  2WKQ A;  2INW A;  5HDC A;  4JGR A;  4HI4 A;  1OJ5 A;  2QKP A;  1LT0 A;  5HD5 A;  3C2W A;  2V1B A;  2P7J A;  4HH3 A;  3CLO A;  3F1N A;  1KOU A;  4BBU A;  4JGP A;  2BAS A;  4HY8 A;  4I3J A;  5TBM A;  4F3L A;  1N9O A;  3HJK A;  4DJ3 A;  1T1B A;  3MR0 A;  4KUK A;  2V9A A;  3BWL A;  4EW7 A;  4EET B;  3A0V A;  3RTY A;  3F1O A;  4DJ2 A;  2OOL A;  4LPZ A;  2JHE A;  3NOT C;  2W27 A;  2ZBB A;  4HJ3 A;  4JGO A;  1N9N A;  1T19 A;  1LSW A;  1TS0 A;  2VLG A;  4XT2 B;  1V9Z A;  3F1N B;  1P97 A;  4EXO A;  1F98 A;  3LIA A;  4MN5 A;  2QJ5 A;  4R3A A;  5TBM B;  2KX6 A;  4F3L B;  3LI8 A;  3K3C A;  1LL8 A;  1DRM A;  5HDD A;  5HDS A;  5HWV A;  3LIE A;  3F1O B;  4L9E A;  4WL9 A;  2VV7 A;  3VE3 A;  3UB8 A;  3MFX A;  4KUO A;  4NXE A;  1GSW A;  2A24 A;  2PYP A;  1XJ3 A;  3UME A;  1UWP X;  2WKR A;  4I38 A;  3EEH A;  4PKY G;  1NWZ A;  2WKP A;  4GHI A;  1T1A A;  1S66 L;  4GCZ A;  3G6O A;  4NXG A;  2VV8 A;  1TS7 A;  3NJA A; 
#chains in the Genus database with same CATH topology
 3UB9 A;  4KZ7 A;  1P9R A;  2MJ6 A;  3W2Z A;  3N7W A;  3HUO A;  3P09 A;  4D2O A;  4OQ0 A;  1BYW A;  1LL9 A;  2J8Y A;  3H82 A;  5KIZ A;  3BYD A;  4DE0 A;  2ZC6 B;  3GR2 A;  1BSG A;  1VEU A;  3IF6 A;  3QP6 A;  3UB5 P;  2UV0 E;  5FSR A;  1MWT A;  4HNB A;  4HP9 A;  4L9G A;  1DJC A;  4UEY A;  4OLG A;  2J3T C;  4KG6 A;  4XXR A;  4BD1 A;  4Z9Q A;  5CER A;  1SKO A;  5CGW A;  3A3I A;  3HLC A;  4PM8 A;  1XFN A;  4GD6 A;  2XEP A;  1K6R A;  1BTL A;  2XSS A;  5CGS A;  2JKR I;  4WF0 A;  2XRO A;  3PAE A;  2HP6 A;  1PZO A;  5DF9 A;  3V50 A;  4WEK A;  5FDH A;  1K57 C;  4OLD A;  1IEM A;  4YOF A;  3A3F A;  2B02 A;  3QP2 A;  2E8J A;  1NYM A;  2WZZ A;  4G3W A;  3T1S A;  3KSI A;  3BFC A;  2UWX A;  2K31 A;  3T4K A;  2Y91 A;  2JKG A;  3CWF A;  1TD5 A;  4MN6 A;  1ERM A;  2V1A A;  2J9O A;  1ONH A;  3G32 A;  3N8S A;  3G34 A;  2Y59 A;  1NRJ A;  5FAT A;  4NXB A;  4EES A;  5IT5 A;  5M1A A;  5EVI A;  1JWZ A;  1MZU A;  4BBT A;  1RGY A;  2D01 A;  1MBL A;  2B5R A;  1LSV A;  3GTC A;  3VSL A;  1YLY A;  4X68 A;  2JN7 A;  1PI5 A;  5FQQ A;  4Z1W A;  5GLC A;  3UE0 A;  5GLD A;  1OTD A;  5GL9 A;  1S6R A;  2PR5 A;  1FQG A;  3E4O A;  4EER A;  4O0P A;  3VP0 A;  3CHW P;  3Q7V B;  1D06 A;  2H28 A;  2K2N A;  5FQM A;  2YKH A;  5IU1 A;  1IKG A;  3OCN A;  2P9V A;  3WRT A;  3H7W B;  2VA0 A;  3MKF A;  4K91 A;  3CZD A;  4H6J B;  4MN7 A;  1ONG A;  3ZCZ A;  2ZD8 A;  4E3L A;  1XP4 A;  4ZDX A;  3OPR A;  3F1P B;  4K08 A;  3WRZ A;  3W4Q A;  4ARZ B;  2HDU A;  4GJ4 A;  3DW0 A;  1U60 A;  3HCY A;  3T4S A;  3OLO A;  3PBS A;  5GLA A;  4MBH A;  1PWD A;  2W1R A;  4R6L A;  5A90 A;  2YKF A;  4QPR A;  4XUX A;  5DTT A;  3ZVT A;  1ERQ A;  5DF8 A;  4MMN A;  4HIA A;  3QP1 A;  2OWH A;  2A49 A;  1H8Y A;  4G3V A;  3S7N A;  1XKZ A;  1PWG A;  5HW3 A;  3KSF A;  2GJ3 A;  4BL2 A;  4WM9 A;  4P6Z M;  4LRZ E;  3CI6 A;  5HAR A;  2IWC A;  1JVJ A;  1VB6 A;  4QD4 A;  4LV1 A;  4CPK A;  4MBF A;  3C8C A;  3NIA A;  3QP4 A;  4ZBE A;  1EWZ A;  1V9Y A;  1KVL A;  1S1Y A;  3CUE C;  2FFY A;  4GZB A;  1CI9 A;  3IX4 A;  2W3G A;  3IBJ A;  1J9M A;  1ODV A;  4O8G A;  5TJJ A;  5FQJ A;  3Q7V A;  4QHC A;  4HES A;  1IYO A;  1YQS A;  1YLZ A;  1KGE A;  1O07 A;  4H6J A;  3UDX A;  3T4T A;  1OTB A;  1F5M A;  3IHA A;  3R7W A;  5F68 A;  5A91 A;  5HAP A;  1HD8 A;  4L0L A;  1GA0 A;  5AQA A;  3HL9 A;  5F82 A;  1GSV A;  3U4L P;  4DMZ A;  2EA9 A;  2NUP C;  1YLP A;  2WZX A;  3UY6 A;  4PM5 A;  2JKF A;  1FR1 A;  5CHU A;  3A0S A;  1FOF A;  2ZOI A;  3DAV A;  1N4O A;  2EX8 A;  5HAI A;  3UPN A;  4C3Q A;  3ICY A;  3IF5 A;  1MXO A;  5DKL A;  2Y2G A;  4HBT A;  5CED A;  3E4Q A;  4O7D A;  5AQ9 A;  2V0W A;  1S1Z A;  5DJU A;  3VOY A;  2HDR A;  2Y2I A;  2WKQ A;  4LGW A;  1E25 A;  1NLZ A;  2CC1 A;  4HI4 A;  2DMW A;  3C38 A;  2OLV A;  5CGX A;  2QKP A;  1LT0 A;  3A3D A;  2ZM2 A;  2JKR M;  4WEL A;  4UA6 A;  3MBZ A;  4EU0 A;  4FH4 A;  2G2W A;  1KOU A;  3HLF A;  3N4I A;  1OME A;  4MBK A;  3SS3 A;  4HY8 A;  4OQH A;  1I2W A;  4F3L A;  1PW1 A;  3BEC A;  4DJ3 A;  2EX9 A;  4DKI A;  1Y54 A;  3BQ8 A;  5E2H A;  3MR0 A;  3K2N A;  3C7U A;  2VGK A;  3CPT A;  5BOH A;  5EV0 A;  5GHZ A;  4RA7 A;  3HLE A;  2ZBB A;  4WMC D;  1JWP A;  2ZMA A;  1KGF A;  4MLL A;  2J9P A;  3CMZ A;  2WKH A;  2XDM A;  4OVD A;  1TS0 A;  2VLG A;  4XT2 B;  1V9Z A;  4OON A;  4EXO A;  2PRF A;  1F98 A;  4FOF A;  1FCM A;  5FI7 A;  3AGD A;  1G6A A;  2Z2L B;  5HDD A;  4UQI M;  5DF7 A;  3UPP A;  2O9A A;  5EVL A;  4EBP A;  4CLC B;  5HX9 A;  4Y17 A;  2XK1 A;  3TJZ C;  1PNE A;  4GNU A;  1KDS A;  5L07 A;  1ES5 A;  2WGW A;  3M2K A;  3MZD A;  1K55 C;  4Y0T A;  3Q81 A;  2Y2J A;  1YM1 A;  1E4D A;  2A24 A;  1XJ3 A;  4QY6 A;  2QZ6 A;  4I38 A;  4E3K A;  3EEH A;  3OZH A;  4PKY G;  1MWR A;  2P04 A;  5CTN A;  1IYP A;  1LLB A;  1Z09 A;  3S4X A;  1T1A A;  4NXG A;  3BJN A;  4B4X A;  1KGG A;  4EUV A;  4JXG A;  5HL6 A;  3DWZ A;  3OBF A;  2H5S A;  4UAA A;  2DNS A;  5DTS A;  4HP4 A;  3V5M A;  2WAD A;  4RX2 A;  3MQ0 A;  1MWU A;  1CJF A;  4YNR A;  4XT2 A;  3WS2 A;  4WN5 A;  5GLB A;  1KE3 A;  4WYY A;  3RFB A;  3G30 A;  3G35 A;  1W63 Q;  4YIN A;  4GHI B;  3VP3 A;  2OAQ 1;  3NOU C;  2Y2M A;  4GDB A;  4EQ1 A;  4WBG A;  4FUW A;  5CHM A;  4Y0O A;  2M7V A;  4KQQ A;  1GSX A;  4DN0 A;  1L0E A;  1AWI A;  1PWC A;  2EXB A;  3NEC A;  3UN7 A;  3BEB A;  3P7N A;  3IWQ A;  1PFL A;  5DKK A;  4IHQ A;  1K6S A;  3IT9 A;  3IQA A;  5FI6 A;  1XX2 A;  2XLN A;  3H82 B;  4B88 A;  2PD8 A;  3RJU A;  1SDE A;  4LFU A;  4NEE D;  1DJA A;  1VEU B;  3IF6 B;  1OTE A;  4GB7 A;  5GHX A;  2IA2 A;  3JVU A;  4GS9 A;  1ES2 A;  4S2N A;  4XUZ A;  4MDZ A;  3HVF A;  1Z6F A;  2VJW A;  3ULF A;  1CK3 A;  4I5S A;  3RH8 B;  1XGJ A;  1SKO B;  1TS8 A;  3NOP C;  5EOE A;  3FPW A;  2CMN A;  3A3E A;  1OT9 A;  4N1X A;  3C30 A;  4LLO B;  4M3K A;  4PAU A;  2V20 A;  5G4Z A;  2A3U A;  3N8L A;  1Y28 A;  2W1T A;  5FA7 A;  3LEZ A;  5J8X A;  5EEC A;  4DE1 A;  1SKF A;  1MKI A;  2FZ0 A;  5CX7 A;  2OWJ A;  2H0Y A;  3UB7 A;  3LY4 A;  2A2L A;  2HGV A;  5DTK A;  3UDI A;  4JBF A;  4RYE A;  3HLW A;  3DTE A;  5A8B A;  3KX0 X;  1RGZ A;  3EOI A;  4H8R A;  2L1M A;  5EFW A;  5FI2 A;  2W3D A;  4BMW A;  2JE5 A;  4DE3 A;  3IHB A;  5FQ9 A;  1WA9 A;  5EVI B;  1YLT A;  4DE2 A;  1SDN A;  3BY8 A;  3GSG A;  2X01 A;  4R4R A;  3EWK A;  4P0M A;  2V1Z A;  4P6B A;  4PMA A;  4OOY A;  4QWO A;  1T1C A;  4E3O A;  3VSK A;  4M4X A;  3NHQ A;  5F1F A;  1WE4 A;  3LGO A;  3ISG A;  3MQQ A;  1KE4 A;  3LI9 A;  3PBN A;  3DTI A;  2ZC4 B;  4Y15 A;  4FD8 A;  4KQR A;  4NET A;  3PBQ A;  4NK3 A;  4WUJ A;  1W8Q A;  2D02 A;  1F9I A;  2P9V B;  2Y8H A;  3T12 B;  3O3V A;  4UHU A;  3LR0 A;  1VHM A;  1Q2Q A;  4II7 A;  4ZJ3 A;  1BZA A;  3IS2 A;  3IX8 A;  3B33 A;  1PW8 A;  1VQQ A;  1K55 A;  2XA7 S;  4OPZ A;  5TR7 A;  4PKY A;  2XF3 A;  3NY4 A;  4C75 A;  1K4F A;  2V2F F;  4JLF A;  4EUZ A;  1XJ6 A;  3SS4 A;  4HEF A;  4JGQ A;  4Q0H A;  4EWF A;  3EQV A;  4U0T A;  3LIB A;  3O5Y A;  3TSG A;  4S2O A;  3IH8 A;  3PBO A;  5C5K A;  1XGI A;  3M2J A;  3KSH A;  2WKI A;  3ZVW A;  3WWX A;  1ZKJ A;  3LR5 A;  5DFY A;  3TRC A;  1MKM A;  3V39 A;  5E2G A;  4R1G A;  3CAX A;  4BL3 A;  3NCK A;  4R0Q A;  1W8Y A;  2VGJ A;  3UE3 A;  4WLA A;  1XA7 A;  5F5Y A;  3HRE A;  3P98 A;  4LRY C;  1QMF A;  2HJE A;  2OV5 A;  1TF1 A;  3OPL A;  4ZTK A;  5JYO A;  1DP6 A;  4CLC E;  2H0T A;  3DTK A;  4R3B A;  4ZJ1 A;  1F2K A;  1BLC A;  3FKV A;  4BBV A;  4ZRR A;  4Q8I A;  3IXG A;  1CEG A;  1Y4O A;  3VMA A;  3R7W B;  2INW A;  5HDC A;  4WZ5 A;  1YLW A;  2H10 A;  3ZG0 A;  3MMH A;  3Q7Z A;  4OOL A;  4MCW A;  3OC2 A;  3BFG A;  5HD5 A;  2ZM8 A;  1JTD A;  1NRF A;  5D3O A;  3AGE A;  3T4L A;  1GA9 A;  5A93 A;  5TGF A;  3CLO A;  5FAQ A;  3PTE A;  5AQB A;  5E2E A;  1O7E A;  4P85 A;  4GD8 A;  2BAS A;  2GZA A;  3CJM A;  4I3J A;  5TBM A;  1N9O A;  3SZT A;  5EPH A;  2V9A A;  3C7V A;  3MSH A;  3A0V A;  3RTY A;  3F1O A;  2OOL A;  4HJ3 A;  4CLC D;  3DTM A;  3MZF A;  3FKW A;  4ZJ2 A;  2WYX A;  5CTM A;  4X53 A;  1FR6 A;  1BLS A;  2WUQ A;  4X1M A;  1ALQ A;  3C4O A;  3BLS A;  1LI0 A;  4ME4 A;  3GVB A;  4R3A A;  1ZG4 A;  2KX6 A;  2WK0 A;  3L9K A;  4F3L B;  3SH8 A;  3T4Q A;  4OKP A;  4Y0U A;  1LL8 A;  5M18 A;  2G7U A;  1IKI A;  2GNX A;  2ZMV A;  3LO7 A;  4KZ5 A;  1GCE A;  2R9X A;  2Y2O A;  3QHY A;  3VP1 A;  3CPT B;  2RCX A;  2QYB A;  4E3I A;  5CEB A;  4L9E A;  4JPM A;  4WL9 A;  3UB8 A;  5F1G A;  3MFX A;  4IVK A;  4KUO A;  3D4F A;  3T1R A;  1VM1 A;  1ZHH B;  4CLC C;  3B42 A;  4MEZ A;  1MWS A;  2KOI A;  5FQI A;  2HPB A;  4A5R A;  1JTG A;  1K54 C;  3UME A;  1MPL A;  3QNB A;  3JVV A;  2PT7 A;  4S2I A;  3SS5 A;  3ZGA B;  2LB9 A;  5HPI A;  4ZAM A;  2HJ9 C;  1GHM A;  3E2K A;  1ERO A;  1S66 L;  2ZL1 A;  4GCZ A;  1TEM A;  3HUN A;  2ACG A;  1TS7 A;  3NJA A;  1YSP A;  4BD0 A;  1GHI A;  1AXB A;  4HQA A;  5AVF A;  2FFF B;  1IFQ A;  3MXR A;  1FCN A;  1K57 A;  2HP9 A;  3U2A A;  3H9W A;  1J3W A;  5DVA A;  3M6H A;  2ZQA A;  4F94 A;  3G4P A;  3R4K A;  5F6A A;  1W63 M;  5HWT A;  2WGW B;  4B9O A;  3LY3 A;  2A24 B;  2P08 A;  5DJT A;  2PAV P;  4MNR A;  5FAP A;  2OSU A;  1FIL A;  1TDL A;  4QY5 A;  2XFT A;  3SH7 A;  5HSQ A;  3IWI A;  4S2P A;  5FEF A;  2PU4 A;  2PDR A;  3RXW A;  3D9Y A;  4PM6 A;  3ITB A;  4EEU A;  1BT5 A;  3LCE A;  1N9B A;  4FTX A;  4O01 A;  3SW1 A;  4NG2 A;  3NBL A;  1DJB A;  1BLP A;  3IX3 A;  1W7F A;  1HTZ A;  2V8C A;  2V0U A;  2QHK A;  3V3S A;  2XFS A;  4JF6 A;  4YFM A;  1L0D A;  2VV6 A;  3VOL A;  4HHD A;  4E3M A;  2RL3 A;  3GDI A;  1BUE A;  3LIF A;  1TS6 A;  5CEC A;  4X69 A;  4GW9 A;  3UE1 A;  3MF0 A;  2O99 A;  2R78 A;  2O0Y A;  1HLU P;  2C5W B;  2ZQ8 A;  5E2F A;  4OH0 A;  5EVE A;  4HOI A;  2HP5 A;  4PM7 A;  2B18 A;  4JXS A;  5HZH A;  1SCW A;  2ZM0 A;  3ZFZ A;  2W3H A;  2L4R A;  3IBR A;  4GS9 B;  2XD5 A;  2EX6 A;  3S22 A;  3N8R A;  1NY0 A;  1L0F A;  4HJ4 A;  2PR6 A;  2EFU A;  3VOZ A;  1LL5 A;  3T50 A;  1P0Z A;  5L2F A;  5EUA A;  5I5L A;  4IUH A;  4S2K A;  3T1X A;  5J3W A;  4RX3 A;  1HZO A;  4JF4 A;  1S4S A;  2W1T B;  4EQI A;  4BQM A;  2IWD A;  1IYQ A;  3D3O A;  3EGX C;  1H0M A;  4PM9 A;  3B3X A;  1ESI A;  2ZC3 B;  3CUE A;  4LCM A;  3ZHH A;  3T4O A;  2VGL S;  3JYI A;  4N9K A;  4GDN A;  2BG1 A;  4I3I A;  5L10 A;  1X0O A;  3FG8 A;  1K56 D;  4NXF A;  2WGI A;  1HVB A;  3EEA A;  1XXM A;  3LR3 A;  1Q2P A;  3QP5 A;  3Q82 A;  3K3D A;  5M19 A;  2HDS A;  5LBR A;  1K0K A;  2XA7 M;  3KO6 A;  2EWV A;  3ZG5 A;  1VET A;  1YAX A;  3E2L A;  5L09 A;  3HBR A;  3IWO A;  3ITA A;  2R9W A;  4UA7 A;  4D60 A;  2PBD P;  2Y2Q A;  1IYS A;  2VKS A;  5DFX A;  1ZTU A;  1H5X A;  3NI9 A;  2Y2N A;  5K5B A;  1YMX A;  5HAQ A;  4X6T A;  5I94 A;  1MC0 A;  1I5Q A;  3FV7 A;  2VEA A;  4FSF A;  4JXV A;  3LFV A;  4K0W A;  3O86 A;  1DP8 A;  1UWN X;  3C5A A;  3HLG A;  3LUQ A;  1KDW A;  2EX2 A;  2V8F A;  4DRT A;  1P9W A;  2M1C A;  2W0N A;  4IBR A;  5J4E A;  3LEQ A;  5FQK A;  3IS2 B;  3G2Z A;  3MS6 A;  1G68 A;  3W8K A;  5TFQ A;  4EBL A;  1G5U A;  2JC7 A;  4E04 A;  2J7V A;  3FPV A;  3Q07 A;  3A0R A;  3IXD A;  4Y5F A;  2ZLY A;  2I9V A;  4LEN A;  3C4P A;  3UPO A;  4GKU A;  1S67 L;  2PD7 A;  4IJG A;  1KVM A;  2WKE A;  3S7P A;  1LI9 A;  2HZ5 A;  3LYX A;  2J3W A;  3KSG A;  5EM1 A;  4Q0I A;  1XA1 A;  2Y2H A;  2C6W B;  2HF6 A;  2QMI A;  3PBT A;  5KSC A;  4GN2 A;  4QU3 A;  2Q9N A;  3ZNT A;  4JGR A;  3SOI A;  3S7O A;  1K4E A;  4OQG A;  5KZH A;  3BW6 A;  4BJP A;  3C2W A;  4EV4 A;  3VV4 A;  1H8M A;  3JPU A;  2P7J A;  3F1N A;  4PHT A;  4OP5 A;  1NJ4 A;  5FAS A;  4LV0 A;  2XH9 A;  2Y2P A;  3PAG A;  3HJK A;  4LV2 A;  3TE8 A;  1T1B A;  4KUK A;  3BWL A;  4EW7 A;  4EET B;  4WMC A;  4KZA A;  3VP2 A;  3ZG7 B;  3KYQ A;  4DJ2 A;  5G18 A;  4LPZ A;  4KZ4 A;  2JCH A;  2P74 A;  3NOT C;  3IXH A;  2ZMF A;  3HLB A;  2O9C A;  3HLD A;  4JGO A;  4G3K A;  1ES4 A;  5EE8 A;  4FCF A;  2XD1 A;  2ZQD A;  3ZDJ A;  1T19 A;  2ZQ9 A;  3BFF A;  5FEG A;  1IOU A;  1L2S A;  1P97 A;  5AQ7 A;  1QME A;  5TBM B;  3ZYT A;  2E8I A;  3FWL A;  2EWW A;  1PI4 A;  3K3C A;  1DRM A;  4X1L A;  2AVX A;  4OPY A;  1TDG A;  4E6X A;  1IEL A;  5HDS A;  5A92 A;  1NZU A;  1RCJ A;  3LIE A;  3F1O B;  2DRW A;  3GMW A;  3TOI A;  4OQI A;  3VE3 A;  4R3J A;  1CQA A;  1GSW A;  3DBA A;  1NYY A;  3BFE A;  4LV3 A;  3T1Q B;  5EOO A;  1RP5 A;  3W4P A;  3QP8 A;  2PBY A;  2W3E A;  4Y13 A;  3PR6 A;  2WKP A;  3G6O A;  1WYB A;  2ZQC A;  3FC7 A;  4R70 A;  3VE4 A;  4K0X A;  2Y2K A;  4E3N A;  2W3F A;  1LSX A;  2GDN A;  3ZNY A;  3PHY A;  1OTA A;  3MFD A;  3VFH A;  1BLH A;  5HL1 A;  1TVF A;  3E0Y A;  1OJG A;  3KYZ A;  3EQU A;  1SZV A;  4Y7P A;  4GLQ A;  1S4R A;  1K56 A;  4P87 A;  5IHV A;  2PHY A;  1ESU A;  5GHY A;  1FSW A;  2PU2 A;  1PYY A;  4KG5 A;  2WAE A;  2ZL1 B;  5KMW A;  4HH2 A;  4OPR A;  3BM6 A;  2GX5 A;  3DWK A;  3OPP A;  3V3R A;  5EM0 A;  4AFI A;  2I72 A;  4N1H A;  1FSY A;  2JKT I;  4BEN A;  3BLM A;  1W79 A;  3Q1F A;  4E6W A;  4YWZ A;  1CEF A;  1JWV A;  3O87 A;  3BY9 A;  2NUT C;  1UGU A;  5JYP A;  1BUL A;  3V67 A;  4HBU A;  3FZC A;  4LCL A;  1E3U D;  3L7H A;  1FIK A;  4L9F A;  1OTI A;  4FH2 A;  2XGN A;  2Z2M B;  2HDQ A;  3PXP A;  4Y3I A;  5E43 A;  1K25 A;  1M6K A;  1G28 A;  3ZQ5 A;  4S2J A;  2HV1 A;  3HUM A;  3BRM A;  3S7Q A;  4KQO A;  3MZE A;  5IS1 A;  3H7W A;  3BFD A;  3HJI A;  1OPX A;  3F1P A;  4IUK A;  1G6O A;  5AJG A;  4ARZ A;  4X55 A;  4KQD A;  5FAO A;  4IVI A;  3UE6 A;  2G2U A;  1YKD A;  4S2L A;  2KDK A;  4DXB A;  4EBN A;  1C3B A;  3OPH A;  1PIO A;  3MQO A;  1KE0 A;  1D7E A;  3WS4 A;  1A0K A;  1T18 A;  4S2N C;  2ZOH A;  5CHJ A;  4RQ9 A;  3G2Y A;  3MJQ A;  3E4P A;  4KG2 A;  2VGL M;  4KZ9 A;  5HWW A;  2WAF A;  4E3J A;  1EW0 A;  4OOM A;  2XR0 A;  2KLI A;  3IXB A;  4GOG A;  4I3A A;  3M6B A;  4DDY A;  3TW8 A;  2QWS A;  2ZQ7 A;  2LB5 A;  4PPR A;  1NXY A;  2Z6C A;  5MC7 A;  1XPB A;  3UMD A;  2PYR A;  4EEP A;  3MKE A;  2B95 A;  1XFQ A;  3S1Y A;  2VX8 A;  4JKT A;  4N92 A;  5AVE A;  5KSH A;  1H3Q A;  3N6I A;  5J7E A;  2BTF P;  4Y2F A;  4QJG A;  3UB6 A;  4R23 A;  1YPR A;  3P01 A;  1XJ2 A;  2X71 A;  3G31 A;  4DF6 A;  1N9L A;  3WS1 A;  1YLJ A;  2WGV A;  1L0G A;  3I7J A;  3RXX A;  3LIC A;  3CIT A;  4U0X A;  4R38 A;  1STZ A;  3GV9 A;  2EXA A;  2J80 A;  4CJN A;  1PRQ A;  4DDS A;  2Q0O A;  3VP4 A;  4P6Z S;  1M40 A;  3IF6 C;  3IH9 A;  1PZP A;  2ZC5 B;  1XJ4 A;  4C6Y A;  5CRF A;  5CXW A;  3OCL A;  3OOV A;  1ZC2 A;  3MXQ A;  1VET B;  2QJ7 A;  4ESP A;  2Y55 A;  1NLY A;  3NC8 A;  3UDF A;  1JNU A;  1OT6 A;  5G4Y A;  5EVI D;  5HD3 A;  3ZG8 B;  3VFF A;  2Y4A A;  4U3T A;  2OLU A;  1YMS A;  3ZG9 B;  1D1J A;  4KZ3 A;  1NZO A;  2QPN A;  1YSQ A;  4LRX C;  1CF0 A;  4X25 A;  2L0W A;  2M7U A;  1K38 A;  3PYP A;  4IED A;  4HJ6 A;  4I39 A;  1CI8 A;  1FCO A;  3D72 A;  2XQZ A;  4JXW A;  3WS0 A;  2OAP 1;  1H8Z A;  3LID A;  2Z6D A;  3GRJ A;  5F69 A;  1DP9 A;  1ES3 A;  2K7S A;  3GEC A;  5FL3 A;  3QNC A;  4WZ4 A;  4BLM A;  4S2M A;  2VZW A;  1L3L A;  3CG5 A;  4KZB A;  4JF5 A;  4ETX A;  3LR4 A;  2ZC7 A;  1WYC A;  2IWB A;  5EVI C;  2Y79 A;  3NDG A;  3WS5 A;  4N9L A;  1ZG6 A;  1OJ5 A;  1I2S A;  2VK3 A;  4KZ8 A;  2JKT M;  1SHV A;  1ACF A;  4R4S A;  2V1B A;  2XRN A;  3BQA A;  3FYZ A;  2ZJ9 A;  4HH3 A;  2X02 A;  4BBU A;  4JGP A;  2FH5 A;  2JBF A;  1W5D A;  4B4Z A;  3A3J A;  5HFO A;  2Y2L A;  1DY6 A;  1S0W A;  3UO9 A;  3O88 A;  4Q0J A;  4CLC A;  2JHE A;  4ETZ A;  5HPF A;  1LHY A;  4KZ6 A;  1K54 A;  2W27 A;  3W4O A;  4RVA A;  3NDE A;  4UA9 A;  3NUL A;  4WZ5 C;  3MXS A;  4CQH A;  1N9N A;  2EFX A;  4BWI A;  5FDS A;  2BLS A;  2O9B A;  1LSW A;  3AGF A;  3F1N B;  1E3U A;  4IBX A;  3EGD C;  3LIA A;  4MN5 A;  2QJ5 A;  3UNW A;  4OP8 A;  4WEJ A;  4OPQ A;  3LI8 A;  1MY8 A;  5U47 A;  3SH9 A;  3T4J A;  5HWV A;  4QB8 A;  4NKP A;  3GQZ A;  2VV7 A;  3B47 A;  2DCF A;  4NXE A;  4B93 A;  4UQI S;  1YT4 A;  3E98 A;  2PYP A;  4ID4 A;  3PBR A;  2Q9M A;  1UWP X;  1GHP A;  2WKR A;  2J3T D;  5L8M A;  4DXC A;  1NWZ A;  5F83 A;  4X56 A;  3KYE A;  4KEN B;  4GHI A;  1EI5 A;  2VV8 A;  3TG9 A; 
#chains in the Genus database with same CATH homology
 3UB9 A;  4HQA A;  4EUV A;  3FC7 A;  4R70 A;  5AVF A;  5HL6 A;  1P9R A;  1IFQ A;  2MJ6 A;  3VE4 A;  3W2Z A;  3U2A A;  3OBF A;  3H9W A;  2W3F A;  1LSX A;  3R4K A;  4HP4 A;  1BYW A;  1W63 M;  3H82 A;  3PHY A;  5F6A A;  5KIZ A;  1OTA A;  5HWT A;  4B9O A;  3E0Y A;  3MQ0 A;  2A24 B;  2P08 A;  5DJT A;  1OJG A;  3KYZ A;  4YNR A;  4XT2 A;  4WN5 A;  3EQU A;  4HNB A;  4HP9 A;  4L9G A;  4GLQ A;  1S4R A;  4UEY A;  2PHY A;  3RFB A;  1W63 Q;  2J3T C;  4GHI B;  2OAQ 1;  3NOU C;  4HH2 A;  5HSQ A;  2GX5 A;  4EQ1 A;  2M7V A;  2PDR A;  1GSX A;  4AFI A;  4DN0 A;  3P7N A;  1XFN A;  5DKK A;  4EEU A;  4IHQ A;  2XSS A;  2JKT I;  4O01 A;  2JKR I;  3H82 B;  4WF0 A;  2XRO A;  2PD8 A;  5DF9 A;  3SW1 A;  4WEK A;  4YWZ A;  4NEE D;  4YOF A;  2V0U A;  2QHK A;  3BY9 A;  2B02 A;  2NUT C;  1OTE A;  2IA2 A;  2VV6 A;  1UGU A;  3JVU A;  4G3W A;  3VOL A;  4GS9 A;  3KSI A;  4HHD A;  2K31 A;  4MDZ A;  3T4K A;  2VJW A;  3ULF A;  3GDI A;  3V67 A;  3CWF A;  3LIF A;  4I5S A;  1TS6 A;  3RH8 B;  1TD5 A;  4MN6 A;  1TS8 A;  4L9F A;  1OTI A;  3NOP C;  4GW9 A;  3MF0 A;  2O99 A;  2R78 A;  2V1A A;  3FPW A;  2CMN A;  2O0Y A;  3PXP A;  4Y3I A;  1OT9 A;  3C30 A;  4LLO B;  4PAU A;  5G4Z A;  1G28 A;  3ZQ5 A;  1NRJ A;  1Y28 A;  2HV1 A;  4HOI A;  3S7Q A;  4NXB A;  4KQO A;  2W1T A;  4EES A;  5IT5 A;  5IS1 A;  3H7W A;  2B18 A;  1MZU A;  5HZH A;  4BBT A;  2D01 A;  3HJI A;  1OPX A;  2FZ0 A;  5CX7 A;  3F1P A;  2OWJ A;  1LSV A;  2W3H A;  2L4R A;  3IBR A;  4IUK A;  1G6O A;  4GS9 B;  5AJG A;  4ARZ A;  3UB7 A;  4KQD A;  2A2L A;  2HGV A;  2JN7 A;  4Z1W A;  3UE6 A;  1YKD A;  2KDK A;  4HJ4 A;  1OTD A;  2PR6 A;  3MQO A;  5A8B A;  1D7E A;  3KX0 X;  2PR5 A;  1P0Z A;  3T50 A;  1T18 A;  3EOI A;  2ZOH A;  4RQ9 A;  3E4O A;  5I5L A;  3MJQ A;  2L1M A;  4EER A;  4O0P A;  5EFW A;  3E4P A;  4IUH A;  1D06 A;  2VGL M;  2W3D A;  4BMW A;  2H28 A;  5HWW A;  2K2N A;  2YKH A;  5J3W A;  1EW0 A;  4OOM A;  5IU1 A;  1S4S A;  2KLI A;  2W1T B;  3OCN A;  1WA9 A;  3H7W B;  2VA0 A;  3D3O A;  4I3A A;  3EGX C;  3BY8 A;  3EWK A;  4H6J B;  4MN7 A;  3TW8 A;  2QWS A;  3CUE A;  3F1P B;  4K08 A;  3T4O A;  1T1C A;  2LB5 A;  2VGL S;  2Z6C A;  4M4X A;  4ARZ B;  3NHQ A;  5MC7 A;  4GJ4 A;  3UMD A;  2PYR A;  4EEP A;  4I3I A;  3MQQ A;  1X0O A;  3FG8 A;  1XFQ A;  3LI9 A;  3HCY A;  3PBN A;  4NXF A;  2VX8 A;  5AVE A;  3T4S A;  5KSH A;  3OLO A;  3PBS A;  1H3Q A;  3EEA A;  5J7E A;  4Y2F A;  2W1R A;  3LR3 A;  4R6L A;  2YKF A;  3K3D A;  4QPR A;  3UB6 A;  5LBR A;  4MMN A;  4HIA A;  2XA7 M;  2OWH A;  3PBQ A;  3KO6 A;  2EWV A;  4WUJ A;  1YAX A;  3P01 A;  2D02 A;  4G3V A;  1XJ2 A;  3S7N A;  1F9I A;  2Y8H A;  3KSF A;  2GJ3 A;  4P6Z M;  3LR0 A;  1VHM A;  1N9L A;  4LRZ E;  4II7 A;  3CI6 A;  3IS2 A;  3B33 A;  1VB6 A;  3LIC A;  3CIT A;  4R38 A;  1STZ A;  2VKS A;  1ZTU A;  2XA7 S;  5DFX A;  2J80 A;  3C8C A;  4PKY A;  5K5B A;  4P6Z S;  1V9Y A;  1XJ6 A;  1S1Y A;  3CUE C;  4JGQ A;  1MC0 A;  4Q0H A;  1XJ4 A;  3EQV A;  2W3G A;  3IBJ A;  3LIB A;  3O5Y A;  2VEA A;  4FSF A;  1ODV A;  4O8G A;  5TJJ A;  3OCL A;  3LFV A;  3OOV A;  1DP8 A;  1UWN X;  3MXQ A;  3PBO A;  5C5K A;  2QJ7 A;  3LUQ A;  1P9W A;  2M1C A;  3KSH A;  2W0N A;  1NLY A;  3LR5 A;  4H6J A;  5J4E A;  5DFY A;  3T4T A;  1OTB A;  1F5M A;  3TRC A;  1JNU A;  1MKM A;  1OT6 A;  3IS2 B;  3R7W A;  5F68 A;  5G4Y A;  5HD3 A;  3CAX A;  4L0L A;  3UE3 A;  4E04 A;  3FPV A;  1GSV A;  4WLA A;  3A0R A;  1YSQ A;  4LRX C;  4DMZ A;  5F5Y A;  2EA9 A;  2L0W A;  4Y5F A;  2M7U A;  2I9V A;  3PYP A;  4HJ6 A;  2NUP C;  4I39 A;  4LRY C;  2HJE A;  3D72 A;  1TF1 A;  1S67 L;  2PD7 A;  4IJG A;  3A0S A;  3S7P A;  2OAP 1;  2ZOI A;  3LYX A;  2J3W A;  3LID A;  1DP6 A;  2Z6D A;  4CLC E;  3KSG A;  4Q0I A;  3ICY A;  5DKL A;  2HF6 A;  3PBT A;  5F69 A;  4BBV A;  1DP9 A;  2K7S A;  4ZRR A;  3E4Q A;  3GEC A;  5FL3 A;  2V0W A;  1S1Z A;  5DJU A;  2WKQ A;  2VZW A;  3R7W B;  2INW A;  5HDC A;  4ETX A;  3LR4 A;  1NLZ A;  4JGR A;  2Y79 A;  4HI4 A;  3S7O A;  2DMW A;  3C38 A;  1OJ5 A;  2QKP A;  3MMH A;  1LT0 A;  4OOL A;  4MCW A;  3OC2 A;  2JKT M;  5HD5 A;  2JKR M;  3BW6 A;  4BJP A;  3C2W A;  4WEL A;  2V1B A;  2XRN A;  4EU0 A;  3T4L A;  3BQA A;  3VV4 A;  1H8M A;  2P7J A;  4HH3 A;  3CLO A;  3F1N A;  4PHT A;  1KOU A;  4BBU A;  4JGP A;  2FH5 A;  2BAS A;  4HY8 A;  2GZA A;  4I3J A;  5TBM A;  4F3L A;  1N9O A;  3HJK A;  4DJ3 A;  3TE8 A;  1T1B A;  3BQ8 A;  3MR0 A;  4KUK A;  2V9A A;  3BWL A;  3K2N A;  4EET B;  4EW7 A;  4Q0J A;  4CLC A;  3A0V A;  3RTY A;  3F1O A;  3KYQ A;  4DJ2 A;  2OOL A;  4LPZ A;  2JHE A;  4ETZ A;  3NOT C;  5HPF A;  2W27 A;  2ZBB A;  2ZMF A;  4HJ3 A;  4CLC D;  2O9C A;  4JGO A;  4G3K A;  4CQH A;  1N9N A;  4BWI A;  1T19 A;  2O9B A;  1LSW A;  1TS0 A;  2VLG A;  4XT2 B;  1V9Z A;  1IOU A;  3F1N B;  1P97 A;  4EXO A;  1F98 A;  3EGD C;  3LIA A;  4FOF A;  4ME4 A;  4MN5 A;  2QJ5 A;  4R3A A;  5TBM B;  2KX6 A;  3ZYT A;  2EWW A;  4F3L B;  4WEJ A;  3T4Q A;  3LI8 A;  3K3C A;  1LL8 A;  1DRM A;  5HDD A;  4UQI M;  2G7U A;  2GNX A;  2ZMV A;  2O9A A;  3T4J A;  5HDS A;  5HWV A;  4CLC B;  3LIE A;  2QYB A;  3F1O B;  4NKP A;  4L9E A;  4WL9 A;  2VV7 A;  3VE3 A;  3TJZ C;  3B47 A;  3UB8 A;  3MFX A;  4KUO A;  4NXE A;  4B93 A;  1GSW A;  3DBA A;  1ZHH B;  4CLC C;  4UQI S;  3B42 A;  3E98 A;  2A24 A;  2PYP A;  2KOI A;  3PBR A;  1XJ3 A;  3UME A;  3JVV A;  1UWP X;  2WKR A;  4I38 A;  2W3E A;  3EEH A;  2J3T D;  2PT7 A;  5L8M A;  4PKY G;  2P04 A;  2LB9 A;  1NWZ A;  3PR6 A;  5HPI A;  2HJ9 C;  2WKP A;  4GHI A;  1T1A A;  1S66 L;  4GCZ A;  3G6O A;  4NXG A;  2VV8 A;  1TS7 A;  3BJN A;  3NJA A;  1YSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...