2A24A

Haddock structure of hif-2a/arnt pas-b heterodimer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
b'KTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endothelial PAS domain protein 1
publication title Structural basis of ARNT PAS-B dimerization: use of a common beta-sheet interface for hetero- and homodimerization.
pubmed doi rcsb
molecule tags Transcription
total genus 27
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2a24A00
3IS2B 1LSXA 3LYXA 2V1BA 3NOPC 3F1OB 1WA9A 1GSVA 3NHQA 2QHKA 5F5YA 4MN6A 1DP8A 1EW0A 4E04A 4I3JA 4H6JA 4EESA 3K3CA 3UB7A 1BYWA 1N9OA 3RH8B 2INWA 4HNBA 5EFWA 4BBUA 3P7NA 4HH3A 1ODVA 4JGQA 3GECA 3LUQA 1MZUA 3C8CA 2CMNA 3ZQ5A 2M1CA 2H28A 1V9YA 5AVEA 2PYPA 1TS8A 4EQ1A 4HJ3A 4DJ2A 2EA9A 1T1AA 3PYPA 3K3DA 2V0WA 3OLOA 3FC7A 1OTEA 3E4QA 4HH2A 5I5LA 4DJ3A 2KX6A 4GHIA 3IBRA 5HDCA 3HJIA 4WLAA 1LSVA 4EXOA 2ZBBA 1VB6A 3A0RA 2QKPA 1XJ2A 3ICYA 4F3LA 4HP4A 2PD8A 4LLOB 3LIBA 1F9IA 3UB8A 4L9GA 3VE4A 2B02A 4F3LB 5HWTA 4KUKA 4K08A 1D7EA 3H82A 2PR6A 4HP9A 1XFNA 3NJAA 2V1AA 3F1PB 4GW9A 3IS2A 1TS0A 1XJ4A 2J80A 3GDIA 2VV7A 2VV6A 1LL8A 2QWSA 4EW7A 4BBTA 5IU1A 1S4SA 2VEAA 1T18A 1UGUA 4I3AA 5F6AA 3E4PA 1NWZA 3LIAA 1OT6A 2YKHA 1V9ZA 4PKYA 2OOLA 4I39A 1T1CA 2PHYA 3MR0A 5DKLA 3CLOA 5HWWA 5G4ZA 3UE6A 2I9VA 1N9LA 1OTAA 2P7JA 4EEUA 2PD7A 5F68A 3H9WA 4LRZE 1GSWA 1OTDA 2W0NA 5J7EA 3EWKA 2Z6DA 5DKKA 3KX0X 3VOLA 3F1NB 4HY8A 1S4RA 3LIDA 3FG8A 3A0SA 1JNUA 5HSQA 1DRMA 2HV1A 3UMEA 2V0UA 5G4YA 3A0VA 4PKYG 2VV8A 3CWFA 3RTYA 1TS6A 1XFQA 2L0WA 3BY9A 1T1BA 4WF0A 1LSWA 3T50A 1OJ5A 2OWHA 5AVFA 1X0OA 3B33A 3PHYA 4GS9B 5KIZA 3F1PA 2A24A 5TBMB 2WKRA 2OWJA 4I3IA 2PYRA 3MXQA 2ZOIA 1XJ6A 1UWPX 3NOTC 2JHEA 2D02A 2A24B 2QJ5A 5HD3A 2GJ3A 1KOUA 4XT2B 4KUOA 1N9NA 4EERA 1TS7A 5A8BA 4YWZA 3H7WA 4JGOA 1GSXA 5HDSA 3BWLA 1F98A 3LI8A 4RQ9A 3H7WB 4NXGA 3LICA 5F69A 4HOIA 4MN5A 3EEHA 3MFXA 4R38A 3BY8A 3MQQA 4GCZA 4LRXC 2BASA 2WKQA 3LI9A 4EETB 4KQDA 2L1MA 4HIAA 4WN5A 5HDDA 3MJQA 3F1NA 5J3WA 4H6JB 3HJKA 1UWNX 1S66L 2L4RA 2PR5A 2ZOHA 4I38A 5HD5A 4NXEA 3E4OA 3LIEA 3UB6A 4HJ6A 4HJ4A 4HHDA 1OTBA 2WKPA 2W27A 2PDRA 2JN7A 3C2WA 2YKFA 3LIFA 1T19A 3D72A 1XJ3A 4R3AA 5DJTA 1OT9A 3NOUC 3UB9A 4L9EA 5HWVA 4WL9A 4GS9A 1S67L 4EEPA 5TBMA 1LT0A 2K7SA 1P0ZA 4JGPA 1P97A 1OJGA 4GHIB 4B9OA 5DJUA 4JGRA 3UMDA 2R78A 2Z6CA 4NXBA 5HZHA 2V9AA 4XT2A 3MQOA 1D06A 4BBVA 1S1YA 1G28A 4LPZA 4R6LA 5IS1A 2D01A 1DP9A 1Y28A 2QJ7A 1OTIA 3G6OA 4HI4A 4NXFA 4L9FA 4WUJA 4M4XA 5J4EA 2KDKA 2VLGA 4I5SA 1DP6A 3VE3A 1S1ZA 4HQAA 4LRYC 4R70A 3H82B 3SW1A 3CAXA 3ULFA 3F1OA
chains in the Genus database with same CATH superfamily
5D3OA 2J3TD 3TE8A 4QY5A 2V1BA 4ZBEA 2JKTI 3T1QB 1YM1A 1MC0A 2EXBA 3FWLA 1GSVA 3MZFA 2QHKA 2ZQ9A 5F5YA 2KOIA 3KO6A 1MKMA 2DCFA 2ZQAA 1EWZA 1K56A 3NC8A 3WS1A 2H0YA 3OPHA 3PXPA 4S2OA 3TJZC 4N92A 2XFSA 2XQZA 1E3UD 3GTCA 1SKOA 3KSIA 3G32A 2JKFA 3LY4A 3GECA 1LL5A 4ID4A 4B4ZA 4O01A 1MZUA 3B3XA 3HLGA 2O99A 1HTZA 3ZQ5A 1XP4A 4EUVA 1P9RA 5HX9A 5AVEA 1PZOA 4DN0A 1PNEA 3S4XA 1IYOA 4EQ1A 3QHYA 2HDUA 3T4QA 4HJ3A 4DJ2A 2HGVA 5GHZA 4ARZB 3OLOA 4UQIS 3D3OA 4DJ3A 4LCMA 4WLAA 1K55C 1LSVA 3FKWA 3M6HA 4BJPA 1VQQA 2ZBBA 3DTEA 3IH8A 4IVIA 3P98A 5IHVA 2PD8A 2V2FF 2HDRA 4LLOB 4PM9A 3LIBA 1PZPA 3BFFA 1FIKA 3PBTA 4QJGA 5CERA 1KVMA 3C5AA 4K08A 1D7EA 3VP4A 4HP9A 2K31A 1XFNA 4QHCA 4GW9A 2J80A 4B93A 4GKUA 5A90A 3Q07A 3VP3A 2PU2A 1MXOA 3WS2A 3AGEA 1SCWA 4RX3A 4MBFA 4NG2A 3CITA 1IKGA 5EVEA 3VSKA 4KZ3A 4E3OA 1JTDA 3O88A 1GCEA 2OSUA 5F6AA 2YKHA 1V9ZA 5AQAA 2OOLA 3SH7A 1H8MA 3C4PA 2V20A 2VK3A 3UPNA 5G4ZA 4KQOA 3UE6A 2EX8A 2GX5A 3NIAA 3KYEA 4LV0A 3ZVWA 5FAOA 1G6AA 4LRZE 2W0NA 1K57C 1JTGA 1PYYA 3SZTA 5M1AA 4HY8A 2WYXA 4EBLA 3FG8A 3HLCA 3Q82A 1JNUA 4WM9A 3CI6A 1SDEA 4CPKA 5FQIA 1NYMA 3DTMA 3CUEC 1YT4A 3HLFA 1E3UA 1PI5A 2OLVA 3KSGA 3CWFA 2OV5A 4Y0UA 3N8SA 3JVUA 2XK1A 2A3UA 1XFQA 4WMCD 2L0WA 1ONGA 5GHXA 4OONA 1IYSA 2XD5A 5FQ9A 3A3JA 2IA2A 1W8QA 1X0OA 5HPIA 1PRQA 3B42A 3DTKA 3F1PA 2DRWA 3VV4A 4DDYA 2A24A 1CF0A 1IYPA 4I3IA 2W3EA 3MXQA 2ZOIA 1XJ6A 3CZDA 3O5YA 4GB7A 4GOGA 2A24B 2XD1A 4O7DA 2OLUA 2GJ3A 1JWPA 2FFFB 4NKPA 5E43A 3A3FA 2ZC5B 4YWZA 3PBQA 4NK3A 3VFFA 3TW8A 1BLSA 1FR6A 4MN7A 1M6KA 4NXGA 3LICA 3OPPA 1Y4OA 5M19A 3SS3A 2HDQA 4S2PA 3IXHA 4R38A 1KDSA 4X6TA 5HAPA 4HBUA 2UWXA 1YQSA 2WKQA 3N6IA 3KSHA 2L1MA 3MKFA 4WN5A 4WZ4A 3BECA 3W4QA 1YPRA 1FCNA 2Q0OA 1H8ZA 5GLDA 4KZBA 4CLCD 2PR5A 4MEZA 4NXEA 2QMIA 3UB6A 4Z9QA 4HHDA 3E2LA 3DAVA 1FCMA 1MBLA 3GSGA 4OPQA 5DFYA 4UAAA 5KSCA 2EFUA 3CPTB 4GNUA 1SKFA 2JN7A 3C2WA 3WWXA 3G35A 5HFOA 5G18A 2R9XA 5CXWA 5DJTA 2Y2IA 1AXBA 4HBTA 3UPPA 1ACFA 3UB9A 3BFGA 2RCXA 5E2EA 1CK3A 4WL9A 2FFYA 1BULA 3R7WB 2W3DA 5AQBA 5TBMA 4YOFA 2XGNA 4JGPA 4GZBA 4XXRA 3PBOA 1ZG6A 4JF6A 2Q9MA 1KGGA 2LB9A 5DJUA 2W3HA 3GRJA 2Y8HA 2XLNA 2HP9A 5HZHA 4X1MA 4UA6A 4XT2A 2LB5A 4BBVA 2A49A 3G6OA 3LEQA 4HI4A 2J7VA 1S6RA 2H10A 5CGXA 3BM6A 1S1ZA 4WMCA 3HLWA 4R70A 1L3LA 3T4JA 2ZL1A 4G3KA 5CEBA 2BTFP 3ISGA 3IS2B 4OPRA 1LSXA 5FAQA 4JXVA 2ZL1B 2C5WB 3HUMA 3NOPC 2Z2MB 2Y2NA 3DW0A 3E2KA 4RA7A 2WGVA 4ETXA 3UNWA 4OLGA 1MWTA 2WGIA 1DP8A 1EW0A 1SZVA 1STZA 2VGJA 1Z09A 3SH8A 3SOIA 1PW8A 2NUTC 4FH4A 4QD4A 1BYWA 1N9OA 3MBZA 3MZDA 1XGIA 3FV7A 4HNBA 4NEED 4Q0IA 2XH9A 4HH3A 2P04A 4DXBA 2HZ5A 1AWIA 3D9YA 1ODVA 1NRFA 5EPHA 1YKDA 2E8IA 3CHWP 5A93A 1BLPA 3EEAA 1L0GA 1BT5A 2H28A 1V9YA 2PYPA 2ZMVA 3M6BA 5CHUA 1L0DA 4N1XA 4FD8A 2NUPC 4K0WA 4FH2A 3K3DA 4BD0A 5HL1A 4DMZA 4E3LA 2VZWA 1OTEA 4HH2A 5I5LA 2W3FA 5FI6A 3IBRA 4LV2A 3IF6B 2PBYA 3L9KA 4MNRA 2ZD8A 3HJIA 3C4OA 1VHMA 4CLCA 1G6OA 2EXAA 4U0TA 4PAUA 1JVJA 2QKPA 1XJ2A 3IXGA 1YMXA 1PWGA 3ICYA 4F3LA 1IYQA 2GZAA 3W4OA 3UE1A 4CLCB 3VP2A 5DF7A 1CQAA 3UB8A 2O9AA 2CC1A 4L9GA 3GVBA 4YINA 4F3LB 2Y91A 3H82A 2PR6A 3Q7ZA 1XA7A 5EOOA 2A2LA 3EQUA 3N7WA 4JF5A 5FL3A 5E2HA 3P01A 4K0XA 2Y59A 5F1GA 2VV7A 3S7NA 5CECA 2V8FA 1IEMA 3ZFZA 3BQ8A 2ZM2A 2QPNA 4EW7A 3ZHHA 3QP4A 1UGUA 3MZEA 1CEGA 4G3VA 3E4PA 1NWZA 3ZCZA 2EFXA 4PKYA 2H0TA 5CGWA 4UQIM 3E0YA 1T1CA 3ZG5A 3IHAA 5DKLA 3QP8A 1A0KA 4DXCA 3T4KA 3S1YA 4OP8A 3RJUA 4JF4A 2BG1A 1CI9A 3H9WA 2C6WB 1Q2QA 3OCNA 4E6XA 2O9CA 1OTDA 3R4KA 5J7EA 3DWKA 3N4IA 4ARZA 3VOLA 1ZTUA 4KQRA 5HPFA 2B18A 1S4RA 3RFBA 4IEDA 5HSQA 5AQ9A 3BLSA 2P9VA 2HV1A 4OQHA 1LLBA 2EX2A 4Y7PA 3IBJA 4IBRA 4R3BA 4O8GA 1YLTA 2P9VB 4OQ0A 3RTYA 1XKZA 2JC7A 1W79A 5U47A 1ES5A 3ZG7B 4WF0A 1LSWA 4BD1A 3IHBA 2GDNA 1ERMA 4DE1A 2OWHA 3SS5A 3PHYA 4QY6A 1LHYA 4KENB 4C75A 1GHPA 2DMWA 2OWJA 2IWBA 1N9BA 4KG2A 5KZHA 2V8CA 2BLSA 2JHEA 2D02A 1XX2A 4CJNA 1YLZA 3TSGA 3JYIA 2WUQA 1KOUA 1N9NA 4EERA 4Y0OA 3OOVA 3T1XA 1K4FA 4JGOA 4OPYA 2W1RA 3LR0A 4WZ5A 4E3KA 2ZC7A 5FDSA 3LI8A 4RQ9A 3ITAA 2B95A 2V1ZA 3BLMA 4S2LA 3C38A 3I7JA 1KE4A 3IX3A 4GN2A 4HOIA 3MFXA 3ZVTA 2PU4A 3ZG9B 1DJAA 5FQKA 3MQQA 4PHTA 4OQGA 3G30A 4PM7A 4LRXC 3UY6A 4QB8A 2JKRM 4KQDA 2EX6A 4XUZA 2KLIA 2XROA 5FSRA 5J3WA 1CI8A 5FASA 4H6JB 3HJKA 1UWNX 1S66L 4Y15A 5CRFA 2L4RA 4Q0JA 3T12B 2ZOHA 2Y2GA 3M2KA 4D60A 3MXRA 2QZ6A 4HJ6A 1G68A 2J9OA 3NECA 4MBKA 4BWIA 3V3RA 2Y79A 2YKFA 3IX4A 3LIFA 2IWDA 4DRTA 1PWCA 1K54A 4R3AA 1H5XA 3IWIA 3A3EA 4KG6A 5HWVA 3MS6A 1DY6A 3NI9A 2W3GA 3HBRA 3BFCA 2HP5A 1I2SA 4NETA 3UB5P 4S2KA 1P0ZA 2RL3A 4LFUA 4K91A 2W1TB 3GR2A 4EUZA 5EVLA 3VP1A 4O0PA 1K0KA 4GHIB 1EROA 1YLYA 2Y4AA 3G31A 4ZDXA 3UE0A 3ZNYA 5EM0A 1NLZA 2J3WA 4Y13A 1IOUA 2XSSA 4U0XA 3O3VA 3MQOA 1D06A 3T4TA 3AGFA 4P6ZS 2D01A 5A92A 3G4PA 4G3WA 4NXFA 2AVXA 4UEYA 4L9FA 2WGWB 2G2UA 4YNRA 3P09A 1YLWA 3PTEA 3SW1A 4FUWA 1PI4A 1YLJA 3F1OA 3ZG8B 4HEFA 3MMHA 3SH9A 1ES2A 3CG5A 4KZ6A 3F1OB 4E6WA 1WE4A 3CMZA 3OPRA 4E04A 1BSGA 4C3QA 4WEJA 4B4XA 4I3JA 4JPMA 1H3QA 4CLCC 4UHUA 1BZAA 4EESA 1NXYA 5E2GA 1Y54A 4ETZA 3V39A 3K3CA 4OOLA 3ZGAB 1F5MA 5EVIC 4RYEA 1W7FA 4BBUA 1NJ4A 3CPTA 4JXSA 2HDSA 4JGQA 1FOFA 3DWZA 1QMEA 3LUQA 5JYPA 1OMEA 1O7EA 2M1CA 1W63Q 4S2NA 2P74A 2ZC3B 3CJMA 2QYBA 4QPRA 3MQ0A 3R7WA 1XPBA 4Y5FA 2O9BA 3IWQA 5IT5A 2EA9A 1T1AA 3PYPA 3FC7A 1WYCA 5GLAA 3E4QA 2HJEA 4P85A 3IX8A 4MDZA 1FCOA 4S2IA 5HDCA 1O07A 3UDFA 3U4LP 3GQZA 4EXOA 4N9LA 3A0RA 2J8YA 3M2JA 4GDBA 2VJWA 1ES3A 5C5KA 4PM8A 1CEFA 3PAEA 1F9IA 5F1FA 3VE4A 2ZQ7A 5HWTA 4Z1WA 5L09A 3IQAA 4KUKA 4JLFA 2XA7M 5EECA 4JXWA 4Y0TA 2V1AA 3HREA 2ZQCA 1H8YA 3IS2A 3NCKA 4R4SA 1XJ4A 1MWUA 3ZYTA 2Z2LB 3QP1A 2G2WA 1KVLA 1YAXA 3D4FA 2VGLM 3VOZA 2FH5A 3EGXC 2VV6A 2Y55A 1LL8A 4OVDA 1VM1A 2QWSA 4MBHA 5IU1A 4DDSA 2ACGA 5L2FA 3CUEA 5CTMA 5EE8A 2I72A 2VEAA 4LV1A 1T18A 5FATA 3LIAA 2ZM8A 1QMFA 3WRTA 4F94A 1L0FA 3HUNA 1RGYA 2K2NA 2XA7S 3N8RA 3MR0A 1F2KA 2PRFA 3CLOA 3JVVA 4PM5A 1MWRA 1RP5A 5HWWA 4KQQA 3O87A 5FQMA 5A91A 4WBGA 2I9VA 1BLHA 2P7JA 2VGLS 3BQAA 3C7UA 4DE0A 3PBSA 2PD7A 3EQVA 5F68A 1HZOA 2O0YA 1K25A 5E2FA 5HL6A 3OC2A 4AFIA 1XGJA 5TGFA 3EWKA 2R9WA 5DKKA 1P9WA 3KX0X 4PMAA 5L07A 4BQMA 3F1NB 4EBPA 1JWZA 3DTIA 4GD8A 3PBNA 3IF6A 3LIDA 3A0SA 3FZCA 1DRMA 1ZHHB 3T4SA 3UMEA 1D1JA 2JKGA 1KE0A 4S2MA 5FI7A 4WZ5C 1K38A 3MXSA 3A0VA 4PKYG 4EBNA 4IUKA 5HW3A 2IWCA 2Y2LA 3LEZA 1TS6A 4IJGA 4CLCE 1H0MA 2M7VA 1YMSA 3T50A 1OJ5A 3SS4A 4GS9B 4CQHA 5DVAA 3NULA 1FILA 1RCJA 1S0WA 4WYYA 3UE3A 3EGDC 2WKRA 1FR1A 3RXXA 5FAPA 3QNCA 4M3KA 1CJFA 1J9MA 1UWPX 2J3TC 3NOTC 2GNXA 3B47A 2HJ9C 4KZ8A 3BW6A 4IHQA 2VA0A 4DF6A 1NZUA 2VKSA 4LV3A 4QWOA 3QP6A 5TR7A 2XF3A 4KUOA 2HPBA 3PAGA 5HARA 5M18A 1GSXA 4X68A 1PW1A 5HDSA 4OP5A 2XR0A 3BWLA 3TRCA 5KSHA 1TF1A 1F98A 1SDNA 4ME4A 3U2AA 1K54C 3BRMA 4FSFA 5DTTA 1WYBA 5F69A 1ZG4A 3UO9A 3RXWA 4MN5A 5AJGA 4ZTKA 3BY8A 2WKHA 4Y2FA 5CHMA 2VGKA 4DE3A 4EU0A 2BASA 3KSFA 3LI9A 4ZRRA 1MKIA 2WADA 4N1HA 4WEKA 5HDDA 4X56A 5LBRA 4X1LA 5J8XA 4JXGA 4Y3IA 1G5UA 3WS5A 1DJBA 5HAQA 2B5RA 1SHVA 4GDNA 4HJ4A 3ZDJA 3VFHA 1OTBA 2JE5A 2WKPA 5MC7A 1SKOB 1ZC2A 2W27A 1YSQA 3V5MA 5FEFA 5F83A 2UV0E 1ERQA 1T19A 1XJ3A 1OT9A 2FZ0A 3NOUC 4ESPA 3N8LA 4L9EA 3LR3A 4R23A 4KZ5A 1XA1A 1S67L 2G7UA 1DJCA 5FEGA 1ES4A 1LT0A 4E3NA 3MF0A 1GA0A 2HP6A 1MPLA 3E98A 1OJGA 2PAVP 4MMNA 1W63M 4B9OA 1HD8A 1C3BA 5EUAA 4OOMA 2PT7A 2R78A 4GJ4A 4R0QA 3FPWA 2ZLYA 4NXBA 4P87A 3BEBA 3FPVA 4LPZA 1NYYA 4R6LA 2JCHA 1U60A 4BL2A 3Q7VA 1DP9A 1Y28A 2QJ7A 3IXDA 1TDLA 3Q1FA 4WUJA 2ZC4B 5J4EA 2KDKA 3IT9A 3Q7VB 4HQAA 2XRNA 1MWSA 1VETA 4KZAA 1FSWA 4S2NC 1ALQA 2XFTA 4OPZA 3AGDA 3NDEA 3LYXA 1VETB 3KYZA 2WZXA 1PIOA 1TVFA 4JKTA 3Q81A 5KMWA 1WA9A 2OAQ1 3NHQA 3S22A 2J9PA 4KZ7A 4MN6A 2Y2MA 3MSHA 4H6JA 5EV0A 1RGZA 4OQIA 3VSLA 3PR6A 3MKEA 1PWDA 2Y2QA 3UB7A 3RH8B 4EQIA 2INWA 5EFWA 3HVFA 2PBDP 3P7NA 4X69A 1LL9A 1Q2PA 3A3IA 2EWWA 2E8JA 3NDGA 2ZQ8A 3C8CA 2CMNA 4ZJ3A 4P6ZM 4PPRA 1FSYA 4ZJ2A 4Q0HA 3LR5A 3HLEA 4WELA 1TS8A 2WAFA 1ONHA 1J3WA 4FOFA 1GA9A 2V0WA 2W1TA 4E3MA 3LCEA 3IWOA 3HL9A 4GD6A 4A5RA 2Y2KA 2KX6A 4GHIA 4OLDA 2Y2OA 3C30A 3UPOA 3A3DA 2ZMFA 3WS0A 3W8KA 1NLYA 3S7QA 4EWFA 3C7VA 1VB6A 5DF8A 3W2ZA 4KZ4A 2Y2JA 3TOIA 1TD5A 3LO7A 5I94A 1NZOA 4HP4A 3G2YA 2JBFA 5GLCA 3HUOA 2WGWA 2WZZA 3FYZA 2B02A 2EWVA 4EV4A 1KDWA 1ZKJA 3NY4A 3VP0A 3IF5A 3NJAA 3F1PB 1XXMA 5CGSA 3G2ZA 1TS0A 5CTNA 1EI5A 3GDIA 2MJ6A 3UDIA 4MCWA 3OBFA 5CEDA 3IF6C 5DTKA 4R4RA 4BBTA 1E25A 2WKIA 4X53A 2XEPA 2VX8A 5TJJA 2JKTM 1S4SA 5GL9A 4BMWA 1K55A 4OOYA 4Y17A 4I3AA 3VMAA 4MLLA 1BUEA 1OT6A 5FQJA 5K5BA 4RVAA 4I39A 1L0EA 2PHYA 4ZJ1A 4R1GA 3UDXA 1W5DA 5GHYA 2Q9NA 3BFEA 3LGOA 1VEUA 3VOYA 3HCYA 1N9LA 1JWVA 3WS4A 1OTAA 4EEUA 2X02A 4UA7A 2WKEA 1VEUB 3T1SA 3ITBA 3TG9A 1GSWA 3K2NA 3V3SA 2Z6DA 3G34A 1KGFA 3BJNA 3L7HA 4PM6A 5EVID 1MY8A 2Y2PA 3S7OA 4YFMA 3OZHA 2V0UA 1KE3A 5AQ7A 5G4YA 3NBLA 4X25A 4E3IA 5JYOA 3LR4A 2X01A 4E3JA 2VV8A 1NRJA 1L2SA 4R3JA 5FQQA 1K6RA 3BY9A 1T1BA 3GV9A 4FTXA 2WK0A 4OH0A 1M40A 4OKPA 5AVFA 4FCFA 3LY3A 3B33A 4II7A 5KIZA 5CHJA 5EM1A 4QU3A 5TBMB 2PYRA 4GLQA 1E4DA 5CX7A 1I5QA 1FQGA 2HF6A 3O86A 4JBFA 3OCLA 3T4OA 1Z6FA 1K57A 1YLPA 2QJ5A 4KG5A 1K4EA 1YSPA 1W8YA 1OPXA 5HD3A 1K56D 3BYDA 1IKIA 1BTLA 4XT2B 3QP5A 5GLBA 1TS7A 3HLDA 4LENA 5A8BA 3H7WA 5HAIA 3S7PA 4LGWA 3ZNTA 3WRZA 4KZ9A 5DFXA 1BLCA 3H7WB 4IBXA 3KYQA 3V50A 4DE2A 3EEHA 3QNBA 2EX9A 4S2JA 5FI2A 5FA7A 3PBRA 3BFDA 2JKRI 3T1RA 1IFQA 5L8MA 4GCZA 3IXBA 5TFQA 4BENA 4EETB 3W4PA 1LI9A 4IVKA 2ZMAA 4HIAA 1GHIA 4RX2A 3MJQA 3F1NA 4IUHA 2M7UA 2ZM0A 1N4OA 2XDMA 4P6BA 4N9KA 5FDHA 4Q8IA 1HVBA 4DKIA 4UA9A 5BOHA 3MFDA 3JPUA 4I38A 5HD5A 1NY0A 3E4OA 3V67A 5EOEA 3LIEA 2H5SA 4XUXA 1K6SA 1TEMA 3T4LA 2PDRA 2ZJ9A 1LI0A 3D72A 3ZG0A 4U3TA 3DBAA 4H8RA 5DTSA 5L10A 1PFLA 3GMWA 4GS9A 4BL3A 1KGEA 4EEPA 3HLBA 4C6YA 2K7SA 3OPLA 4BLMA 3LFVA 4D2OA 2ZQDA 1P97A 4ZAMA 2ZC6B 1ESUA 2P08A 3QP2A 4JGRA 3UMDA 1GHMA 2Z6CA 4LCLA 2V9AA 2DNSA 5EVIA 1I2WA 3IH9A 4P0MA 4L0LA 1S1YA 1G28A 5IS1A 3EOIA 1HLUP 2WAEA 5DF9A 2Y2HA 1OTIA 3FKVA 5EVIB 1ESIA 1IELA 4M4XA 2OAP1 4HESA 2VLGA 3UN7A 4I5SA 1DP6A 3VE3A 4LRYC 5F82A 4B88A 2X71A 3H82B 3CAXA 1TDGA 3ULFA 4X55A
chains in the Genus database with same CATH topology
3IS2B 2J3TD 1LSXA 3TE8A 3LYXA 3KYZA 2V1BA 3MMHA 2JKTI 3NOPC 3F1OB 1MC0A 1WA9A 2OAQ1 1GSVA 3NHQA 2QHKA 4ETXA 5F5YA 2KOIA 4MN6A 1DP8A 1EW0A 4E04A 3KO6A 4WEJA 4I3JA 4H6JA 1MKMA 1H3QA 1STZA 4CLCC 3PR6A 4EESA 2NUTC 4ETZA 3K3CA 3UB7A 1BYWA 3PXPA 4OOLA 3TJZC 1N9OA 3RH8B 1F5MA 2INWA 4HNBA 5EFWA 4BBUA 4NEED 3KSIA 3P7NA 4Q0IA 4HH3A 2P04A 1ODVA 4JGQA 3GECA 3LUQA 1YKDA 4O01A 2EWWA 1MZUA 3C8CA 2O99A 2CMNA 3EEAA 3ZQ5A 4EUVA 2M1CA 2H28A 1P9RA 4P6ZM 1W63Q 1V9YA 2QYBA 4QPRA 5AVEA 2PYPA 3MQ0A 4Q0HA 4DN0A 3R7WA 3LR5A 2ZMVA 4WELA 1TS8A 4Y5FA 4EQ1A 2O9BA 2NUPC 5IT5A 3T4QA 4FOFA 4HJ3A 4DJ2A 2EA9A 1T1AA 3PYPA 3K3DA 2HGVA 2V0WA 3OLOA 4UQIS 2W1TA 4ARZB 3D3OA 3FC7A 4DMZA 2VZWA 1OTEA 3E4QA 4HH2A 2HJEA 5I5LA 4DJ3A 2W3FA 2KX6A 4GHIA 3IBRA 3C30A 4MDZA 2ZMFA 1NLYA 5HDCA 3HJIA 4WLAA 3S7QA 1LSVA 4EXOA 1VHMA 4BJPA 4CLCA 1G6OA 1VB6A 2ZBBA 3A0RA 3W2ZA 4PAUA 2QKPA 1XJ2A 2VJWA 1TD5A 3ICYA 4F3LA 2GZAA 5C5KA 4HP4A 2PD8A 4CLCB 4LLOB 3LIBA 1F9IA 3UB8A 2O9AA 4L9GA 3PBTA 3VE4A 2B02A 4F3LB 5HWTA 4Z1WA 4KUKA 2EWVA 4K08A 1D7EA 2XA7M 3H82A 2PR6A 4HP9A 2K31A 1XFNA 3NJAA 2V1AA 2A2LA 3EQUA 3F1PB 5FL3A 4GW9A 3IS2A 1TS0A 1XJ4A 3P01A 2J80A 4B93A 3ZYTA 1YAXA 3GDIA 2MJ6A 2VV7A 2VGLM 4MCWA 3S7NA 3OBFA 3BQ8A 2FH5A 3EGXC 2VV6A 1LL8A 2QWSA 4EW7A 4BBTA 5IU1A 2VX8A 5TJJA 3CITA 2JKTM 1S4SA 3CUEA 2VEAA 4BMWA 1T18A 1UGUA 4I3AA 4G3VA 3E4PA 1NWZA 5F6AA 3LIAA 1OT6A 2YKHA 1V9ZA 4PKYA 5K5BA 4UQIM 2OOLA 4I39A 3E0YA 1T1CA 1H8MA 2K2NA 2XA7S 2PHYA 3MR0A 5DKLA 3CLOA 3JVVA 5HWWA 5G4ZA 4KQOA 3UE6A 3T4KA 2I9VA 3HCYA 1N9LA 2GX5A 1OTAA 2P7JA 2VGLS 3BQAA 3PBSA 4EEUA 2PD7A 3EQVA 5F68A 3H9WA 2O0YA 3OCNA 2O9CA 4LRZE 1GSWA 5HL6A 1OTDA 3K2NA 3OC2A 2W0NA 4AFIA 3R4KA 5J7EA 3EWKA 4ARZA 2Z6DA 5DKKA 1P9WA 3KX0X 1ZTUA 3VOLA 3F1NB 5HPFA 2B18A 3PBNA 4HY8A 1S4RA 3LIDA 3FG8A 3RFBA 3A0SA 1JNUA 3BJNA 1DRMA 3CI6A 5HSQA 1ZHHB 3T4SA 2HV1A 3UMEA 3S7OA 2V0UA 5G4YA 3CUEC 3IBJA 3A0VA 3LR4A 4O8GA 4PKYG 2VV8A 3KSGA 1NRJA 3CWFA 4IUKA 3JVUA 3RTYA 1TS6A 1XFQA 2L0WA 4IJGA 3BY9A 4CLCE 1T1BA 4WF0A 1LSWA 2IA2A 2M7VA 3T50A 1OJ5A 2OWHA 5AVFA 1X0OA 5HPIA 3B33A 3PHYA 3B42A 4GS9B 4II7A 3F1PA 4CQHA 5KIZA 3VV4A 3UE3A 2A24A 2DMWA 3EGDC 5TBMB 2WKRA 2OWJA 4I3IA 2W3EA 2PYRA 3MXQA 4GLQA 2ZOIA 1XJ6A 5CX7A 2HF6A 3O5YA 3OCLA 1UWPX 2J3TC 3T4OA 3NOTC 2JHEA 2D02A 2GNXA 3B47A 2A24B 2HJ9C 2QJ5A 3BW6A 4IHQA 1YSPA 2VA0A 2VKSA 1OPXA 5HD3A 2GJ3A 1KOUA 4NKPA 4XT2B 4KUOA 1N9NA 4EERA 1TS7A 3OOVA 5A8BA 4YWZA 3H7WA 3PBQA 4JGOA 1GSXA 3S7PA 5HDSA 2W1RA 3LR0A 3BWLA 3TRCA 3TW8A 5KSHA 1TF1A 1F98A 4ME4A 4MN7A 3LI8A 5DFXA 4RQ9A 3H7WB 3U2AA 4NXGA 3KYQA 4FSFA 3C38A 3LICA 5F69A 4HOIA 4MN5A 3EEHA 3MFXA 5AJGA 3PBRA 4R38A 3BY8A 2JKRI 3MQQA 1IFQA 4PHTA 5L8MA 4GCZA 4Y2FA 4LRXC 4EU0A 2BASA 3KSFA 2WKQA 3LI9A 4EETB 2JKRM 4KQDA 4ZRRA 3KSHA 2L1MA 2KLIA 4HIAA 4WN5A 2XROA 4WEKA 5HDDA 5LBRA 3MJQA 3F1NA 4IUHA 2M7UA 5J3WA 4H6JB 3HJKA 4Y3IA 1UWNX 1S66L 4CLCD 2L4RA 4Q0JA 2PR5A 2ZOHA 4I38A 5HD5A 4NXEA 3E4OA 3V67A 3LIEA 3UB6A 4HJ6A 4HJ4A 4HHDA 1OTBA 2WKPA 5DFYA 5MC7A 4BWIA 3T4LA 2W27A 2PDRA 2Y79A 1YSQA 2JN7A 3C2WA 2YKFA 3LIFA 1T19A 3D72A 1XJ3A 4R3AA 5DJTA 1OT9A 2FZ0A 3NOUC 3DBAA 3UB9A 4L9EA 5HWVA 3LR3A 4WL9A 2W3GA 4GS9A 2G7UA 1S67L 3R7WB 2W3DA 4EEPA 5TBMA 1LT0A 2K7SA 4YOFA 1P0ZA 4JGPA 3MF0A 3LFVA 2W1TB 3E98A 3PBOA 4O0PA 1P97A 1OJGA 4GHIB 4MMNA 1W63M 2P08A 4B9OA 2LB9A 5DJUA 4JGRA 4OOMA 2PT7A 2W3HA 3UMDA 2R78A 4GJ4A 1NLZA 2Z6CA 2Y8HA 3FPWA 2J3WA 4NXBA 5HZHA 1IOUA 2V9AA 2XSSA 4XT2A 2LB5A 3MQOA 1D06A 3FPVA 4L0LA 4BBVA 1S1YA 1G28A 4LPZA 3T4TA 4R6LA 5IS1A 4P6ZS 3EOIA 2D01A 1DP9A 1Y28A 2QJ7A 5DF9A 4G3WA 1OTIA 3G6OA 4HI4A 4NXFA 4UEYA 4L9FA 4WUJA 4M4XA 2OAP1 5J4EA 2KDKA 2VLGA 4I5SA 1DP6A 4YNRA 3VE3A 1S1ZA 4HQAA 4LRYC 2XRNA 4R70A 3H82B 3T4JA 3SW1A 3CAXA 4G3KA 3ULFA 3F1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IS2 B;  1LSX A;  3LYX A;  2V1B A;  3NOP C;  3F1O B;  1WA9 A;  1GSV A;  3NHQ A;  2QHK A;  5F5Y A;  4MN6 A;  1DP8 A;  1EW0 A;  4E04 A;  4I3J A;  4H6J A;  4EES A;  3K3C A;  3UB7 A;  1BYW A;  1N9O A;  3RH8 B;  2INW A;  4HNB A;  5EFW A;  4BBU A;  3P7N A;  4HH3 A;  1ODV A;  4JGQ A;  3GEC A;  3LUQ A;  1MZU A;  3C8C A;  2CMN A;  3ZQ5 A;  2M1C A;  2H28 A;  1V9Y A;  5AVE A;  2PYP A;  1TS8 A;  4EQ1 A;  4HJ3 A;  4DJ2 A;  2EA9 A;  1T1A A;  3PYP A;  3K3D A;  2V0W A;  3OLO A;  3FC7 A;  1OTE A;  3E4Q A;  4HH2 A;  5I5L A;  4DJ3 A;  2KX6 A;  4GHI A;  3IBR A;  5HDC A;  3HJI A;  4WLA A;  1LSV A;  4EXO A;  2ZBB A;  1VB6 A;  3A0R A;  2QKP A;  1XJ2 A;  3ICY A;  4F3L A;  4HP4 A;  2PD8 A;  4LLO B;  3LIB A;  1F9I A;  3UB8 A;  4L9G A;  3VE4 A;  2B02 A;  4F3L B;  5HWT A;  4KUK A;  4K08 A;  1D7E A;  3H82 A;  2PR6 A;  4HP9 A;  1XFN A;  3NJA A;  2V1A A;  3F1P B;  4GW9 A;  3IS2 A;  1TS0 A;  1XJ4 A;  2J80 A;  3GDI A;  2VV7 A;  2VV6 A;  1LL8 A;  2QWS A;  4EW7 A;  4BBT A;  5IU1 A;  1S4S A;  2VEA A;  1T18 A;  1UGU A;  4I3A A;  5F6A A;  3E4P A;  1NWZ A;  3LIA A;  1OT6 A;  2YKH A;  1V9Z A;  4PKY A;  2OOL A;  4I39 A;  1T1C A;  2PHY A;  3MR0 A;  5DKL A;  3CLO A;  5HWW A;  5G4Z A;  3UE6 A;  2I9V A;  1N9L A;  1OTA A;  2P7J A;  4EEU A;  2PD7 A;  5F68 A;  3H9W A;  4LRZ E;  1GSW A;  1OTD A;  2W0N A;  5J7E A;  3EWK A;  2Z6D A;  5DKK A;  3KX0 X;  3VOL A;  3F1N B;  4HY8 A;  1S4R A;  3LID A;  3FG8 A;  3A0S A;  1JNU A;  5HSQ A;  1DRM A;  2HV1 A;  3UME A;  2V0U A;  5G4Y A;  3A0V A;  4PKY G;  2VV8 A;  3CWF A;  3RTY A;  1TS6 A;  1XFQ A;  2L0W A;  3BY9 A;  1T1B A;  4WF0 A;  1LSW A;  3T50 A;  1OJ5 A;  2OWH A;  5AVF A;  1X0O A;  3B33 A;  3PHY A;  4GS9 B;  5KIZ A;  3F1P A;  2A24 A;  5TBM B;  2WKR A;  2OWJ A;  4I3I A;  2PYR A;  3MXQ A;  2ZOI A;  1XJ6 A;  1UWP X;  3NOT C;  2JHE A;  2D02 A;  2A24 B;  2QJ5 A;  5HD3 A;  2GJ3 A;  1KOU A;  4XT2 B;  4KUO A;  1N9N A;  4EER A;  1TS7 A;  5A8B A;  4YWZ A;  3H7W A;  4JGO A;  1GSX A;  5HDS A;  3BWL A;  1F98 A;  3LI8 A;  4RQ9 A;  3H7W B;  4NXG A;  3LIC A;  5F69 A;  4HOI A;  4MN5 A;  3EEH A;  3MFX A;  4R38 A;  3BY8 A;  3MQQ A;  4GCZ A;  4LRX C;  2BAS A;  2WKQ A;  3LI9 A;  4EET B;  4KQD A;  2L1M A;  4HIA A;  4WN5 A;  5HDD A;  3MJQ A;  3F1N A;  5J3W A;  4H6J B;  3HJK A;  1UWN X;  1S66 L;  2L4R A;  2PR5 A;  2ZOH A;  4I38 A;  5HD5 A;  4NXE A;  3E4O A;  3LIE A;  3UB6 A;  4HJ6 A;  4HJ4 A;  4HHD A;  1OTB A;  2WKP A;  2W27 A;  2PDR A;  2JN7 A;  3C2W A;  2YKF A;  3LIF A;  1T19 A;  3D72 A;  1XJ3 A;  4R3A A;  5DJT A;  1OT9 A;  3NOU C;  3UB9 A;  4L9E A;  5HWV A;  4WL9 A;  4GS9 A;  1S67 L;  4EEP A;  5TBM A;  1LT0 A;  2K7S A;  1P0Z A;  4JGP A;  1P97 A;  1OJG A;  4GHI B;  4B9O A;  5DJU A;  4JGR A;  3UMD A;  2R78 A;  2Z6C A;  4NXB A;  5HZH A;  2V9A A;  4XT2 A;  3MQO A;  1D06 A;  4BBV A;  1S1Y A;  1G28 A;  4LPZ A;  4R6L A;  5IS1 A;  2D01 A;  1DP9 A;  1Y28 A;  2QJ7 A;  1OTI A;  3G6O A;  4HI4 A;  4NXF A;  4L9F A;  4WUJ A;  4M4X A;  5J4E A;  2KDK A;  2VLG A;  4I5S A;  1DP6 A;  3VE3 A;  1S1Z A;  4HQA A;  4LRY C;  4R70 A;  3H82 B;  3SW1 A;  3CAX A;  3ULF A;  3F1O A; 
#chains in the Genus database with same CATH topology
 5D3O A;  2J3T D;  3TE8 A;  4QY5 A;  2V1B A;  4ZBE A;  2JKT I;  3T1Q B;  1YM1 A;  1MC0 A;  2EXB A;  3FWL A;  1GSV A;  3MZF A;  2QHK A;  2ZQ9 A;  5F5Y A;  2KOI A;  3KO6 A;  1MKM A;  2DCF A;  2ZQA A;  1EWZ A;  1K56 A;  3NC8 A;  3WS1 A;  2H0Y A;  3OPH A;  3PXP A;  4S2O A;  3TJZ C;  4N92 A;  2XFS A;  2XQZ A;  1E3U D;  3GTC A;  1SKO A;  3KSI A;  3G32 A;  2JKF A;  3LY4 A;  3GEC A;  1LL5 A;  4ID4 A;  4B4Z A;  4O01 A;  1MZU A;  3B3X A;  3HLG A;  2O99 A;  1HTZ A;  3ZQ5 A;  1XP4 A;  4EUV A;  1P9R A;  5HX9 A;  5AVE A;  1PZO A;  4DN0 A;  1PNE A;  3S4X A;  1IYO A;  4EQ1 A;  3QHY A;  2HDU A;  3T4Q A;  4HJ3 A;  4DJ2 A;  2HGV A;  5GHZ A;  4ARZ B;  3OLO A;  4UQI S;  3D3O A;  4DJ3 A;  4LCM A;  4WLA A;  1K55 C;  1LSV A;  3FKW A;  3M6H A;  4BJP A;  1VQQ A;  2ZBB A;  3DTE A;  3IH8 A;  4IVI A;  3P98 A;  5IHV A;  2PD8 A;  2V2F F;  2HDR A;  4LLO B;  4PM9 A;  3LIB A;  1PZP A;  3BFF A;  1FIK A;  3PBT A;  4QJG A;  5CER A;  1KVM A;  3C5A A;  4K08 A;  1D7E A;  3VP4 A;  4HP9 A;  2K31 A;  1XFN A;  4QHC A;  4GW9 A;  2J80 A;  4B93 A;  4GKU A;  5A90 A;  3Q07 A;  3VP3 A;  2PU2 A;  1MXO A;  3WS2 A;  3AGE A;  1SCW A;  4RX3 A;  4MBF A;  4NG2 A;  3CIT A;  1IKG A;  5EVE A;  3VSK A;  4KZ3 A;  4E3O A;  1JTD A;  3O88 A;  1GCE A;  2OSU A;  5F6A A;  2YKH A;  1V9Z A;  5AQA A;  2OOL A;  3SH7 A;  1H8M A;  3C4P A;  2V20 A;  2VK3 A;  3UPN A;  5G4Z A;  4KQO A;  3UE6 A;  2EX8 A;  2GX5 A;  3NIA A;  3KYE A;  4LV0 A;  3ZVW A;  5FAO A;  1G6A A;  4LRZ E;  2W0N A;  1K57 C;  1JTG A;  1PYY A;  3SZT A;  5M1A A;  4HY8 A;  2WYX A;  4EBL A;  3FG8 A;  3HLC A;  3Q82 A;  1JNU A;  4WM9 A;  3CI6 A;  1SDE A;  4CPK A;  5FQI A;  1NYM A;  3DTM A;  3CUE C;  1YT4 A;  3HLF A;  1E3U A;  1PI5 A;  2OLV A;  3KSG A;  3CWF A;  2OV5 A;  4Y0U A;  3N8S A;  3JVU A;  2XK1 A;  2A3U A;  1XFQ A;  4WMC D;  2L0W A;  1ONG A;  5GHX A;  4OON A;  1IYS A;  2XD5 A;  5FQ9 A;  3A3J A;  2IA2 A;  1W8Q A;  1X0O A;  5HPI A;  1PRQ A;  3B42 A;  3DTK A;  3F1P A;  2DRW A;  3VV4 A;  4DDY A;  2A24 A;  1CF0 A;  1IYP A;  4I3I A;  2W3E A;  3MXQ A;  2ZOI A;  1XJ6 A;  3CZD A;  3O5Y A;  4GB7 A;  4GOG A;  2A24 B;  2XD1 A;  4O7D A;  2OLU A;  2GJ3 A;  1JWP A;  2FFF B;  4NKP A;  5E43 A;  3A3F A;  2ZC5 B;  4YWZ A;  3PBQ A;  4NK3 A;  3VFF A;  3TW8 A;  1BLS A;  1FR6 A;  4MN7 A;  1M6K A;  4NXG A;  3LIC A;  3OPP A;  1Y4O A;  5M19 A;  3SS3 A;  2HDQ A;  4S2P A;  3IXH A;  4R38 A;  1KDS A;  4X6T A;  5HAP A;  4HBU A;  2UWX A;  1YQS A;  2WKQ A;  3N6I A;  3KSH A;  2L1M A;  3MKF A;  4WN5 A;  4WZ4 A;  3BEC A;  3W4Q A;  1YPR A;  1FCN A;  2Q0O A;  1H8Z A;  5GLD A;  4KZB A;  4CLC D;  2PR5 A;  4MEZ A;  4NXE A;  2QMI A;  3UB6 A;  4Z9Q A;  4HHD A;  3E2L A;  3DAV A;  1FCM A;  1MBL A;  3GSG A;  4OPQ A;  5DFY A;  4UAA A;  5KSC A;  2EFU A;  3CPT B;  4GNU A;  1SKF A;  2JN7 A;  3C2W A;  3WWX A;  3G35 A;  5HFO A;  5G18 A;  2R9X A;  5CXW A;  5DJT A;  2Y2I A;  1AXB A;  4HBT A;  3UPP A;  1ACF A;  3UB9 A;  3BFG A;  2RCX A;  5E2E A;  1CK3 A;  4WL9 A;  2FFY A;  1BUL A;  3R7W B;  2W3D A;  5AQB A;  5TBM A;  4YOF A;  2XGN A;  4JGP A;  4GZB A;  4XXR A;  3PBO A;  1ZG6 A;  4JF6 A;  2Q9M A;  1KGG A;  2LB9 A;  5DJU A;  2W3H A;  3GRJ A;  2Y8H A;  2XLN A;  2HP9 A;  5HZH A;  4X1M A;  4UA6 A;  4XT2 A;  2LB5 A;  4BBV A;  2A49 A;  3G6O A;  3LEQ A;  4HI4 A;  2J7V A;  1S6R A;  2H10 A;  5CGX A;  3BM6 A;  1S1Z A;  4WMC A;  3HLW A;  4R70 A;  1L3L A;  3T4J A;  2ZL1 A;  4G3K A;  5CEB A;  2BTF P;  3ISG A;  3IS2 B;  4OPR A;  1LSX A;  5FAQ A;  4JXV A;  2ZL1 B;  2C5W B;  3HUM A;  3NOP C;  2Z2M B;  2Y2N A;  3DW0 A;  3E2K A;  4RA7 A;  2WGV A;  4ETX A;  3UNW A;  4OLG A;  1MWT A;  2WGI A;  1DP8 A;  1EW0 A;  1SZV A;  1STZ A;  2VGJ A;  1Z09 A;  3SH8 A;  3SOI A;  1PW8 A;  2NUT C;  4FH4 A;  4QD4 A;  1BYW A;  1N9O A;  3MBZ A;  3MZD A;  1XGI A;  3FV7 A;  4HNB A;  4NEE D;  4Q0I A;  2XH9 A;  4HH3 A;  2P04 A;  4DXB A;  2HZ5 A;  1AWI A;  3D9Y A;  1ODV A;  1NRF A;  5EPH A;  1YKD A;  2E8I A;  3CHW P;  5A93 A;  1BLP A;  3EEA A;  1L0G A;  1BT5 A;  2H28 A;  1V9Y A;  2PYP A;  2ZMV A;  3M6B A;  5CHU A;  1L0D A;  4N1X A;  4FD8 A;  2NUP C;  4K0W A;  4FH2 A;  3K3D A;  4BD0 A;  5HL1 A;  4DMZ A;  4E3L A;  2VZW A;  1OTE A;  4HH2 A;  5I5L A;  2W3F A;  5FI6 A;  3IBR A;  4LV2 A;  3IF6 B;  2PBY A;  3L9K A;  4MNR A;  2ZD8 A;  3HJI A;  3C4O A;  1VHM A;  4CLC A;  1G6O A;  2EXA A;  4U0T A;  4PAU A;  1JVJ A;  2QKP A;  1XJ2 A;  3IXG A;  1YMX A;  1PWG A;  3ICY A;  4F3L A;  1IYQ A;  2GZA A;  3W4O A;  3UE1 A;  4CLC B;  3VP2 A;  5DF7 A;  1CQA A;  3UB8 A;  2O9A A;  2CC1 A;  4L9G A;  3GVB A;  4YIN A;  4F3L B;  2Y91 A;  3H82 A;  2PR6 A;  3Q7Z A;  1XA7 A;  5EOO A;  2A2L A;  3EQU A;  3N7W A;  4JF5 A;  5FL3 A;  5E2H A;  3P01 A;  4K0X A;  2Y59 A;  5F1G A;  2VV7 A;  3S7N A;  5CEC A;  2V8F A;  1IEM A;  3ZFZ A;  3BQ8 A;  2ZM2 A;  2QPN A;  4EW7 A;  3ZHH A;  3QP4 A;  1UGU A;  3MZE A;  1CEG A;  4G3V A;  3E4P A;  1NWZ A;  3ZCZ A;  2EFX A;  4PKY A;  2H0T A;  5CGW A;  4UQI M;  3E0Y A;  1T1C A;  3ZG5 A;  3IHA A;  5DKL A;  3QP8 A;  1A0K A;  4DXC A;  3T4K A;  3S1Y A;  4OP8 A;  3RJU A;  4JF4 A;  2BG1 A;  1CI9 A;  3H9W A;  2C6W B;  1Q2Q A;  3OCN A;  4E6X A;  2O9C A;  1OTD A;  3R4K A;  5J7E A;  3DWK A;  3N4I A;  4ARZ A;  3VOL A;  1ZTU A;  4KQR A;  5HPF A;  2B18 A;  1S4R A;  3RFB A;  4IED A;  5HSQ A;  5AQ9 A;  3BLS A;  2P9V A;  2HV1 A;  4OQH A;  1LLB A;  2EX2 A;  4Y7P A;  3IBJ A;  4IBR A;  4R3B A;  4O8G A;  1YLT A;  2P9V B;  4OQ0 A;  3RTY A;  1XKZ A;  2JC7 A;  1W79 A;  5U47 A;  1ES5 A;  3ZG7 B;  4WF0 A;  1LSW A;  4BD1 A;  3IHB A;  2GDN A;  1ERM A;  4DE1 A;  2OWH A;  3SS5 A;  3PHY A;  4QY6 A;  1LHY A;  4KEN B;  4C75 A;  1GHP A;  2DMW A;  2OWJ A;  2IWB A;  1N9B A;  4KG2 A;  5KZH A;  2V8C A;  2BLS A;  2JHE A;  2D02 A;  1XX2 A;  4CJN A;  1YLZ A;  3TSG A;  3JYI A;  2WUQ A;  1KOU A;  1N9N A;  4EER A;  4Y0O A;  3OOV A;  3T1X A;  1K4F A;  4JGO A;  4OPY A;  2W1R A;  3LR0 A;  4WZ5 A;  4E3K A;  2ZC7 A;  5FDS A;  3LI8 A;  4RQ9 A;  3ITA A;  2B95 A;  2V1Z A;  3BLM A;  4S2L A;  3C38 A;  3I7J A;  1KE4 A;  3IX3 A;  4GN2 A;  4HOI A;  3MFX A;  3ZVT A;  2PU4 A;  3ZG9 B;  1DJA A;  5FQK A;  3MQQ A;  4PHT A;  4OQG A;  3G30 A;  4PM7 A;  4LRX C;  3UY6 A;  4QB8 A;  2JKR M;  4KQD A;  2EX6 A;  4XUZ A;  2KLI A;  2XRO A;  5FSR A;  5J3W A;  1CI8 A;  5FAS A;  4H6J B;  3HJK A;  1UWN X;  1S66 L;  4Y15 A;  5CRF A;  2L4R A;  4Q0J A;  3T12 B;  2ZOH A;  2Y2G A;  3M2K A;  4D60 A;  3MXR A;  2QZ6 A;  4HJ6 A;  1G68 A;  2J9O A;  3NEC A;  4MBK A;  4BWI A;  3V3R A;  2Y79 A;  2YKF A;  3IX4 A;  3LIF A;  2IWD A;  4DRT A;  1PWC A;  1K54 A;  4R3A A;  1H5X A;  3IWI A;  3A3E A;  4KG6 A;  5HWV A;  3MS6 A;  1DY6 A;  3NI9 A;  2W3G A;  3HBR A;  3BFC A;  2HP5 A;  1I2S A;  4NET A;  3UB5 P;  4S2K A;  1P0Z A;  2RL3 A;  4LFU A;  4K91 A;  2W1T B;  3GR2 A;  4EUZ A;  5EVL A;  3VP1 A;  4O0P A;  1K0K A;  4GHI B;  1ERO A;  1YLY A;  2Y4A A;  3G31 A;  4ZDX A;  3UE0 A;  3ZNY A;  5EM0 A;  1NLZ A;  2J3W A;  4Y13 A;  1IOU A;  2XSS A;  4U0X A;  3O3V A;  3MQO A;  1D06 A;  3T4T A;  3AGF A;  4P6Z S;  2D01 A;  5A92 A;  3G4P A;  4G3W A;  4NXF A;  2AVX A;  4UEY A;  4L9F A;  2WGW B;  2G2U A;  4YNR A;  3P09 A;  1YLW A;  3PTE A;  3SW1 A;  4FUW A;  1PI4 A;  1YLJ A;  3F1O A;  3ZG8 B;  4HEF A;  3MMH A;  3SH9 A;  1ES2 A;  3CG5 A;  4KZ6 A;  3F1O B;  4E6W A;  1WE4 A;  3CMZ A;  3OPR A;  4E04 A;  1BSG A;  4C3Q A;  4WEJ A;  4B4X A;  4I3J A;  4JPM A;  1H3Q A;  4CLC C;  4UHU A;  1BZA A;  4EES A;  1NXY A;  5E2G A;  1Y54 A;  4ETZ A;  3V39 A;  3K3C A;  4OOL A;  3ZGA B;  1F5M A;  5EVI C;  4RYE A;  1W7F A;  4BBU A;  1NJ4 A;  3CPT A;  4JXS A;  2HDS A;  4JGQ A;  1FOF A;  3DWZ A;  1QME A;  3LUQ A;  5JYP A;  1OME A;  1O7E A;  2M1C A;  1W63 Q;  4S2N A;  2P74 A;  2ZC3 B;  3CJM A;  2QYB A;  4QPR A;  3MQ0 A;  3R7W A;  1XPB A;  4Y5F A;  2O9B A;  3IWQ A;  5IT5 A;  2EA9 A;  1T1A A;  3PYP A;  3FC7 A;  1WYC A;  5GLA A;  3E4Q A;  2HJE A;  4P85 A;  3IX8 A;  4MDZ A;  1FCO A;  4S2I A;  5HDC A;  1O07 A;  3UDF A;  3U4L P;  3GQZ A;  4EXO A;  4N9L A;  3A0R A;  2J8Y A;  3M2J A;  4GDB A;  2VJW A;  1ES3 A;  5C5K A;  4PM8 A;  1CEF A;  3PAE A;  1F9I A;  5F1F A;  3VE4 A;  2ZQ7 A;  5HWT A;  4Z1W A;  5L09 A;  3IQA A;  4KUK A;  4JLF A;  2XA7 M;  5EEC A;  4JXW A;  4Y0T A;  2V1A A;  3HRE A;  2ZQC A;  1H8Y A;  3IS2 A;  3NCK A;  4R4S A;  1XJ4 A;  1MWU A;  3ZYT A;  2Z2L B;  3QP1 A;  2G2W A;  1KVL A;  1YAX A;  3D4F A;  2VGL M;  3VOZ A;  2FH5 A;  3EGX C;  2VV6 A;  2Y55 A;  1LL8 A;  4OVD A;  1VM1 A;  2QWS A;  4MBH A;  5IU1 A;  4DDS A;  2ACG A;  5L2F A;  3CUE A;  5CTM A;  5EE8 A;  2I72 A;  2VEA A;  4LV1 A;  1T18 A;  5FAT A;  3LIA A;  2ZM8 A;  1QMF A;  3WRT A;  4F94 A;  1L0F A;  3HUN A;  1RGY A;  2K2N A;  2XA7 S;  3N8R A;  3MR0 A;  1F2K A;  2PRF A;  3CLO A;  3JVV A;  4PM5 A;  1MWR A;  1RP5 A;  5HWW A;  4KQQ A;  3O87 A;  5FQM A;  5A91 A;  4WBG A;  2I9V A;  1BLH A;  2P7J A;  2VGL S;  3BQA A;  3C7U A;  4DE0 A;  3PBS A;  2PD7 A;  3EQV A;  5F68 A;  1HZO A;  2O0Y A;  1K25 A;  5E2F A;  5HL6 A;  3OC2 A;  4AFI A;  1XGJ A;  5TGF A;  3EWK A;  2R9W A;  5DKK A;  1P9W A;  3KX0 X;  4PMA A;  5L07 A;  4BQM A;  3F1N B;  4EBP A;  1JWZ A;  3DTI A;  4GD8 A;  3PBN A;  3IF6 A;  3LID A;  3A0S A;  3FZC A;  1DRM A;  1ZHH B;  3T4S A;  3UME A;  1D1J A;  2JKG A;  1KE0 A;  4S2M A;  5FI7 A;  4WZ5 C;  1K38 A;  3MXS A;  3A0V A;  4PKY G;  4EBN A;  4IUK A;  5HW3 A;  2IWC A;  2Y2L A;  3LEZ A;  1TS6 A;  4IJG A;  4CLC E;  1H0M A;  2M7V A;  1YMS A;  3T50 A;  1OJ5 A;  3SS4 A;  4GS9 B;  4CQH A;  5DVA A;  3NUL A;  1FIL A;  1RCJ A;  1S0W A;  4WYY A;  3UE3 A;  3EGD C;  2WKR A;  1FR1 A;  3RXX A;  5FAP A;  3QNC A;  4M3K A;  1CJF A;  1J9M A;  1UWP X;  2J3T C;  3NOT C;  2GNX A;  3B47 A;  2HJ9 C;  4KZ8 A;  3BW6 A;  4IHQ A;  2VA0 A;  4DF6 A;  1NZU A;  2VKS A;  4LV3 A;  4QWO A;  3QP6 A;  5TR7 A;  2XF3 A;  4KUO A;  2HPB A;  3PAG A;  5HAR A;  5M18 A;  1GSX A;  4X68 A;  1PW1 A;  5HDS A;  4OP5 A;  2XR0 A;  3BWL A;  3TRC A;  5KSH A;  1TF1 A;  1F98 A;  1SDN A;  4ME4 A;  3U2A A;  1K54 C;  3BRM A;  4FSF A;  5DTT A;  1WYB A;  5F69 A;  1ZG4 A;  3UO9 A;  3RXW A;  4MN5 A;  5AJG A;  4ZTK A;  3BY8 A;  2WKH A;  4Y2F A;  5CHM A;  2VGK A;  4DE3 A;  4EU0 A;  2BAS A;  3KSF A;  3LI9 A;  4ZRR A;  1MKI A;  2WAD A;  4N1H A;  4WEK A;  5HDD A;  4X56 A;  5LBR A;  4X1L A;  5J8X A;  4JXG A;  4Y3I A;  1G5U A;  3WS5 A;  1DJB A;  5HAQ A;  2B5R A;  1SHV A;  4GDN A;  4HJ4 A;  3ZDJ A;  3VFH A;  1OTB A;  2JE5 A;  2WKP A;  5MC7 A;  1SKO B;  1ZC2 A;  2W27 A;  1YSQ A;  3V5M A;  5FEF A;  5F83 A;  2UV0 E;  1ERQ A;  1T19 A;  1XJ3 A;  1OT9 A;  2FZ0 A;  3NOU C;  4ESP A;  3N8L A;  4L9E A;  3LR3 A;  4R23 A;  4KZ5 A;  1XA1 A;  1S67 L;  2G7U A;  1DJC A;  5FEG A;  1ES4 A;  1LT0 A;  4E3N A;  3MF0 A;  1GA0 A;  2HP6 A;  1MPL A;  3E98 A;  1OJG A;  2PAV P;  4MMN A;  1W63 M;  4B9O A;  1HD8 A;  1C3B A;  5EUA A;  4OOM A;  2PT7 A;  2R78 A;  4GJ4 A;  4R0Q A;  3FPW A;  2ZLY A;  4NXB A;  4P87 A;  3BEB A;  3FPV A;  4LPZ A;  1NYY A;  4R6L A;  2JCH A;  1U60 A;  4BL2 A;  3Q7V A;  1DP9 A;  1Y28 A;  2QJ7 A;  3IXD A;  1TDL A;  3Q1F A;  4WUJ A;  2ZC4 B;  5J4E A;  2KDK A;  3IT9 A;  3Q7V B;  4HQA A;  2XRN A;  1MWS A;  1VET A;  4KZA A;  1FSW A;  4S2N C;  1ALQ A;  2XFT A;  4OPZ A;  3AGD A;  3NDE A;  3LYX A;  1VET B;  3KYZ A;  2WZX A;  1PIO A;  1TVF A;  4JKT A;  3Q81 A;  5KMW A;  1WA9 A;  2OAQ 1;  3NHQ A;  3S22 A;  2J9P A;  4KZ7 A;  4MN6 A;  2Y2M A;  3MSH A;  4H6J A;  5EV0 A;  1RGZ A;  4OQI A;  3VSL A;  3PR6 A;  3MKE A;  1PWD A;  2Y2Q A;  3UB7 A;  3RH8 B;  4EQI A;  2INW A;  5EFW A;  3HVF A;  2PBD P;  3P7N A;  4X69 A;  1LL9 A;  1Q2P A;  3A3I A;  2EWW A;  2E8J A;  3NDG A;  2ZQ8 A;  3C8C A;  2CMN A;  4ZJ3 A;  4P6Z M;  4PPR A;  1FSY A;  4ZJ2 A;  4Q0H A;  3LR5 A;  3HLE A;  4WEL A;  1TS8 A;  2WAF A;  1ONH A;  1J3W A;  4FOF A;  1GA9 A;  2V0W A;  2W1T A;  4E3M A;  3LCE A;  3IWO A;  3HL9 A;  4GD6 A;  4A5R A;  2Y2K A;  2KX6 A;  4GHI A;  4OLD A;  2Y2O A;  3C30 A;  3UPO A;  3A3D A;  2ZMF A;  3WS0 A;  3W8K A;  1NLY A;  3S7Q A;  4EWF A;  3C7V A;  1VB6 A;  5DF8 A;  3W2Z A;  4KZ4 A;  2Y2J A;  3TOI A;  1TD5 A;  3LO7 A;  5I94 A;  1NZO A;  4HP4 A;  3G2Y A;  2JBF A;  5GLC A;  3HUO A;  2WGW A;  2WZZ A;  3FYZ A;  2B02 A;  2EWV A;  4EV4 A;  1KDW A;  1ZKJ A;  3NY4 A;  3VP0 A;  3IF5 A;  3NJA A;  3F1P B;  1XXM A;  5CGS A;  3G2Z A;  1TS0 A;  5CTN A;  1EI5 A;  3GDI A;  2MJ6 A;  3UDI A;  4MCW A;  3OBF A;  5CED A;  3IF6 C;  5DTK A;  4R4R A;  4BBT A;  1E25 A;  2WKI A;  4X53 A;  2XEP A;  2VX8 A;  5TJJ A;  2JKT M;  1S4S A;  5GL9 A;  4BMW A;  1K55 A;  4OOY A;  4Y17 A;  4I3A A;  3VMA A;  4MLL A;  1BUE A;  1OT6 A;  5FQJ A;  5K5B A;  4RVA A;  4I39 A;  1L0E A;  2PHY A;  4ZJ1 A;  4R1G A;  3UDX A;  1W5D A;  5GHY A;  2Q9N A;  3BFE A;  3LGO A;  1VEU A;  3VOY A;  3HCY A;  1N9L A;  1JWV A;  3WS4 A;  1OTA A;  4EEU A;  2X02 A;  4UA7 A;  2WKE A;  1VEU B;  3T1S A;  3ITB A;  3TG9 A;  1GSW A;  3K2N A;  3V3S A;  2Z6D A;  3G34 A;  1KGF A;  3BJN A;  3L7H A;  4PM6 A;  5EVI D;  1MY8 A;  2Y2P A;  3S7O A;  4YFM A;  3OZH A;  2V0U A;  1KE3 A;  5AQ7 A;  5G4Y A;  3NBL A;  4X25 A;  4E3I A;  5JYO A;  3LR4 A;  2X01 A;  4E3J A;  2VV8 A;  1NRJ A;  1L2S A;  4R3J A;  5FQQ A;  1K6R A;  3BY9 A;  1T1B A;  3GV9 A;  4FTX A;  2WK0 A;  4OH0 A;  1M40 A;  4OKP A;  5AVF A;  4FCF A;  3LY3 A;  3B33 A;  4II7 A;  5KIZ A;  5CHJ A;  5EM1 A;  4QU3 A;  5TBM B;  2PYR A;  4GLQ A;  1E4D A;  5CX7 A;  1I5Q A;  1FQG A;  2HF6 A;  3O86 A;  4JBF A;  3OCL A;  3T4O A;  1Z6F A;  1K57 A;  1YLP A;  2QJ5 A;  4KG5 A;  1K4E A;  1YSP A;  1W8Y A;  1OPX A;  5HD3 A;  1K56 D;  3BYD A;  1IKI A;  1BTL A;  4XT2 B;  3QP5 A;  5GLB A;  1TS7 A;  3HLD A;  4LEN A;  5A8B A;  3H7W A;  5HAI A;  3S7P A;  4LGW A;  3ZNT A;  3WRZ A;  4KZ9 A;  5DFX A;  1BLC A;  3H7W B;  4IBX A;  3KYQ A;  3V50 A;  4DE2 A;  3EEH A;  3QNB A;  2EX9 A;  4S2J A;  5FI2 A;  5FA7 A;  3PBR A;  3BFD A;  2JKR I;  3T1R A;  1IFQ A;  5L8M A;  4GCZ A;  3IXB A;  5TFQ A;  4BEN A;  4EET B;  3W4P A;  1LI9 A;  4IVK A;  2ZMA A;  4HIA A;  1GHI A;  4RX2 A;  3MJQ A;  3F1N A;  4IUH A;  2M7U A;  2ZM0 A;  1N4O A;  2XDM A;  4P6B A;  4N9K A;  5FDH A;  4Q8I A;  1HVB A;  4DKI A;  4UA9 A;  5BOH A;  3MFD A;  3JPU A;  4I38 A;  5HD5 A;  1NY0 A;  3E4O A;  3V67 A;  5EOE A;  3LIE A;  2H5S A;  4XUX A;  1K6S A;  1TEM A;  3T4L A;  2PDR A;  2ZJ9 A;  1LI0 A;  3D72 A;  3ZG0 A;  4U3T A;  3DBA A;  4H8R A;  5DTS A;  5L10 A;  1PFL A;  3GMW A;  4GS9 A;  4BL3 A;  1KGE A;  4EEP A;  3HLB A;  4C6Y A;  2K7S A;  3OPL A;  4BLM A;  3LFV A;  4D2O A;  2ZQD A;  1P97 A;  4ZAM A;  2ZC6 B;  1ESU A;  2P08 A;  3QP2 A;  4JGR A;  3UMD A;  1GHM A;  2Z6C A;  4LCL A;  2V9A A;  2DNS A;  5EVI A;  1I2W A;  3IH9 A;  4P0M A;  4L0L A;  1S1Y A;  1G28 A;  5IS1 A;  3EOI A;  1HLU P;  2WAE A;  5DF9 A;  2Y2H A;  1OTI A;  3FKV A;  5EVI B;  1ESI A;  1IEL A;  4M4X A;  2OAP 1;  4HES A;  2VLG A;  3UN7 A;  4I5S A;  1DP6 A;  3VE3 A;  4LRY C;  5F82 A;  4B88 A;  2X71 A;  3H82 B;  3CAX A;  1TDG A;  3ULF A;  4X55 A; 
#chains in the Genus database with same CATH homology
 3IS2 B;  2J3T D;  1LSX A;  3TE8 A;  3LYX A;  3KYZ A;  2V1B A;  3MMH A;  2JKT I;  3NOP C;  3F1O B;  1MC0 A;  1WA9 A;  2OAQ 1;  1GSV A;  3NHQ A;  2QHK A;  4ETX A;  5F5Y A;  2KOI A;  4MN6 A;  1DP8 A;  1EW0 A;  4E04 A;  3KO6 A;  4WEJ A;  4I3J A;  4H6J A;  1MKM A;  1H3Q A;  1STZ A;  4CLC C;  3PR6 A;  4EES A;  2NUT C;  4ETZ A;  3K3C A;  3UB7 A;  1BYW A;  3PXP A;  4OOL A;  3TJZ C;  1N9O A;  3RH8 B;  1F5M A;  2INW A;  4HNB A;  5EFW A;  4BBU A;  4NEE D;  3KSI A;  3P7N A;  4Q0I A;  4HH3 A;  2P04 A;  1ODV A;  4JGQ A;  3GEC A;  3LUQ A;  1YKD A;  4O01 A;  2EWW A;  1MZU A;  3C8C A;  2O99 A;  2CMN A;  3EEA A;  3ZQ5 A;  4EUV A;  2M1C A;  2H28 A;  1P9R A;  4P6Z M;  1W63 Q;  1V9Y A;  2QYB A;  4QPR A;  5AVE A;  2PYP A;  3MQ0 A;  4Q0H A;  4DN0 A;  3R7W A;  3LR5 A;  2ZMV A;  4WEL A;  1TS8 A;  4Y5F A;  4EQ1 A;  2O9B A;  2NUP C;  5IT5 A;  3T4Q A;  4FOF A;  4HJ3 A;  4DJ2 A;  2EA9 A;  1T1A A;  3PYP A;  3K3D A;  2HGV A;  2V0W A;  3OLO A;  4UQI S;  2W1T A;  4ARZ B;  3D3O A;  3FC7 A;  4DMZ A;  2VZW A;  1OTE A;  3E4Q A;  4HH2 A;  2HJE A;  5I5L A;  4DJ3 A;  2W3F A;  2KX6 A;  4GHI A;  3IBR A;  3C30 A;  4MDZ A;  2ZMF A;  1NLY A;  5HDC A;  3HJI A;  4WLA A;  3S7Q A;  1LSV A;  4EXO A;  1VHM A;  4BJP A;  4CLC A;  1G6O A;  1VB6 A;  2ZBB A;  3A0R A;  3W2Z A;  4PAU A;  2QKP A;  1XJ2 A;  2VJW A;  1TD5 A;  3ICY A;  4F3L A;  2GZA A;  5C5K A;  4HP4 A;  2PD8 A;  4CLC B;  4LLO B;  3LIB A;  1F9I A;  3UB8 A;  2O9A A;  4L9G A;  3PBT A;  3VE4 A;  2B02 A;  4F3L B;  5HWT A;  4Z1W A;  4KUK A;  2EWV A;  4K08 A;  1D7E A;  2XA7 M;  3H82 A;  2PR6 A;  4HP9 A;  2K31 A;  1XFN A;  3NJA A;  2V1A A;  2A2L A;  3EQU A;  3F1P B;  5FL3 A;  4GW9 A;  3IS2 A;  1TS0 A;  1XJ4 A;  3P01 A;  2J80 A;  4B93 A;  3ZYT A;  1YAX A;  3GDI A;  2MJ6 A;  2VV7 A;  2VGL M;  4MCW A;  3S7N A;  3OBF A;  3BQ8 A;  2FH5 A;  3EGX C;  2VV6 A;  1LL8 A;  2QWS A;  4EW7 A;  4BBT A;  5IU1 A;  2VX8 A;  5TJJ A;  3CIT A;  2JKT M;  1S4S A;  3CUE A;  2VEA A;  4BMW A;  1T18 A;  1UGU A;  4I3A A;  4G3V A;  3E4P A;  1NWZ A;  5F6A A;  3LIA A;  1OT6 A;  2YKH A;  1V9Z A;  4PKY A;  5K5B A;  4UQI M;  2OOL A;  4I39 A;  3E0Y A;  1T1C A;  1H8M A;  2K2N A;  2XA7 S;  2PHY A;  3MR0 A;  5DKL A;  3CLO A;  3JVV A;  5HWW A;  5G4Z A;  4KQO A;  3UE6 A;  3T4K A;  2I9V A;  3HCY A;  1N9L A;  2GX5 A;  1OTA A;  2P7J A;  2VGL S;  3BQA A;  3PBS A;  4EEU A;  2PD7 A;  3EQV A;  5F68 A;  3H9W A;  2O0Y A;  3OCN A;  2O9C A;  4LRZ E;  1GSW A;  5HL6 A;  1OTD A;  3K2N A;  3OC2 A;  2W0N A;  4AFI A;  3R4K A;  5J7E A;  3EWK A;  4ARZ A;  2Z6D A;  5DKK A;  1P9W A;  3KX0 X;  1ZTU A;  3VOL A;  3F1N B;  5HPF A;  2B18 A;  3PBN A;  4HY8 A;  1S4R A;  3LID A;  3FG8 A;  3RFB A;  3A0S A;  1JNU A;  3BJN A;  1DRM A;  3CI6 A;  5HSQ A;  1ZHH B;  3T4S A;  2HV1 A;  3UME A;  3S7O A;  2V0U A;  5G4Y A;  3CUE C;  3IBJ A;  3A0V A;  3LR4 A;  4O8G A;  4PKY G;  2VV8 A;  3KSG A;  1NRJ A;  3CWF A;  4IUK A;  3JVU A;  3RTY A;  1TS6 A;  1XFQ A;  2L0W A;  4IJG A;  3BY9 A;  4CLC E;  1T1B A;  4WF0 A;  1LSW A;  2IA2 A;  2M7V A;  3T50 A;  1OJ5 A;  2OWH A;  5AVF A;  1X0O A;  5HPI A;  3B33 A;  3PHY A;  3B42 A;  4GS9 B;  4II7 A;  3F1P A;  4CQH A;  5KIZ A;  3VV4 A;  3UE3 A;  2A24 A;  2DMW A;  3EGD C;  5TBM B;  2WKR A;  2OWJ A;  4I3I A;  2W3E A;  2PYR A;  3MXQ A;  4GLQ A;  2ZOI A;  1XJ6 A;  5CX7 A;  2HF6 A;  3O5Y A;  3OCL A;  1UWP X;  2J3T C;  3T4O A;  3NOT C;  2JHE A;  2D02 A;  2GNX A;  3B47 A;  2A24 B;  2HJ9 C;  2QJ5 A;  3BW6 A;  4IHQ A;  1YSP A;  2VA0 A;  2VKS A;  1OPX A;  5HD3 A;  2GJ3 A;  1KOU A;  4NKP A;  4XT2 B;  4KUO A;  1N9N A;  4EER A;  1TS7 A;  3OOV A;  5A8B A;  4YWZ A;  3H7W A;  3PBQ A;  4JGO A;  1GSX A;  3S7P A;  5HDS A;  2W1R A;  3LR0 A;  3BWL A;  3TRC A;  3TW8 A;  5KSH A;  1TF1 A;  1F98 A;  4ME4 A;  4MN7 A;  3LI8 A;  5DFX A;  4RQ9 A;  3H7W B;  3U2A A;  4NXG A;  3KYQ A;  4FSF A;  3C38 A;  3LIC A;  5F69 A;  4HOI A;  4MN5 A;  3EEH A;  3MFX A;  5AJG A;  3PBR A;  4R38 A;  3BY8 A;  2JKR I;  3MQQ A;  1IFQ A;  4PHT A;  5L8M A;  4GCZ A;  4Y2F A;  4LRX C;  4EU0 A;  2BAS A;  3KSF A;  2WKQ A;  3LI9 A;  4EET B;  2JKR M;  4KQD A;  4ZRR A;  3KSH A;  2L1M A;  2KLI A;  4HIA A;  4WN5 A;  2XRO A;  4WEK A;  5HDD A;  5LBR A;  3MJQ A;  3F1N A;  4IUH A;  2M7U A;  5J3W A;  4H6J B;  3HJK A;  4Y3I A;  1UWN X;  1S66 L;  4CLC D;  2L4R A;  4Q0J A;  2PR5 A;  2ZOH A;  4I38 A;  5HD5 A;  4NXE A;  3E4O A;  3V67 A;  3LIE A;  3UB6 A;  4HJ6 A;  4HJ4 A;  4HHD A;  1OTB A;  2WKP A;  5DFY A;  5MC7 A;  4BWI A;  3T4L A;  2W27 A;  2PDR A;  2Y79 A;  1YSQ A;  2JN7 A;  3C2W A;  2YKF A;  3LIF A;  1T19 A;  3D72 A;  1XJ3 A;  4R3A A;  5DJT A;  1OT9 A;  2FZ0 A;  3NOU C;  3DBA A;  3UB9 A;  4L9E A;  5HWV A;  3LR3 A;  4WL9 A;  2W3G A;  4GS9 A;  2G7U A;  1S67 L;  3R7W B;  2W3D A;  4EEP A;  5TBM A;  1LT0 A;  2K7S A;  4YOF A;  1P0Z A;  4JGP A;  3MF0 A;  3LFV A;  2W1T B;  3E98 A;  3PBO A;  4O0P A;  1P97 A;  1OJG A;  4GHI B;  4MMN A;  1W63 M;  2P08 A;  4B9O A;  2LB9 A;  5DJU A;  4JGR A;  4OOM A;  2PT7 A;  2W3H A;  3UMD A;  2R78 A;  4GJ4 A;  1NLZ A;  2Z6C A;  2Y8H A;  3FPW A;  2J3W A;  4NXB A;  5HZH A;  1IOU A;  2V9A A;  2XSS A;  4XT2 A;  2LB5 A;  3MQO A;  1D06 A;  3FPV A;  4L0L A;  4BBV A;  1S1Y A;  1G28 A;  4LPZ A;  3T4T A;  4R6L A;  5IS1 A;  4P6Z S;  3EOI A;  2D01 A;  1DP9 A;  1Y28 A;  2QJ7 A;  5DF9 A;  4G3W A;  1OTI A;  3G6O A;  4HI4 A;  4NXF A;  4UEY A;  4L9F A;  4WUJ A;  4M4X A;  2OAP 1;  5J4E A;  2KDK A;  2VLG A;  4I5S A;  1DP6 A;  4YNR A;  3VE3 A;  1S1Z A;  4HQA A;  4LRY C;  2XRN A;  4R70 A;  3H82 B;  3T4J A;  3SW1 A;  3CAX A;  4G3K A;  3ULF A;  3F1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...