2A24B

Haddock structure of hif-2a/arnt pas-b heterodimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
CQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endothelial PAS domain protein 1
publication title Structural basis of ARNT PAS-B dimerization: use of a common beta-sheet interface for hetero- and homodimerization.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2a24B01
3NHQA 1OTAA 1TS0A 5DJTA 1LSVA 4I3JA 4NXBA 2PHYA 1D7EA 2WKPA 1TS6A 3E4PA 1N9LA 4M4XA 1UWPX 2OWHA 4HH3A 1S1YA 1S1ZA 3NOTC 1LSXA 4MN6A 4H6JA 4HOIA 1DRMA 2ZOIA 2KX6A 2K7SA 4K08A 3ZQ5A 1DP9A 2QKPA 1S4RA 3G6OA 4R6LA 3D72A 2YKFA 2PYRA 3LIEA 3NOUC 4L9EA 5J7EA 1X0OA 1MZUA 4R3AA 2GJ3A 3B33A 3P7NA 4HJ6A 3IBRA 4EERA 4HP4A 4HP9A 4LRXC 4HIAA 4DJ2A 2V0WA 3UB7A 3E4QA 2A24B 2I9VA 4HNBA 1D06A 1T18A 3LUQA 3PYPA 1OTDA 4GHIB 3FC7A 1OTIA 2V1AA 4LRZE 2ZBBA 1XJ4A 2PDRA 5J3WA 4HY8A 4BBVA 5A8BA 4PKYG 1OTEA 3F1OB 2VV8A 4HHDA 3UE6A 1Y28A 2JHEA 3KX0X 3IS2B 3MR0A 4MN5A 2VV7A 2W0NA 1LL8A 3NOPC 1TS8A 2OOLA 4GS9A 3UB8A 3BWLA 2Z6CA 2L0WA 2M1CA 3A0VA 1S67L 3MXQA 5TBMA 3LICA 3MFXA 2V1BA 1LT0A 3EEHA 3MQOA 3SW1A 4EXOA 5G4ZA 5HD3A 4EESA 4BBUA 3CAXA 1T1BA 4KQDA 1XJ6A 5HWWA 4XT2B 3F1PB 5KIZA 3F1NA 5F5YA 3PHYA 2WKQA 5HDCA 4EW7A 1UWNX 1VB6A 1V9YA 4I39A 4JGQA 4RQ9A 3LI9A 4F3LA 4HJ3A 2Z6DA 3UMEA 5HSQA 2PD7A 4WUJA 1OTBA 3A0SA 5HWTA 1ODVA 2L4RA 3ICYA 4HH2A 4HI4A 1GSVA 1GSXA 4H6JB 5DKLA 1XFQA 1XJ2A 2J80A 4NXEA 3K3CA 1N9NA 3LIFA 4I38A 3K3DA 3LYXA 1DP8A 5AVFA 4WN5A 4E04A 4L9GA 1S4SA 2V0UA 4WLAA 5DJUA 2PD8A 3H7WA 1XJ3A 1WA9A 2D01A 3H82B 2H28A 1OJ5A 3A0RA 3UB6A 3IS2A 3CWFA 2ZOHA 1F9IA 2CMNA 4GW9A 5IU1A 2R78A 1DP6A 2BASA 2L1MA 4I5SA 1UGUA 3H9WA 1P97A 3UMDA 4WL9A 2PYPA 1OT6A 1NWZA 4EEPA 1F98A 4XT2A 3VE3A 4I3AA 3MJQA 1OJGA 2PR6A 3T50A 1TS7A 1KOUA 4EQ1A 3NJAA 3VOLA 5TBMB 2VEAA 4BBTA 3LI8A 4KUKA 1S66L 1G28A 1LSWA 5HWVA 2YKHA 4L9FA 3OLOA 2QJ7A 3F1NB 4JGOA 5EFWA 4JGPA 4NXFA 2INWA 1N9OA 2B02A 4F3LB 2A24A 3GECA 1OT9A 4DJ3A 3HJIA 1XFNA 3GDIA 4EETB 4EEUA 1GSWA 4WF0A 5AVEA 3E4OA 5J4EA 4GHIA 2D02A 3CLOA 2PR5A 2VLGA 2WKRA 4NXGA 4B9OA 3UB9A 4R38A 5IS1A 2JN7A 5HD5A 3MQQA 3H82A 5DKKA 1EW0A 3F1OA 4PKYA 2HV1A 1JNUA 3LIAA 4HQAA 3RH8B 2QHKA 3VE4A 1T1CA 3LIBA 1V9ZA 3HJKA 5HZHA 4I3IA 1T19A 2P7JA 2VV6A 3BY9A 2QJ5A 4YWZA 5F68A 5I5LA 5F69A 4LLOB 3H7WB 4GCZA 4JGRA 2V9AA 2EA9A 1BYWA 3C8CA 3C2WA 1T1AA 5G4YA 3RTYA 3LIDA 4KUOA 2QWSA 5HDDA 3F1PA 5F6AA 4R70A 1P0ZA 3BY8A 2OWJA 3EWKA 3ULFA 4HJ4A 4LPZA 4GS9B 5HDSA 3FG8A 4LRYC 2KDKA 2W27A
chains in the Genus database with same CATH superfamily
1Q2PA 1OTAA 2P9VB 3G32A 1TS0A 3ZG8B 5DJTA 4BMWA 2HDSA 4GDBA 4OQGA 1LL5A 1ES5A 2PHYA 5FQIA 5EE8A 1N9LA 1VETB 4LGWA 4M4XA 1UWPX 2JKRI 3L7HA 1LSXA 3MFDA 4MN6A 1DRMA 4EWFA 1VQQA 4G3VA 4K08A 3ZQ5A 3TRCA 3ZHHA 4PM6A 2Y2QA 4YFMA 1ZKJA 4HEFA 3D72A 3MMHA 2XEPA 1PFLA 3LIEA 3NOUC 5J7EA 2GJ3A 2V8CA 4MMNA 3IBRA 2ZC5B 4WMCA 4EERA 2LB9A 4HP4A 4Z9QA 4LRXC 4HIAA 1FCOA 4K91A 5L09A 1KGFA 3W4OA 4D60A 4JXVA 2IWDA 2HPBA 2DCFA 4LV2A 3UDFA 4ZRRA 3MKEA 2DRWA 3QP2A 4EBLA 2EX2A 2XH9A 1K55C 1OTIA 1XGIA 2V1AA 3VMAA 3E2LA 1GHIA 3U4LP 3OCNA 2Y2OA 4BBVA 2J9PA 1NRJA 3F1OB 1YSPA 5GLDA 3KSIA 4GD6A 2QZ6A 1FIKA 2JHEA 3IS2B 3MR0A 3NI9A 1MY8A 4MN5A 3ZG9B 1ZG4A 4IJGA 5FI7A 5EVEA 4EUVA 4BJPA 2J3WA 4ZAMA 5E2EA 3UB8A 2ZL1B 4X56A 4FOFA 3G2ZA 1S0WA 3BFEA 2ZC4B 4QPRA 2W1TB 4NETA 3ZG5A 2XGNA 3WRZA 2Z2MB 4BBUA 4KQDA 2B18A 4X68A 4WZ5A 3N4IA 1VEUA 2OLVA 4JGQA 4FH4A 3DW0A 2EWVA 2XR0A 1CEGA 1CK3A 3LI9A 3MKFA 3O87A 1YLPA 4DE2A 5EUAA 5IT5A 2GX5A 1W63Q 5I94A 3CPTB 1ERQA 1DY6A 1ODVA 3LCEA 1H8MA 3MZDA 4HI4A 4HH2A 3LR0A 4LENA 3VOZA 1PI4A 1P9RA 3IQAA 3T1RA 3S7OA 4R4RA 3BEBA 4WEJA 1L0DA 4NXEA 3K3CA 5AQAA 4XUXA 2ZC6B 4OPQA 4E3LA 4E3JA 1ESIA 2XD5A 5DFXA 4R0QA 3HL9A 3SOIA 2G2UA 4QY6A 4WN5A 1W8QA 4NK3A 5FEFA 3T4TA 4PMAA 1H8ZA 3BM6A 1PIOA 5A90A 5CTMA 2DNSA 2ZQCA 3SS5A 4DMZA 4S2IA 1YMXA 4BLMA 3NY4A 4X1MA 2P74A 3C4OA 1WA9A 2D01A 3C30A 2H28A 3CI6A 1OJ5A 3A0RA 2UWXA 3Q7VA 4LV3A 3CWFA 2ZOHA 4BD1A 3P01A 2XRNA 5IU1A 2RL3A 1Z09A 2R78A 3V39A 1QMFA 4HBUA 1KE3A 2ZLYA 2J9OA 2JBFA 2P9VA 3B42A 2FZ0A 1K57A 3LR3A 5CHUA 4KZ4A 2PYPA 3FYZA 1GHMA 2E8IA 1VETA 4WYYA 3HLCA 3RXWA 3MJQA 4IBXA 3B47A 1KOUA 1YPRA 3N8LA 1K25A 4WEKA 1VM1A 5TR7A 4PAUA 1WE4A 4QY5A 2HJEA 5J8XA 2VEAA 4UHUA 3M2JA 2Y2LA 1BLHA 1ES2A 1KVLA 1E3UA 1SCWA 2WADA 3LEQA 3GTCA 1LSWA 3P98A 2YKHA 4L9FA 1YAXA 1RGZA 2QJ7A 3GSGA 1AWIA 4PHTA 2B02A 1NZOA 4OONA 2B5RA 3LO7A 1OT9A 3UPNA 3WS1A 3EQVA 1XFNA 3GDIA 4EEUA 2JCHA 1NYYA 1IKIA 1H5XA 3E4OA 4G3KA 5EM0A 4ARZB 2WAFA 4IVIA 2WKRA 2A49A 5JYOA 1PRQA 1BLCA 4B9OA 2OV5A 4ID4A 2O99A 2Y2JA 4KQRA 4R1GA 3SH9A 1BLSA 1TD5A 3H82A 3HLBA 3Q7ZA 3F1OA 3HLWA 5EVIB 1W7FA 3T4JA 3LIAA 3G4PA 4ZDXA 5FQKA 2Y2MA 4UAAA 5KSHA 1K38A 3AGDA 3ZDJA 1V9ZA 5CECA 5CHJA 1T19A 3VSKA 2ZL1A 2WZZA 3BYDA 2W3EA 1IEMA 4IHQA 5FDSA 3T12B 3KYEA 2WAEA 4GDNA 3PBOA 2XFTA 4HBTA 1PI5A 2O9BA 1SZVA 3SH8A 2EFXA 3LIDA 1EWZA 2Y2HA 2H5SA 3ULFA 5HPFA 4A5RA 2MJ6A 2XLNA 4PM5A 2KDKA 4KZ6A 2ZQDA 4P6ZS 1IELA 3RFBA 2NUTC 4Y0OA 1LSVA 3PBNA 3BFGA 3NDEA 1CJFA 2WKPA 1XKZA 3G30A 4HH3A 5DTSA 5GL9A 4HOIA 1M40A 1K54A 2KOIA 5F1GA 2KX6A 2VX8A 2K7SA 5C5KA 4WZ4A 4PPRA 3MQ0A 1DP9A 2JKGA 2PBYA 2QKPA 4U0XA 1U60A 1S4RA 3PAEA 1LHYA 3I7JA 2JKTM 3A3DA 4KZ7A 2H10A 4JF4A 5EV0A 3UDIA 3FZCA 5GHZA 5A91A 1TVFA 1GCEA 1X0OA 4R3AA 5CGXA 2K31A 1CQAA 3B33A 1QMEA 3P7NA 3HLFA 3CMZA 4L0LA 2FFYA 2J3TD 2PBDP 5EOOA 4OP5A 3O3VA 4JXWA 1TEMA 2I9VA 2P08A 1PZOA 3ITBA 3IF5A 1W79A 5FSRA 3GQZA 4KQQA 3MZEA 1OTDA 4GHIB 2OSUA 1MC0A 4BL3A 3NCKA 4LRZE 1KVMA 1XJ4A 2GNXA 3T4LA 5CGSA 5A8BA 4BENA 4JF6A 4QU3A 3SZTA 3NBLA 2WYXA 2VV8A 2Y2IA 1Y28A 3KX0X 5FI2A 4FUWA 2PRFA 2VV7A 2W0NA 2P04A 2UV0E 1DJCA 3MXSA 3D9YA 2OOLA 4KZ5A 3BWLA 2Z6CA 4WBGA 1JTDA 2M1CA 3G2YA 2M7UA 3MXQA 1I2SA 1ZG6A 5E2GA 1BLPA 3DWKA 3IXHA 3LICA 5L8MA 2HDRA 3SW1A 2HJ9C 1ES4A 4CQHA 1Y4OA 1J3WA 2W3DA 3QP6A 3QHYA 2K2NA 5F5YA 1MWTA 2ZQ9A 3FWLA 3ZVWA 4Y5FA 3OBFA 1IYQA 2Z6DA 5FAPA 2PD7A 4GNUA 4JF5A 4WUJA 4CLCB 3A0SA 2Y55A 4K0WA 4E3MA 3GMWA 1F5MA 2L4RA 1PW8A 5EECA 4ARZA 3EQUA 3JVVA 1GSXA 4H6JB 2VGKA 4RYEA 4XXRA 1LLBA 1XJ2A 3ZVTA 1IFQA 2J80A 1N9NA 1GA0A 4MBHA 3BFDA 5EVIA 2GZAA 4R3JA 4DRTA 3K3DA 3M6BA 2HP6A 1L0GA 5M19A 5FQQA 1L2SA 1FOFA 4CJNA 1IYSA 4N9LA 3PAGA 5KZHA 3CITA 1S4SA 1NY0A 1BZAA 4KG2A 4WLAA 4OPYA 1K4FA 1NXYA 3DTKA 5DJUA 2IWCA 2QYBA 2ZQ8A 3H82B 3HCYA 4Y3IA 4S2KA 3W4PA 1MBLA 2CMNA 4GW9A 4H8RA 3B3XA 2VGJA 3T1QB 2WKIA 2HF6A 3IX4A 4YINA 2W3FA 4I5SA 4R23A 5FDHA 1KGGA 1YQSA 1IYOA 1LI0A 1FR1A 3H9WA 3CUEC 4OP8A 2B95A 3UMDA 4N1XA 5HAPA 5CTNA 3FV7A 1OT6A 4OQHA 2Q9NA 2ZC3B 1F98A 4E3OA 3HUMA 4P6BA 4G3WA 3VP2A 1YLYA 3VE3A 1G6OA 1SKOB 3LY4A 4KZ8A 4X6TA 2PR6A 3EGDC 1TS7A 3S7PA 4PM9A 1RGYA 2VZWA 1FSWA 2XSSA 3IF6B 2O9AA 3IHBA 4C6YA 3OC2A 5HX9A 5FQ9A 1S6RA 1CI8A 1G5UA 1N9BA 4KUKA 1S66L 3WRTA 1DJBA 3IX3A 5E2HA 2V1ZA 1G28A 3N8SA 1YLWA 5HFOA 2VGLS 1K57C 4JGOA 2J3TC 4ZJ1A 3SH7A 1N9OA 3KYZA 3GECA 3IH9A 5EOEA 4DJ3A 1XA1A 1K55A 2R9WA 4S2OA 1JVJA 5AVEA 1G68A 4GHIA 5CHMA 1ONHA 2PR5A 1K56D 4JPMA 3UE1A 2HDUA 4GJ4A 1L0FA 4FTXA 5HPIA 2AVXA 4QD4A 5IS1A 4UA9A 2JN7A 4S2MA 4MNRA 5DKKA 5F1FA 1RP5A 3IHAA 4E6XA 1JNUA 2H0YA 3AGEA 2OLUA 5L10A 3R7WB 1BT5A 2QHKA 4ESPA 4O01A 4FSFA 4M3KA 4GOGA 3TOIA 3HJKA 4RA7A 4OPRA 5CERA 4EUZA 3ZGAB 4DE0A 3BY9A 2J7VA 1K6RA 2W3HA 4LV0A 2QJ5A 4YWZA 3H7WB 4GCZA 2DMWA 3C8CA 4F94A 3FPVA 5G4YA 3N6IA 4WMCD 4RX3A 1NLZA 2QWSA 4S2JA 4KZAA 3SS3A 3IT9A 1OPXA 1PNEA 5F6AA 4R70A 3UY6A 4S2PA 4HJ4A 4E3NA 3JVUA 3BLMA 4Y17A 5CEBA 3M6HA 3FG8A 1PW1A 1ZTUA 5TJJA 4LRYC 2PAVP 3NHQA 4DE3A 3LFVA 3M2KA 3MS6A 1JWZA 4Q0JA 4I3JA 1MWSA 1N4OA 2VK3A 3GVBA 1PYYA 3HLGA 4CLCA 4NXBA 1XP4A 3S7QA 3E4PA 2OWHA 3KSHA 5EM1A 2JE5A 1S1YA 1S1ZA 3NOTC 3T4KA 4X53A 4GD8A 4H6JA 2ZOIA 3CG5A 4B88A 3ZCZA 4C3QA 4IBRA 3WS0A 3TW8A 1C3BA 3OPLA 1CEFA 4R6LA 3W2ZA 2PYRA 4Y7PA 3CJMA 1NLYA 5AQ9A 1HTZA 1LI9A 3U2AA 5MC7A 1GHPA 3ZNYA 4E3IA 4HJ6A 3OPPA 2EWWA 4X55A 3SS4A 4OOMA 4UQIS 4OLDA 2ZQ7A 4HP9A 4IEDA 2E8JA 4DJ2A 3OZHA 1XXMA 3UB7A 3E4QA 4Y0UA 1NYMA 2Y91A 4K0XA 1D06A 1T18A 1K54C 2WGWB 3WS5A 3LUQA 1I2WA 2FH5A 2X71A 3FC7A 4IUHA 1G6AA 4OOLA 2XD1A 2PDRA 2Z2LB 3JYIA 4HY8A 4PKYG 4R4SA 1OTEA 3VFFA 1P9WA 3LR5A 1DJAA 1H8YA 2WKHA 2EX9A 3T4OA 5G18A 3EEAA 4U0TA 1XA7A 1SKOA 1LL8A 4S2LA 2JC7A 3NOPC 2BLSA 1L3LA 2HP5A 1KE0A 4GS9A 1MXOA 3S1YA 3WS2A 3IF6A 5DTKA 3BLSA 2V1BA 4EXOA 5DVAA 3QP8A 1ALQA 1RCJA 1PZPA 3FKVA 1SHVA 4MCWA 1YM1A 3HLEA 1SDEA 1T1BA 1XJ6A 4CLCE 5HWWA 5KIZA 3PHYA 2WKQA 4GKUA 1NRFA 1UWNX 2Y2NA 2X02A 1V9YA 4I39A 4ZJ2A 3Q07A 3HBRA 4HJ3A 3VFHA 1ZC2A 1Z6FA 3ZNTA 3UMEA 4Q8IA 2O9CA 3UDXA 4II7A 4P85A 4WM9A 3ICYA 4BWIA 2XA7M 5FQJA 4ZTKA 5DKLA 4UA6A 5KMWA 1JTGA 4OH0A 2C6WB 3W8KA 3V5MA 2EXBA 5U47A 5FA7A 3LIFA 5GHYA 5AQBA 5FEGA 3R7WA 3OPRA 1DP8A 4Y13A 1HD8A 3TG9A 2XROA 4E04A 3VSLA 4L9GA 5HAIA 4NEED 4DDYA 2O0YA 4N9KA 2JKRM 5K5BA 4KZ9A 3C4PA 3PBRA 1BULA 3H7WA 3IH8A 2OAP1 3UB6A 2G7UA 3E98A 2Y2KA 3GR2A 1F9IA 4P0MA 3IWQA 1W5DA 3Q1FA 1K6SA 1IKGA 5EVIC 1AXBA 1MKIA 4MBKA 1DP6A 2BASA 2JKTI 3NECA 2L1MA 4QJGA 4DF6A 4ZBEA 1UGUA 4RVAA 2OAQ1 4OQ0A 2BG1A 4Y15A 5F83A 1EI5A 1FQGA 4YNRA 4WL9A 5GLAA 3UNWA 3CZDA 3DWZA 2XQZA 1ES3A 3VOYA 4ETZA 4XT2A 2XK1A 5HL1A 2ZMVA 3LEZA 4OLGA 1OJGA 2Q9MA 1K56A 4EQ1A 3TSGA 1M6KA 1XGJA 5DTTA 5TBMB 3BQAA 5M1AA 1XPBA 3O88A 4PM8A 2HP9A 4BBTA 3C5AA 1ONGA 3G31A 4E3KA 3TJZC 3KSGA 3UE0A 5HWVA 4GZBA 3F1NB 1FCNA 5EFWA 4P6ZM 5DF9A 4JGPA 5DF7A 4NXFA 2INWA 2QPNA 1FR6A 2FFFB 3Q82A 4UEYA 3NIAA 4F3LB 3DTIA 3A3IA 3DAVA 3VV4A 4WZ5C 1BSGA 4EBNA 3HJIA 2WGWA 2PU4A 1GSWA 3NDGA 3UO9A 4GB7A 5FAOA 3V50A 4S2NA 2WZXA 3CLOA 1TDLA 4X1LA 2VLGA 1OMEA 4JXSA 3E2KA 4BQMA 4NXGA 5IHVA 3S22A 5FL3A 3VP3A 3UN7A 1E4DA 3EOIA 5JYPA 1EW0A 4PKYA 2HV1A 4N92A 3A3JA 3V67A 1YLJA 4Q0HA 4HQAA 1MPLA 3VE4A 2ZM0A 5FI6A 1T1CA 3LIBA 4I3IA 2P7JA 4KENB 5I5LA 4AFIA 2J8YA 3OOVA 3QP5A 5M18A 3PTEA 2V9AA 2EA9A 1BYWA 5TFQA 2PT7A 2ACGA 3C2WA 3HREA 3NC8A 3P09A 2IWBA 3C38A 3RTYA 3C7VA 4KUOA 4DE1A 3FPWA 3MSHA 4EV4A 1P0ZA 3BY8A 4O8GA 2OWJA 3EWKA 4DDSA 2X01A 5HARA 1FILA 4LPZA 3MZFA 2EX6A 4Q0IA 4E6WA 4N1HA 4GS9B 5DFYA 2HDQA 4KG5A 1PWDA 4DKIA 5L07A 5AJGA 2EFUA 3OCLA 1O7EA 1D1JA 3BQ8A 5A93A 2VA0A 3V3SA 1D7EA 3IXBA 4Y2FA 1TS6A 3KO6A 4B4XA 3DTMA 3L9KA 2Y4AA 4CPKA 2WK0A 3UPPA 3QNBA 2PU2A 3G6OA 4O0PA 2ZQAA 2YKFA 1ACFA 2KLIA 5AQ7A 1KDWA 3PXPA 5BOHA 3K2NA 4L9EA 1MZUA 3LR4A 1JWPA 3TE8A 3BFFA 4U3TA 3S7NA 4CLCC 1H0MA 3O86A 1I5QA 4EU0A 2A2LA 5CGWA 1STZA 2V0WA 2XF3A 2A24B 4HNBA 3QNCA 4ETXA 2XFSA 4KQOA 3PYPA 3CUEA 4C75A 2V20A 5A92A 4LV1A 5FASA 4B93A 4Z1WA 3A3EA 2V2FF 3N7WA 4P87A 2ZBBA 4EBPA 1ESUA 5J3WA 3QP4A 3DBAA 2ZM2A 1L0EA 4HHDA 4UA7A 2HZ5A 2V8FA 3UE6A 1YKDA 2EX8A 3BJNA 5FATA 5EVLA 4OOYA 1TS8A 3PBTA 1ERMA 1YT4A 2L0WA 3E0YA 1WYCA 4HESA 3A0VA 3O5YA 5EVID 1S67L 4LFUA 5TBMA 1WYBA 4Y0TA 3EGXC 3UE3A 4RX2A 1YMSA 4OQIA 3MFXA 2R9XA 3MQOA 1LT0A 3EEHA 4LCLA 4X25A 1W63M 2HGVA 5CXWA 2Q0OA 1KDSA 5G4ZA 5HD3A 4QHCA 4XUZA 3FKWA 3G34A 4EESA 4ZJ3A 1MWUA 3CAXA 2ZM8A 5HL6A 3IWOA 4XT2B 3F1PB 5E2FA 2Y2PA 3F1NA 5LBRA 1YLZA 2GDNA 3A3FA 2Y59A 3IWIA 3T1XA 3CHWP 5HDCA 1HVBA 4EW7A 5FAQA 1VB6A 2XA7S 1BTLA 4RQ9A 1A0KA 4F3LA 3VP4A 1F2KA 1KE4A 5HSQA 4B4ZA 2WUQA 4OPZA 2W3GA 1OTBA 5CX7A 3IBJA 3T4QA 3W4QA 5HWTA 4MEZA 3IF6C 1NJ4A 4X69A 5E43A 3ZG0A 1CF0A 1GSVA 3ZYTA 1SKFA 1MWRA 3RXXA 3PR6A 3RJUA 3HLDA 4OVDA 1XFQA 5L2FA 4WELA 2ZMFA 1K0KA 3R4KA 2VGLM 3GV9A 4I38A 1XX2A 3N8RA 4KG6A 3LGOA 2G2WA 2ZJ9A 3LYXA 1LL9A 5AVFA 2VJWA 1IYPA 2C5WB 2RCXA 3PBSA 2W1RA 4NG2A 4DXBA 1PWCA 3S4XA 5D3OA 2V0UA 5GLCA 3BECA 1TDGA 4DN0A 5F82A 1FSYA 2PD8A 1MKMA 1XJ3A 1GA9A 4FCFA 1HLUP 4R3BA 3V3RA 3IS2A 4MBFA 4JKTA 3BFCA 4GLQA 3WWXA 2BTFP 2IA2A 1KGEA 2NUPC 2Y2GA 5TGFA 3MBZA 3HVFA 3IXGA 1HZOA 5KSCA 4JXGA 3OPHA 4QWOA 4YOFA 2A3UA 1H3QA 1P97A 2W1TA 2EXAA 3D3OA 4O7DA 3WS4A 1YSQA 2WGVA 3HUNA 3T4SA 1YLTA 1NWZA 4EEPA 3QP1A 1CI9A 3PBQA 2QMIA 1BUEA 1E25A 4I3AA 1VHMA 2ZD8A 4KZ3A 3AGFA 3T50A 3MF0A 1JWVA 3IXDA 3NJAA 3VOLA 3VP0A 5HW3A 1PWGA 5GLBA 3ZFZA 3NULA 3BRMA 3LI8A 5FQMA 3CPTA 4KZBA 2M7VA 3G35A 3DTEA 1J9MA 3OLOA 5CRFA 1VEUB 3LY3A 1SDNA 4JBFA 2WGIA 1ZHHB 2VKSA 2I72A 3ZG7B 4DXCA 4D2OA 2A24A 2H0TA 1W8YA 2ZC7A 3ITAA 4IUKA 4EETB 3UB5P 4PM7A 5HAQA 1Y54A 3KSFA 3GRJA 4WF0A 3UPOA 5J4EA 2ZMAA 2D02A 3T1SA 4JLFA 4FD8A 5CEDA 3UB9A 4R38A 4BL2A 3VP1A 5HD5A 3MQQA 4CLCD 4FH2A 1E3UD 1Q2QA 3MXRA 3D4FA 3ISGA 5DF8A 4MN7A 4UQIM 4NKPA 2JKFA 3HUOA 2WKEA 3Q81A 4GN2A 3RH8B 2LB5A 3IX8A 5HZHA 3C7UA 2Y8HA 1IOUA 2VV6A 3JPUA 4MDZA 1O07A 5F68A 4ME4A 4S2NC 4EQIA 4LCMA 5F69A 1TF1A 4LLOB 2CC1A 5GHXA 4JGRA 3BW6A 2XDMA 3Q7VB 4OKPA 4IVKA 1T1AA 2Y79A 5EPHA 1K4EA 5HDDA 4BD0A 3F1PA 1EROA 1FCMA 3KYQA 5HDSA 4MLLA 1NZUA 4QB8A 2W27A
chains in the Genus database with same CATH topology
3NHQA 1OTAA 5AJGA 3LFVA 3OCLA 1TS0A 5DJTA 4P6ZS 4BMWA 3RFBA 2NUTC 4Q0JA 3BQ8A 1LSVA 4I3JA 2VA0A 4CLCA 3PBNA 4NXBA 2PHYA 1D7EA 2WKPA 4Y2FA 1TS6A 3KO6A 3E4PA 1N9LA 4M4XA 3S7QA 1UWPX 2OWHA 2JKRI 3KSHA 4HH3A 1S1YA 1S1ZA 3NOTC 3T4KA 1LSXA 4MN6A 4H6JA 4HOIA 1DRMA 2ZOIA 2KOIA 2KX6A 2VX8A 2K7SA 4G3VA 5C5KA 4K08A 3ZQ5A 3TRCA 3MQ0A 1DP9A 2QKPA 3TW8A 1S4RA 2JKTM 3G6OA 4O0PA 4R6LA 3D72A 2YKFA 3MMHA 3W2ZA 2KLIA 2PYRA 3LIEA 1NLYA 3NOUC 3PXPA 3K2NA 4L9EA 5J7EA 3U2AA 1X0OA 5MC7A 1MZUA 4R3AA 2GJ3A 2K31A 3B33A 3LR4A 3P7NA 4HJ6A 4MMNA 2EWWA 3IBRA 4EERA 3TE8A 2LB9A 4CLCC 3S7NA 4OOMA 4UQIS 4L0LA 4HP4A 2J3TD 4EU0A 2A2LA 4HP9A 4LRXC 4HIAA 4DJ2A 1STZA 2V0WA 3UB7A 3E4QA 2A24B 2I9VA 2P08A 4HNBA 1D06A 1T18A 4ETXA 3LUQA 2FH5A 3PYPA 4KQOA 3CUEA 1OTDA 4GHIB 4ZRRA 3FC7A 4IUHA 4B93A 1MC0A 4Z1WA 1OTIA 2V1AA 4LRZE 4OOLA 2ZBBA 1XJ4A 2GNXA 2PDRA 3T4LA 3OCNA 5J3WA 4HY8A 4BBVA 3DBAA 5A8BA 4PKYG 1NRJA 1OTEA 3F1OB 2VV8A 1YSPA 1P9WA 3LR5A 4HHDA 3KSIA 3UE6A 1Y28A 3T4OA 2JHEA 3KX0X 3IS2B 1YKDA 3MR0A 4MN5A 3BJNA 3EEAA 4IJGA 2VV7A 2W0NA 2P04A 1LL8A 4EUVA 4BJPA 3NOPC 1TS8A 2J3WA 2OOLA 4GS9A 3PBTA 3UB8A 3BWLA 2Z6CA 2L0WA 3E0YA 2M1CA 2M7UA 3A0VA 3O5YA 1S67L 3MXQA 5TBMA 3EGXC 3UE3A 4FOFA 3LICA 3MFXA 4QPRA 5L8MA 2V1BA 1LT0A 2W1TB 3EEHA 3MQOA 3SW1A 4EXOA 1W63M 2HGVA 2HJ9C 5G4ZA 4CQHA 5HD3A 4EESA 4BBUA 3CAXA 4MCWA 2W3DA 5HL6A 1T1BA 4KQDA 1XJ6A 4CLCE 4XT2B 5HWWA 2B18A 3F1PB 5KIZA 3F1NA 2K2NA 5F5YA 5LBRA 3PHYA 2WKQA 5HDCA 4EW7A 1UWNX 1VB6A 1V9YA 2XA7S 4I39A 3OBFA 4Y5FA 4JGQA 2EWVA 4RQ9A 3LI9A 4F3LA 4HJ3A 2Z6DA 5IT5A 3UMEA 5HSQA 2O9CA 2PD7A 4WUJA 4CLCB 2GX5A 1OTBA 2W3GA 5CX7A 3A0SA 1W63Q 3IBJA 4II7A 3T4QA 5HWTA 1ODVA 1F5MA 2L4RA 3ICYA 1H8MA 4HI4A 4HH2A 4BWIA 3LR0A 2XA7M 1GSVA 3ZYTA 4ARZA 1P9RA 3EQUA 3S7OA 3JVVA 1GSXA 4H6JB 3PR6A 4WEJA 5DKLA 1XFQA 1XJ2A 4WELA 2ZMFA 1IFQA 2J80A 4NXEA 3K3CA 3R4KA 1N9NA 2VGLM 3LIFA 2GZAA 4I38A 3K3DA 5DFXA 3R7WA 3LYXA 1DP8A 5AVFA 2VJWA 4WN5A 2XROA 3PBSA 2W1RA 4E04A 3T4TA 4L9GA 3CITA 1S4SA 2V0UA 4NEED 2O0YA 4DMZA 4DN0A 4WLAA 2JKRM 5K5BA 5DJUA 3PBRA 2PD8A 3H7WA 1MKMA 1WA9A 1XJ3A 2QYBA 2D01A 3C30A 3H82B 2H28A 3CI6A 1OJ5A 3A0RA 3HCYA 4Y3IA 2OAP1 3UB6A 2G7UA 3CWFA 3IS2A 3E98A 2ZOHA 1F9IA 2CMNA 4GW9A 3P01A 2XRNA 4GLQA 5IU1A 2IA2A 2R78A 2NUPC 1DP6A 2BASA 2JKTI 2HF6A 2L1MA 2W3FA 4I5SA 1UGUA 4YOFA 2OAQ1 3H9WA 3CUEC 1H3QA 1P97A 2W1TA 3B42A 2FZ0A 3D3OA 4YNRA 3UMDA 4WL9A 3LR3A 1YSQA 2PYPA 1OT6A 3T4SA 1NWZA 4EEPA 1F98A 3PBQA 4ETZA 4G3WA 4XT2A 3VE3A 1G6OA 4I3AA 1VHMA 2ZMVA 3MJQA 1OJGA 2PR6A 3EGDC 3T50A 1TS7A 3B47A 1KOUA 3MF0A 3S7PA 4EQ1A 4WEKA 3NJAA 2VZWA 4PAUA 3VOLA 5TBMB 2HJEA 2XSSA 3BQAA 2VEAA 2O9AA 3OC2A 4BBTA 3LI8A 4KUKA 3TJZC 1S66L 3KSGA 2M7VA 1G28A 1LSWA 5HWVA 2YKHA 2VGLS 4L9FA 1YAXA 3OLOA 2QJ7A 3F1NB 4JGOA 5EFWA 2J3TC 4P6ZM 4PHTA 5DF9A 4JGPA 4NXFA 2INWA 1N9OA 2B02A 1ZHHB 2VKSA 3KYZA 4UEYA 4F3LB 2A24A 3GECA 3VV4A 1OT9A 4DJ3A 3HJIA 3EQVA 1XFNA 3GDIA 4IUKA 4EETB 4EEUA 1GSWA 3KSFA 4WF0A 5AVEA 3E4OA 5J4EA 4G3KA 4GHIA 2D02A 4ARZB 3CLOA 2PR5A 2VLGA 2WKRA 4NXGA 4B9OA 4GJ4A 2O99A 3UB9A 5HPIA 4R38A 5FL3A 5IS1A 2JN7A 5HD5A 3MQQA 1TD5A 4CLCD 3H82A 3EOIA 5DKKA 1EW0A 3F1OA 4PKYA 2HV1A 1JNUA 3LIAA 3T4JA 3V67A 4MN7A 4Q0HA 4UQIM 4HQAA 5KSHA 4NKPA 3R7WB 3RH8B 2QHKA 3VE4A 4O01A 4FSFA 1T1CA 3LIBA 1V9ZA 2LB5A 3HJKA 5HZHA 4I3IA 1T19A 2P7JA 2VV6A 2Y8HA 2W3HA 3BY9A 1IOUA 4MDZA 2QJ5A 4YWZA 5F68A 2W3EA 4IHQA 4ME4A 5I5LA 4AFIA 5F69A 1TF1A 3OOVA 4LLOB 3H7WB 4GCZA 4JGRA 3PBOA 3BW6A 2V9AA 2DMWA 2EA9A 1BYWA 3C8CA 2O9BA 2PT7A 3C2WA 1T1AA 2Y79A 3C38A 3FPVA 5G4YA 3RTYA 3LIDA 4KUOA 1NLZA 2QWSA 5HDDA 3FPWA 1OPXA 3F1PA 5F6AA 4R70A 1P0ZA 3BY8A 4O8GA 2OWJA 3EWKA 3ULFA 4HJ4A 5HPFA 4LPZA 3JVUA 4Q0IA 3KYQA 4GS9B 5DFYA 5HDSA 2MJ6A 3FG8A 1ZTUA 5TJJA 4LRYC 2KDKA 2W27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHQ A;  1OTA A;  1TS0 A;  5DJT A;  1LSV A;  4I3J A;  4NXB A;  2PHY A;  1D7E A;  2WKP A;  1TS6 A;  3E4P A;  1N9L A;  4M4X A;  1UWP X;  2OWH A;  4HH3 A;  1S1Y A;  1S1Z A;  3NOT C;  1LSX A;  4MN6 A;  4H6J A;  4HOI A;  1DRM A;  2ZOI A;  2KX6 A;  2K7S A;  4K08 A;  3ZQ5 A;  1DP9 A;  2QKP A;  1S4R A;  3G6O A;  4R6L A;  3D72 A;  2YKF A;  2PYR A;  3LIE A;  3NOU C;  4L9E A;  5J7E A;  1X0O A;  1MZU A;  4R3A A;  2GJ3 A;  3B33 A;  3P7N A;  4HJ6 A;  3IBR A;  4EER A;  4HP4 A;  4HP9 A;  4LRX C;  4HIA A;  4DJ2 A;  2V0W A;  3UB7 A;  3E4Q A;  2A24 B;  2I9V A;  4HNB A;  1D06 A;  1T18 A;  3LUQ A;  3PYP A;  1OTD A;  4GHI B;  3FC7 A;  1OTI A;  2V1A A;  4LRZ E;  2ZBB A;  1XJ4 A;  2PDR A;  5J3W A;  4HY8 A;  4BBV A;  5A8B A;  4PKY G;  1OTE A;  3F1O B;  2VV8 A;  4HHD A;  3UE6 A;  1Y28 A;  2JHE A;  3KX0 X;  3IS2 B;  3MR0 A;  4MN5 A;  2VV7 A;  2W0N A;  1LL8 A;  3NOP C;  1TS8 A;  2OOL A;  4GS9 A;  3UB8 A;  3BWL A;  2Z6C A;  2L0W A;  2M1C A;  3A0V A;  1S67 L;  3MXQ A;  5TBM A;  3LIC A;  3MFX A;  2V1B A;  1LT0 A;  3EEH A;  3MQO A;  3SW1 A;  4EXO A;  5G4Z A;  5HD3 A;  4EES A;  4BBU A;  3CAX A;  1T1B A;  4KQD A;  1XJ6 A;  5HWW A;  4XT2 B;  3F1P B;  5KIZ A;  3F1N A;  5F5Y A;  3PHY A;  2WKQ A;  5HDC A;  4EW7 A;  1UWN X;  1VB6 A;  1V9Y A;  4I39 A;  4JGQ A;  4RQ9 A;  3LI9 A;  4F3L A;  4HJ3 A;  2Z6D A;  3UME A;  5HSQ A;  2PD7 A;  4WUJ A;  1OTB A;  3A0S A;  5HWT A;  1ODV A;  2L4R A;  3ICY A;  4HH2 A;  4HI4 A;  1GSV A;  1GSX A;  4H6J B;  5DKL A;  1XFQ A;  1XJ2 A;  2J80 A;  4NXE A;  3K3C A;  1N9N A;  3LIF A;  4I38 A;  3K3D A;  3LYX A;  1DP8 A;  5AVF A;  4WN5 A;  4E04 A;  4L9G A;  1S4S A;  2V0U A;  4WLA A;  5DJU A;  2PD8 A;  3H7W A;  1XJ3 A;  1WA9 A;  2D01 A;  3H82 B;  2H28 A;  1OJ5 A;  3A0R A;  3UB6 A;  3IS2 A;  3CWF A;  2ZOH A;  1F9I A;  2CMN A;  4GW9 A;  5IU1 A;  2R78 A;  1DP6 A;  2BAS A;  2L1M A;  4I5S A;  1UGU A;  3H9W A;  1P97 A;  3UMD A;  4WL9 A;  2PYP A;  1OT6 A;  1NWZ A;  4EEP A;  1F98 A;  4XT2 A;  3VE3 A;  4I3A A;  3MJQ A;  1OJG A;  2PR6 A;  3T50 A;  1TS7 A;  1KOU A;  4EQ1 A;  3NJA A;  3VOL A;  5TBM B;  2VEA A;  4BBT A;  3LI8 A;  4KUK A;  1S66 L;  1G28 A;  1LSW A;  5HWV A;  2YKH A;  4L9F A;  3OLO A;  2QJ7 A;  3F1N B;  4JGO A;  5EFW A;  4JGP A;  4NXF A;  2INW A;  1N9O A;  2B02 A;  4F3L B;  2A24 A;  3GEC A;  1OT9 A;  4DJ3 A;  3HJI A;  1XFN A;  3GDI A;  4EET B;  4EEU A;  1GSW A;  4WF0 A;  5AVE A;  3E4O A;  5J4E A;  4GHI A;  2D02 A;  3CLO A;  2PR5 A;  2VLG A;  2WKR A;  4NXG A;  4B9O A;  3UB9 A;  4R38 A;  5IS1 A;  2JN7 A;  5HD5 A;  3MQQ A;  3H82 A;  5DKK A;  1EW0 A;  3F1O A;  4PKY A;  2HV1 A;  1JNU A;  3LIA A;  4HQA A;  3RH8 B;  2QHK A;  3VE4 A;  1T1C A;  3LIB A;  1V9Z A;  3HJK A;  5HZH A;  4I3I A;  1T19 A;  2P7J A;  2VV6 A;  3BY9 A;  2QJ5 A;  4YWZ A;  5F68 A;  5I5L A;  5F69 A;  4LLO B;  3H7W B;  4GCZ A;  4JGR A;  2V9A A;  2EA9 A;  1BYW A;  3C8C A;  3C2W A;  1T1A A;  5G4Y A;  3RTY A;  3LID A;  4KUO A;  2QWS A;  5HDD A;  3F1P A;  5F6A A;  4R70 A;  1P0Z A;  3BY8 A;  2OWJ A;  3EWK A;  3ULF A;  4HJ4 A;  4LPZ A;  4GS9 B;  5HDS A;  3FG8 A;  4LRY C;  2KDK A;  2W27 A; 
#chains in the Genus database with same CATH topology
 1Q2P A;  1OTA A;  2P9V B;  3G32 A;  1TS0 A;  3ZG8 B;  5DJT A;  4BMW A;  2HDS A;  4GDB A;  4OQG A;  1LL5 A;  1ES5 A;  2PHY A;  5FQI A;  5EE8 A;  1N9L A;  1VET B;  4LGW A;  4M4X A;  1UWP X;  2JKR I;  3L7H A;  1LSX A;  3MFD A;  4MN6 A;  1DRM A;  4EWF A;  1VQQ A;  4G3V A;  4K08 A;  3ZQ5 A;  3TRC A;  3ZHH A;  4PM6 A;  2Y2Q A;  4YFM A;  1ZKJ A;  4HEF A;  3D72 A;  3MMH A;  2XEP A;  1PFL A;  3LIE A;  3NOU C;  5J7E A;  2GJ3 A;  2V8C A;  4MMN A;  3IBR A;  2ZC5 B;  4WMC A;  4EER A;  2LB9 A;  4HP4 A;  4Z9Q A;  4LRX C;  4HIA A;  1FCO A;  4K91 A;  5L09 A;  1KGF A;  3W4O A;  4D60 A;  4JXV A;  2IWD A;  2HPB A;  2DCF A;  4LV2 A;  3UDF A;  4ZRR A;  3MKE A;  2DRW A;  3QP2 A;  4EBL A;  2EX2 A;  2XH9 A;  1K55 C;  1OTI A;  1XGI A;  2V1A A;  3VMA A;  3E2L A;  1GHI A;  3U4L P;  3OCN A;  2Y2O A;  4BBV A;  2J9P A;  1NRJ A;  3F1O B;  1YSP A;  5GLD A;  3KSI A;  4GD6 A;  2QZ6 A;  1FIK A;  2JHE A;  3IS2 B;  3MR0 A;  3NI9 A;  1MY8 A;  4MN5 A;  3ZG9 B;  1ZG4 A;  4IJG A;  5FI7 A;  5EVE A;  4EUV A;  4BJP A;  2J3W A;  4ZAM A;  5E2E A;  3UB8 A;  2ZL1 B;  4X56 A;  4FOF A;  3G2Z A;  1S0W A;  3BFE A;  2ZC4 B;  4QPR A;  2W1T B;  4NET A;  3ZG5 A;  2XGN A;  3WRZ A;  2Z2M B;  4BBU A;  4KQD A;  2B18 A;  4X68 A;  4WZ5 A;  3N4I A;  1VEU A;  2OLV A;  4JGQ A;  4FH4 A;  3DW0 A;  2EWV A;  2XR0 A;  1CEG A;  1CK3 A;  3LI9 A;  3MKF A;  3O87 A;  1YLP A;  4DE2 A;  5EUA A;  5IT5 A;  2GX5 A;  1W63 Q;  5I94 A;  3CPT B;  1ERQ A;  1DY6 A;  1ODV A;  3LCE A;  1H8M A;  3MZD A;  4HI4 A;  4HH2 A;  3LR0 A;  4LEN A;  3VOZ A;  1PI4 A;  1P9R A;  3IQA A;  3T1R A;  3S7O A;  4R4R A;  3BEB A;  4WEJ A;  1L0D A;  4NXE A;  3K3C A;  5AQA A;  4XUX A;  2ZC6 B;  4OPQ A;  4E3L A;  4E3J A;  1ESI A;  2XD5 A;  5DFX A;  4R0Q A;  3HL9 A;  3SOI A;  2G2U A;  4QY6 A;  4WN5 A;  1W8Q A;  4NK3 A;  5FEF A;  3T4T A;  4PMA A;  1H8Z A;  3BM6 A;  1PIO A;  5A90 A;  5CTM A;  2DNS A;  2ZQC A;  3SS5 A;  4DMZ A;  4S2I A;  1YMX A;  4BLM A;  3NY4 A;  4X1M A;  2P74 A;  3C4O A;  1WA9 A;  2D01 A;  3C30 A;  2H28 A;  3CI6 A;  1OJ5 A;  3A0R A;  2UWX A;  3Q7V A;  4LV3 A;  3CWF A;  2ZOH A;  4BD1 A;  3P01 A;  2XRN A;  5IU1 A;  2RL3 A;  1Z09 A;  2R78 A;  3V39 A;  1QMF A;  4HBU A;  1KE3 A;  2ZLY A;  2J9O A;  2JBF A;  2P9V A;  3B42 A;  2FZ0 A;  1K57 A;  3LR3 A;  5CHU A;  4KZ4 A;  2PYP A;  3FYZ A;  1GHM A;  2E8I A;  1VET A;  4WYY A;  3HLC A;  3RXW A;  3MJQ A;  4IBX A;  3B47 A;  1KOU A;  1YPR A;  3N8L A;  1K25 A;  4WEK A;  1VM1 A;  5TR7 A;  4PAU A;  1WE4 A;  4QY5 A;  2HJE A;  5J8X A;  2VEA A;  4UHU A;  3M2J A;  2Y2L A;  1BLH A;  1ES2 A;  1KVL A;  1E3U A;  1SCW A;  2WAD A;  3LEQ A;  3GTC A;  1LSW A;  3P98 A;  2YKH A;  4L9F A;  1YAX A;  1RGZ A;  2QJ7 A;  3GSG A;  1AWI A;  4PHT A;  2B02 A;  1NZO A;  4OON A;  2B5R A;  3LO7 A;  1OT9 A;  3UPN A;  3WS1 A;  3EQV A;  1XFN A;  3GDI A;  4EEU A;  2JCH A;  1NYY A;  1IKI A;  1H5X A;  3E4O A;  4G3K A;  5EM0 A;  4ARZ B;  2WAF A;  4IVI A;  2WKR A;  2A49 A;  5JYO A;  1PRQ A;  1BLC A;  4B9O A;  2OV5 A;  4ID4 A;  2O99 A;  2Y2J A;  4KQR A;  4R1G A;  3SH9 A;  1BLS A;  1TD5 A;  3H82 A;  3HLB A;  3Q7Z A;  3F1O A;  3HLW A;  5EVI B;  1W7F A;  3T4J A;  3LIA A;  3G4P A;  4ZDX A;  5FQK A;  2Y2M A;  4UAA A;  5KSH A;  1K38 A;  3AGD A;  3ZDJ A;  1V9Z A;  5CEC A;  5CHJ A;  1T19 A;  3VSK A;  2ZL1 A;  2WZZ A;  3BYD A;  2W3E A;  1IEM A;  4IHQ A;  5FDS A;  3T12 B;  3KYE A;  2WAE A;  4GDN A;  3PBO A;  2XFT A;  4HBT A;  1PI5 A;  2O9B A;  1SZV A;  3SH8 A;  2EFX A;  3LID A;  1EWZ A;  2Y2H A;  2H5S A;  3ULF A;  5HPF A;  4A5R A;  2MJ6 A;  2XLN A;  4PM5 A;  2KDK A;  4KZ6 A;  2ZQD A;  4P6Z S;  1IEL A;  3RFB A;  2NUT C;  4Y0O A;  1LSV A;  3PBN A;  3BFG A;  3NDE A;  1CJF A;  2WKP A;  1XKZ A;  3G30 A;  4HH3 A;  5DTS A;  5GL9 A;  4HOI A;  1M40 A;  1K54 A;  2KOI A;  5F1G A;  2KX6 A;  2VX8 A;  2K7S A;  5C5K A;  4WZ4 A;  4PPR A;  3MQ0 A;  1DP9 A;  2JKG A;  2PBY A;  2QKP A;  4U0X A;  1U60 A;  1S4R A;  3PAE A;  1LHY A;  3I7J A;  2JKT M;  3A3D A;  4KZ7 A;  2H10 A;  4JF4 A;  5EV0 A;  3UDI A;  3FZC A;  5GHZ A;  5A91 A;  1TVF A;  1GCE A;  1X0O A;  4R3A A;  5CGX A;  2K31 A;  1CQA A;  3B33 A;  1QME A;  3P7N A;  3HLF A;  3CMZ A;  4L0L A;  2FFY A;  2J3T D;  2PBD P;  5EOO A;  4OP5 A;  3O3V A;  4JXW A;  1TEM A;  2I9V A;  2P08 A;  1PZO A;  3ITB A;  3IF5 A;  1W79 A;  5FSR A;  3GQZ A;  4KQQ A;  3MZE A;  1OTD A;  4GHI B;  2OSU A;  1MC0 A;  4BL3 A;  3NCK A;  4LRZ E;  1KVM A;  1XJ4 A;  2GNX A;  3T4L A;  5CGS A;  5A8B A;  4BEN A;  4JF6 A;  4QU3 A;  3SZT A;  3NBL A;  2WYX A;  2VV8 A;  2Y2I A;  1Y28 A;  3KX0 X;  5FI2 A;  4FUW A;  2PRF A;  2VV7 A;  2W0N A;  2P04 A;  2UV0 E;  1DJC A;  3MXS A;  3D9Y A;  2OOL A;  4KZ5 A;  3BWL A;  2Z6C A;  4WBG A;  1JTD A;  2M1C A;  3G2Y A;  2M7U A;  3MXQ A;  1I2S A;  1ZG6 A;  5E2G A;  1BLP A;  3DWK A;  3IXH A;  3LIC A;  5L8M A;  2HDR A;  3SW1 A;  2HJ9 C;  1ES4 A;  4CQH A;  1Y4O A;  1J3W A;  2W3D A;  3QP6 A;  3QHY A;  2K2N A;  5F5Y A;  1MWT A;  2ZQ9 A;  3FWL A;  3ZVW A;  4Y5F A;  3OBF A;  1IYQ A;  2Z6D A;  5FAP A;  2PD7 A;  4GNU A;  4JF5 A;  4WUJ A;  4CLC B;  3A0S A;  2Y55 A;  4K0W A;  4E3M A;  3GMW A;  1F5M A;  2L4R A;  1PW8 A;  5EEC A;  4ARZ A;  3EQU A;  3JVV A;  1GSX A;  4H6J B;  2VGK A;  4RYE A;  4XXR A;  1LLB A;  1XJ2 A;  3ZVT A;  1IFQ A;  2J80 A;  1N9N A;  1GA0 A;  4MBH A;  3BFD A;  5EVI A;  2GZA A;  4R3J A;  4DRT A;  3K3D A;  3M6B A;  2HP6 A;  1L0G A;  5M19 A;  5FQQ A;  1L2S A;  1FOF A;  4CJN A;  1IYS A;  4N9L A;  3PAG A;  5KZH A;  3CIT A;  1S4S A;  1NY0 A;  1BZA A;  4KG2 A;  4WLA A;  4OPY A;  1K4F A;  1NXY A;  3DTK A;  5DJU A;  2IWC A;  2QYB A;  2ZQ8 A;  3H82 B;  3HCY A;  4Y3I A;  4S2K A;  3W4P A;  1MBL A;  2CMN A;  4GW9 A;  4H8R A;  3B3X A;  2VGJ A;  3T1Q B;  2WKI A;  2HF6 A;  3IX4 A;  4YIN A;  2W3F A;  4I5S A;  4R23 A;  5FDH A;  1KGG A;  1YQS A;  1IYO A;  1LI0 A;  1FR1 A;  3H9W A;  3CUE C;  4OP8 A;  2B95 A;  3UMD A;  4N1X A;  5HAP A;  5CTN A;  3FV7 A;  1OT6 A;  4OQH A;  2Q9N A;  2ZC3 B;  1F98 A;  4E3O A;  3HUM A;  4P6B A;  4G3W A;  3VP2 A;  1YLY A;  3VE3 A;  1G6O A;  1SKO B;  3LY4 A;  4KZ8 A;  4X6T A;  2PR6 A;  3EGD C;  1TS7 A;  3S7P A;  4PM9 A;  1RGY A;  2VZW A;  1FSW A;  2XSS A;  3IF6 B;  2O9A A;  3IHB A;  4C6Y A;  3OC2 A;  5HX9 A;  5FQ9 A;  1S6R A;  1CI8 A;  1G5U A;  1N9B A;  4KUK A;  1S66 L;  3WRT A;  1DJB A;  3IX3 A;  5E2H A;  2V1Z A;  1G28 A;  3N8S A;  1YLW A;  5HFO A;  2VGL S;  1K57 C;  4JGO A;  2J3T C;  4ZJ1 A;  3SH7 A;  1N9O A;  3KYZ A;  3GEC A;  3IH9 A;  5EOE A;  4DJ3 A;  1XA1 A;  1K55 A;  2R9W A;  4S2O A;  1JVJ A;  5AVE A;  1G68 A;  4GHI A;  5CHM A;  1ONH A;  2PR5 A;  1K56 D;  4JPM A;  3UE1 A;  2HDU A;  4GJ4 A;  1L0F A;  4FTX A;  5HPI A;  2AVX A;  4QD4 A;  5IS1 A;  4UA9 A;  2JN7 A;  4S2M A;  4MNR A;  5DKK A;  5F1F A;  1RP5 A;  3IHA A;  4E6X A;  1JNU A;  2H0Y A;  3AGE A;  2OLU A;  5L10 A;  3R7W B;  1BT5 A;  2QHK A;  4ESP A;  4O01 A;  4FSF A;  4M3K A;  4GOG A;  3TOI A;  3HJK A;  4RA7 A;  4OPR A;  5CER A;  4EUZ A;  3ZGA B;  4DE0 A;  3BY9 A;  2J7V A;  1K6R A;  2W3H A;  4LV0 A;  2QJ5 A;  4YWZ A;  3H7W B;  4GCZ A;  2DMW A;  3C8C A;  4F94 A;  3FPV A;  5G4Y A;  3N6I A;  4WMC D;  4RX3 A;  1NLZ A;  2QWS A;  4S2J A;  4KZA A;  3SS3 A;  3IT9 A;  1OPX A;  1PNE A;  5F6A A;  4R70 A;  3UY6 A;  4S2P A;  4HJ4 A;  4E3N A;  3JVU A;  3BLM A;  4Y17 A;  5CEB A;  3M6H A;  3FG8 A;  1PW1 A;  1ZTU A;  5TJJ A;  4LRY C;  2PAV P;  3NHQ A;  4DE3 A;  3LFV A;  3M2K A;  3MS6 A;  1JWZ A;  4Q0J A;  4I3J A;  1MWS A;  1N4O A;  2VK3 A;  3GVB A;  1PYY A;  3HLG A;  4CLC A;  4NXB A;  1XP4 A;  3S7Q A;  3E4P A;  2OWH A;  3KSH A;  5EM1 A;  2JE5 A;  1S1Y A;  1S1Z A;  3NOT C;  3T4K A;  4X53 A;  4GD8 A;  4H6J A;  2ZOI A;  3CG5 A;  4B88 A;  3ZCZ A;  4C3Q A;  4IBR A;  3WS0 A;  3TW8 A;  1C3B A;  3OPL A;  1CEF A;  4R6L A;  3W2Z A;  2PYR A;  4Y7P A;  3CJM A;  1NLY A;  5AQ9 A;  1HTZ A;  1LI9 A;  3U2A A;  5MC7 A;  1GHP A;  3ZNY A;  4E3I A;  4HJ6 A;  3OPP A;  2EWW A;  4X55 A;  3SS4 A;  4OOM A;  4UQI S;  4OLD A;  2ZQ7 A;  4HP9 A;  4IED A;  2E8J A;  4DJ2 A;  3OZH A;  1XXM A;  3UB7 A;  3E4Q A;  4Y0U A;  1NYM A;  2Y91 A;  4K0X A;  1D06 A;  1T18 A;  1K54 C;  2WGW B;  3WS5 A;  3LUQ A;  1I2W A;  2FH5 A;  2X71 A;  3FC7 A;  4IUH A;  1G6A A;  4OOL A;  2XD1 A;  2PDR A;  2Z2L B;  3JYI A;  4HY8 A;  4PKY G;  4R4S A;  1OTE A;  3VFF A;  1P9W A;  3LR5 A;  1DJA A;  1H8Y A;  2WKH A;  2EX9 A;  3T4O A;  5G18 A;  3EEA A;  4U0T A;  1XA7 A;  1SKO A;  1LL8 A;  4S2L A;  2JC7 A;  3NOP C;  2BLS A;  1L3L A;  2HP5 A;  1KE0 A;  4GS9 A;  1MXO A;  3S1Y A;  3WS2 A;  3IF6 A;  5DTK A;  3BLS A;  2V1B A;  4EXO A;  5DVA A;  3QP8 A;  1ALQ A;  1RCJ A;  1PZP A;  3FKV A;  1SHV A;  4MCW A;  1YM1 A;  3HLE A;  1SDE A;  1T1B A;  1XJ6 A;  4CLC E;  5HWW A;  5KIZ A;  3PHY A;  2WKQ A;  4GKU A;  1NRF A;  1UWN X;  2Y2N A;  2X02 A;  1V9Y A;  4I39 A;  4ZJ2 A;  3Q07 A;  3HBR A;  4HJ3 A;  3VFH A;  1ZC2 A;  1Z6F A;  3ZNT A;  3UME A;  4Q8I A;  2O9C A;  3UDX A;  4II7 A;  4P85 A;  4WM9 A;  3ICY A;  4BWI A;  2XA7 M;  5FQJ A;  4ZTK A;  5DKL A;  4UA6 A;  5KMW A;  1JTG A;  4OH0 A;  2C6W B;  3W8K A;  3V5M A;  2EXB A;  5U47 A;  5FA7 A;  3LIF A;  5GHY A;  5AQB A;  5FEG A;  3R7W A;  3OPR A;  1DP8 A;  4Y13 A;  1HD8 A;  3TG9 A;  2XRO A;  4E04 A;  3VSL A;  4L9G A;  5HAI A;  4NEE D;  4DDY A;  2O0Y A;  4N9K A;  2JKR M;  5K5B A;  4KZ9 A;  3C4P A;  3PBR A;  1BUL A;  3H7W A;  3IH8 A;  2OAP 1;  3UB6 A;  2G7U A;  3E98 A;  2Y2K A;  3GR2 A;  1F9I A;  4P0M A;  3IWQ A;  1W5D A;  3Q1F A;  1K6S A;  1IKG A;  5EVI C;  1AXB A;  1MKI A;  4MBK A;  1DP6 A;  2BAS A;  2JKT I;  3NEC A;  2L1M A;  4QJG A;  4DF6 A;  4ZBE A;  1UGU A;  4RVA A;  2OAQ 1;  4OQ0 A;  2BG1 A;  4Y15 A;  5F83 A;  1EI5 A;  1FQG A;  4YNR A;  4WL9 A;  5GLA A;  3UNW A;  3CZD A;  3DWZ A;  2XQZ A;  1ES3 A;  3VOY A;  4ETZ A;  4XT2 A;  2XK1 A;  5HL1 A;  2ZMV A;  3LEZ A;  4OLG A;  1OJG A;  2Q9M A;  1K56 A;  4EQ1 A;  3TSG A;  1M6K A;  1XGJ A;  5DTT A;  5TBM B;  3BQA A;  5M1A A;  1XPB A;  3O88 A;  4PM8 A;  2HP9 A;  4BBT A;  3C5A A;  1ONG A;  3G31 A;  4E3K A;  3TJZ C;  3KSG A;  3UE0 A;  5HWV A;  4GZB A;  3F1N B;  1FCN A;  5EFW A;  4P6Z M;  5DF9 A;  4JGP A;  5DF7 A;  4NXF A;  2INW A;  2QPN A;  1FR6 A;  2FFF B;  3Q82 A;  4UEY A;  3NIA A;  4F3L B;  3DTI A;  3A3I A;  3DAV A;  3VV4 A;  4WZ5 C;  1BSG A;  4EBN A;  3HJI A;  2WGW A;  2PU4 A;  1GSW A;  3NDG A;  3UO9 A;  4GB7 A;  5FAO A;  3V50 A;  4S2N A;  2WZX A;  3CLO A;  1TDL A;  4X1L A;  2VLG A;  1OME A;  4JXS A;  3E2K A;  4BQM A;  4NXG A;  5IHV A;  3S22 A;  5FL3 A;  3VP3 A;  3UN7 A;  1E4D A;  3EOI A;  5JYP A;  1EW0 A;  4PKY A;  2HV1 A;  4N92 A;  3A3J A;  3V67 A;  1YLJ A;  4Q0H A;  4HQA A;  1MPL A;  3VE4 A;  2ZM0 A;  5FI6 A;  1T1C A;  3LIB A;  4I3I A;  2P7J A;  4KEN B;  5I5L A;  4AFI A;  2J8Y A;  3OOV A;  3QP5 A;  5M18 A;  3PTE A;  2V9A A;  2EA9 A;  1BYW A;  5TFQ A;  2PT7 A;  2ACG A;  3C2W A;  3HRE A;  3NC8 A;  3P09 A;  2IWB A;  3C38 A;  3RTY A;  3C7V A;  4KUO A;  4DE1 A;  3FPW A;  3MSH A;  4EV4 A;  1P0Z A;  3BY8 A;  4O8G A;  2OWJ A;  3EWK A;  4DDS A;  2X01 A;  5HAR A;  1FIL A;  4LPZ A;  3MZF A;  2EX6 A;  4Q0I A;  4E6W A;  4N1H A;  4GS9 B;  5DFY A;  2HDQ A;  4KG5 A;  1PWD A;  4DKI A;  5L07 A;  5AJG A;  2EFU A;  3OCL A;  1O7E A;  1D1J A;  3BQ8 A;  5A93 A;  2VA0 A;  3V3S A;  1D7E A;  3IXB A;  4Y2F A;  1TS6 A;  3KO6 A;  4B4X A;  3DTM A;  3L9K A;  2Y4A A;  4CPK A;  2WK0 A;  3UPP A;  3QNB A;  2PU2 A;  3G6O A;  4O0P A;  2ZQA A;  2YKF A;  1ACF A;  2KLI A;  5AQ7 A;  1KDW A;  3PXP A;  5BOH A;  3K2N A;  4L9E A;  1MZU A;  3LR4 A;  1JWP A;  3TE8 A;  3BFF A;  4U3T A;  3S7N A;  4CLC C;  1H0M A;  3O86 A;  1I5Q A;  4EU0 A;  2A2L A;  5CGW A;  1STZ A;  2V0W A;  2XF3 A;  2A24 B;  4HNB A;  3QNC A;  4ETX A;  2XFS A;  4KQO A;  3PYP A;  3CUE A;  4C75 A;  2V20 A;  5A92 A;  4LV1 A;  5FAS A;  4B93 A;  4Z1W A;  3A3E A;  2V2F F;  3N7W A;  4P87 A;  2ZBB A;  4EBP A;  1ESU A;  5J3W A;  3QP4 A;  3DBA A;  2ZM2 A;  1L0E A;  4HHD A;  4UA7 A;  2HZ5 A;  2V8F A;  3UE6 A;  1YKD A;  2EX8 A;  3BJN A;  5FAT A;  5EVL A;  4OOY A;  1TS8 A;  3PBT A;  1ERM A;  1YT4 A;  2L0W A;  3E0Y A;  1WYC A;  4HES A;  3A0V A;  3O5Y A;  5EVI D;  1S67 L;  4LFU A;  5TBM A;  1WYB A;  4Y0T A;  3EGX C;  3UE3 A;  4RX2 A;  1YMS A;  4OQI A;  3MFX A;  2R9X A;  3MQO A;  1LT0 A;  3EEH A;  4LCL A;  4X25 A;  1W63 M;  2HGV A;  5CXW A;  2Q0O A;  1KDS A;  5G4Z A;  5HD3 A;  4QHC A;  4XUZ A;  3FKW A;  3G34 A;  4EES A;  4ZJ3 A;  1MWU A;  3CAX A;  2ZM8 A;  5HL6 A;  3IWO A;  4XT2 B;  3F1P B;  5E2F A;  2Y2P A;  3F1N A;  5LBR A;  1YLZ A;  2GDN A;  3A3F A;  2Y59 A;  3IWI A;  3T1X A;  3CHW P;  5HDC A;  1HVB A;  4EW7 A;  5FAQ A;  1VB6 A;  2XA7 S;  1BTL A;  4RQ9 A;  1A0K A;  4F3L A;  3VP4 A;  1F2K A;  1KE4 A;  5HSQ A;  4B4Z A;  2WUQ A;  4OPZ A;  2W3G A;  1OTB A;  5CX7 A;  3IBJ A;  3T4Q A;  3W4Q A;  5HWT A;  4MEZ A;  3IF6 C;  1NJ4 A;  4X69 A;  5E43 A;  3ZG0 A;  1CF0 A;  1GSV A;  3ZYT A;  1SKF A;  1MWR A;  3RXX A;  3PR6 A;  3RJU A;  3HLD A;  4OVD A;  1XFQ A;  5L2F A;  4WEL A;  2ZMF A;  1K0K A;  3R4K A;  2VGL M;  3GV9 A;  4I38 A;  1XX2 A;  3N8R A;  4KG6 A;  3LGO A;  2G2W A;  2ZJ9 A;  3LYX A;  1LL9 A;  5AVF A;  2VJW A;  1IYP A;  2C5W B;  2RCX A;  3PBS A;  2W1R A;  4NG2 A;  4DXB A;  1PWC A;  3S4X A;  5D3O A;  2V0U A;  5GLC A;  3BEC A;  1TDG A;  4DN0 A;  5F82 A;  1FSY A;  2PD8 A;  1MKM A;  1XJ3 A;  1GA9 A;  4FCF A;  1HLU P;  4R3B A;  3V3R A;  3IS2 A;  4MBF A;  4JKT A;  3BFC A;  4GLQ A;  3WWX A;  2BTF P;  2IA2 A;  1KGE A;  2NUP C;  2Y2G A;  5TGF A;  3MBZ A;  3HVF A;  3IXG A;  1HZO A;  5KSC A;  4JXG A;  3OPH A;  4QWO A;  4YOF A;  2A3U A;  1H3Q A;  1P97 A;  2W1T A;  2EXA A;  3D3O A;  4O7D A;  3WS4 A;  1YSQ A;  2WGV A;  3HUN A;  3T4S A;  1YLT A;  1NWZ A;  4EEP A;  3QP1 A;  1CI9 A;  3PBQ A;  2QMI A;  1BUE A;  1E25 A;  4I3A A;  1VHM A;  2ZD8 A;  4KZ3 A;  3AGF A;  3T50 A;  3MF0 A;  1JWV A;  3IXD A;  3NJA A;  3VOL A;  3VP0 A;  5HW3 A;  1PWG A;  5GLB A;  3ZFZ A;  3NUL A;  3BRM A;  3LI8 A;  5FQM A;  3CPT A;  4KZB A;  2M7V A;  3G35 A;  3DTE A;  1J9M A;  3OLO A;  5CRF A;  1VEU B;  3LY3 A;  1SDN A;  4JBF A;  2WGI A;  1ZHH B;  2VKS A;  2I72 A;  3ZG7 B;  4DXC A;  4D2O A;  2A24 A;  2H0T A;  1W8Y A;  2ZC7 A;  3ITA A;  4IUK A;  4EET B;  3UB5 P;  4PM7 A;  5HAQ A;  1Y54 A;  3KSF A;  3GRJ A;  4WF0 A;  3UPO A;  5J4E A;  2ZMA A;  2D02 A;  3T1S A;  4JLF A;  4FD8 A;  5CED A;  3UB9 A;  4R38 A;  4BL2 A;  3VP1 A;  5HD5 A;  3MQQ A;  4CLC D;  4FH2 A;  1E3U D;  1Q2Q A;  3MXR A;  3D4F A;  3ISG A;  5DF8 A;  4MN7 A;  4UQI M;  4NKP A;  2JKF A;  3HUO A;  2WKE A;  3Q81 A;  4GN2 A;  3RH8 B;  2LB5 A;  3IX8 A;  5HZH A;  3C7U A;  2Y8H A;  1IOU A;  2VV6 A;  3JPU A;  4MDZ A;  1O07 A;  5F68 A;  4ME4 A;  4S2N C;  4EQI A;  4LCM A;  5F69 A;  1TF1 A;  4LLO B;  2CC1 A;  5GHX A;  4JGR A;  3BW6 A;  2XDM A;  3Q7V B;  4OKP A;  4IVK A;  1T1A A;  2Y79 A;  5EPH A;  1K4E A;  5HDD A;  4BD0 A;  3F1P A;  1ERO A;  1FCM A;  3KYQ A;  5HDS A;  4MLL A;  1NZU A;  4QB8 A;  2W27 A; 
#chains in the Genus database with same CATH homology
 3NHQ A;  1OTA A;  5AJG A;  3LFV A;  3OCL A;  1TS0 A;  5DJT A;  4P6Z S;  4BMW A;  3RFB A;  2NUT C;  4Q0J A;  3BQ8 A;  1LSV A;  4I3J A;  2VA0 A;  4CLC A;  3PBN A;  4NXB A;  2PHY A;  1D7E A;  2WKP A;  4Y2F A;  1TS6 A;  3KO6 A;  3E4P A;  1N9L A;  4M4X A;  3S7Q A;  1UWP X;  2OWH A;  2JKR I;  3KSH A;  4HH3 A;  1S1Y A;  1S1Z A;  3NOT C;  3T4K A;  1LSX A;  4MN6 A;  4H6J A;  4HOI A;  1DRM A;  2ZOI A;  2KOI A;  2KX6 A;  2VX8 A;  2K7S A;  4G3V A;  5C5K A;  4K08 A;  3ZQ5 A;  3TRC A;  3MQ0 A;  1DP9 A;  2QKP A;  3TW8 A;  1S4R A;  2JKT M;  3G6O A;  4O0P A;  4R6L A;  3D72 A;  2YKF A;  3MMH A;  3W2Z A;  2KLI A;  2PYR A;  3LIE A;  1NLY A;  3NOU C;  3PXP A;  3K2N A;  4L9E A;  5J7E A;  3U2A A;  1X0O A;  5MC7 A;  1MZU A;  4R3A A;  2GJ3 A;  2K31 A;  3B33 A;  3LR4 A;  3P7N A;  4HJ6 A;  4MMN A;  2EWW A;  3IBR A;  4EER A;  3TE8 A;  2LB9 A;  4CLC C;  3S7N A;  4OOM A;  4UQI S;  4L0L A;  4HP4 A;  2J3T D;  4EU0 A;  2A2L A;  4HP9 A;  4LRX C;  4HIA A;  4DJ2 A;  1STZ A;  2V0W A;  3UB7 A;  3E4Q A;  2A24 B;  2I9V A;  2P08 A;  4HNB A;  1D06 A;  1T18 A;  4ETX A;  3LUQ A;  2FH5 A;  3PYP A;  4KQO A;  3CUE A;  1OTD A;  4GHI B;  4ZRR A;  3FC7 A;  4IUH A;  4B93 A;  1MC0 A;  4Z1W A;  1OTI A;  2V1A A;  4LRZ E;  4OOL A;  2ZBB A;  1XJ4 A;  2GNX A;  2PDR A;  3T4L A;  3OCN A;  5J3W A;  4HY8 A;  4BBV A;  3DBA A;  5A8B A;  4PKY G;  1NRJ A;  1OTE A;  3F1O B;  2VV8 A;  1YSP A;  1P9W A;  3LR5 A;  4HHD A;  3KSI A;  3UE6 A;  1Y28 A;  3T4O A;  2JHE A;  3KX0 X;  3IS2 B;  1YKD A;  3MR0 A;  4MN5 A;  3BJN A;  3EEA A;  4IJG A;  2VV7 A;  2W0N A;  2P04 A;  1LL8 A;  4EUV A;  4BJP A;  3NOP C;  1TS8 A;  2J3W A;  2OOL A;  4GS9 A;  3PBT A;  3UB8 A;  3BWL A;  2Z6C A;  2L0W A;  3E0Y A;  2M1C A;  2M7U A;  3A0V A;  3O5Y A;  1S67 L;  3MXQ A;  5TBM A;  3EGX C;  3UE3 A;  4FOF A;  3LIC A;  3MFX A;  4QPR A;  5L8M A;  2V1B A;  1LT0 A;  2W1T B;  3EEH A;  3MQO A;  3SW1 A;  4EXO A;  1W63 M;  2HGV A;  2HJ9 C;  5G4Z A;  4CQH A;  5HD3 A;  4EES A;  4BBU A;  3CAX A;  4MCW A;  2W3D A;  5HL6 A;  1T1B A;  4KQD A;  1XJ6 A;  4CLC E;  4XT2 B;  5HWW A;  2B18 A;  3F1P B;  5KIZ A;  3F1N A;  2K2N A;  5F5Y A;  5LBR A;  3PHY A;  2WKQ A;  5HDC A;  4EW7 A;  1UWN X;  1VB6 A;  1V9Y A;  2XA7 S;  4I39 A;  3OBF A;  4Y5F A;  4JGQ A;  2EWV A;  4RQ9 A;  3LI9 A;  4F3L A;  4HJ3 A;  2Z6D A;  5IT5 A;  3UME A;  5HSQ A;  2O9C A;  2PD7 A;  4WUJ A;  4CLC B;  2GX5 A;  1OTB A;  2W3G A;  5CX7 A;  3A0S A;  1W63 Q;  3IBJ A;  4II7 A;  3T4Q A;  5HWT A;  1ODV A;  1F5M A;  2L4R A;  3ICY A;  1H8M A;  4HI4 A;  4HH2 A;  4BWI A;  3LR0 A;  2XA7 M;  1GSV A;  3ZYT A;  4ARZ A;  1P9R A;  3EQU A;  3S7O A;  3JVV A;  1GSX A;  4H6J B;  3PR6 A;  4WEJ A;  5DKL A;  1XFQ A;  1XJ2 A;  4WEL A;  2ZMF A;  1IFQ A;  2J80 A;  4NXE A;  3K3C A;  3R4K A;  1N9N A;  2VGL M;  3LIF A;  2GZA A;  4I38 A;  3K3D A;  5DFX A;  3R7W A;  3LYX A;  1DP8 A;  5AVF A;  2VJW A;  4WN5 A;  2XRO A;  3PBS A;  2W1R A;  4E04 A;  3T4T A;  4L9G A;  3CIT A;  1S4S A;  2V0U A;  4NEE D;  2O0Y A;  4DMZ A;  4DN0 A;  4WLA A;  2JKR M;  5K5B A;  5DJU A;  3PBR A;  2PD8 A;  3H7W A;  1MKM A;  1WA9 A;  1XJ3 A;  2QYB A;  2D01 A;  3C30 A;  3H82 B;  2H28 A;  3CI6 A;  1OJ5 A;  3A0R A;  3HCY A;  4Y3I A;  2OAP 1;  3UB6 A;  2G7U A;  3CWF A;  3IS2 A;  3E98 A;  2ZOH A;  1F9I A;  2CMN A;  4GW9 A;  3P01 A;  2XRN A;  4GLQ A;  5IU1 A;  2IA2 A;  2R78 A;  2NUP C;  1DP6 A;  2BAS A;  2JKT I;  2HF6 A;  2L1M A;  2W3F A;  4I5S A;  1UGU A;  4YOF A;  2OAQ 1;  3H9W A;  3CUE C;  1H3Q A;  1P97 A;  2W1T A;  3B42 A;  2FZ0 A;  3D3O A;  4YNR A;  3UMD A;  4WL9 A;  3LR3 A;  1YSQ A;  2PYP A;  1OT6 A;  3T4S A;  1NWZ A;  4EEP A;  1F98 A;  3PBQ A;  4ETZ A;  4G3W A;  4XT2 A;  3VE3 A;  1G6O A;  4I3A A;  1VHM A;  2ZMV A;  3MJQ A;  1OJG A;  2PR6 A;  3EGD C;  3T50 A;  1TS7 A;  3B47 A;  1KOU A;  3MF0 A;  3S7P A;  4EQ1 A;  4WEK A;  3NJA A;  2VZW A;  4PAU A;  3VOL A;  5TBM B;  2HJE A;  2XSS A;  3BQA A;  2VEA A;  2O9A A;  3OC2 A;  4BBT A;  3LI8 A;  4KUK A;  3TJZ C;  1S66 L;  3KSG A;  2M7V A;  1G28 A;  1LSW A;  5HWV A;  2YKH A;  2VGL S;  4L9F A;  1YAX A;  3OLO A;  2QJ7 A;  3F1N B;  4JGO A;  5EFW A;  2J3T C;  4P6Z M;  4PHT A;  5DF9 A;  4JGP A;  4NXF A;  2INW A;  1N9O A;  2B02 A;  1ZHH B;  2VKS A;  3KYZ A;  4UEY A;  4F3L B;  2A24 A;  3GEC A;  3VV4 A;  1OT9 A;  4DJ3 A;  3HJI A;  3EQV A;  1XFN A;  3GDI A;  4IUK A;  4EET B;  4EEU A;  1GSW A;  3KSF A;  4WF0 A;  5AVE A;  3E4O A;  5J4E A;  4G3K A;  4GHI A;  2D02 A;  4ARZ B;  3CLO A;  2PR5 A;  2VLG A;  2WKR A;  4NXG A;  4B9O A;  4GJ4 A;  2O99 A;  3UB9 A;  5HPI A;  4R38 A;  5FL3 A;  5IS1 A;  2JN7 A;  5HD5 A;  3MQQ A;  1TD5 A;  4CLC D;  3H82 A;  3EOI A;  5DKK A;  1EW0 A;  3F1O A;  4PKY A;  2HV1 A;  1JNU A;  3LIA A;  3T4J A;  3V67 A;  4MN7 A;  4Q0H A;  4UQI M;  4HQA A;  5KSH A;  4NKP A;  3R7W B;  3RH8 B;  2QHK A;  3VE4 A;  4O01 A;  4FSF A;  1T1C A;  3LIB A;  1V9Z A;  2LB5 A;  3HJK A;  5HZH A;  4I3I A;  1T19 A;  2P7J A;  2VV6 A;  2Y8H A;  2W3H A;  3BY9 A;  1IOU A;  4MDZ A;  2QJ5 A;  4YWZ A;  5F68 A;  2W3E A;  4IHQ A;  4ME4 A;  5I5L A;  4AFI A;  5F69 A;  1TF1 A;  3OOV A;  4LLO B;  3H7W B;  4GCZ A;  4JGR A;  3PBO A;  3BW6 A;  2V9A A;  2DMW A;  2EA9 A;  1BYW A;  3C8C A;  2O9B A;  2PT7 A;  3C2W A;  1T1A A;  2Y79 A;  3C38 A;  3FPV A;  5G4Y A;  3RTY A;  3LID A;  4KUO A;  1NLZ A;  2QWS A;  5HDD A;  3FPW A;  1OPX A;  3F1P A;  5F6A A;  4R70 A;  1P0Z A;  3BY8 A;  4O8G A;  2OWJ A;  3EWK A;  3ULF A;  4HJ4 A;  5HPF A;  4LPZ A;  3JVU A;  4Q0I A;  3KYQ A;  4GS9 B;  5DFY A;  5HDS A;  2MJ6 A;  3FG8 A;  1ZTU A;  5TJJ A;  4LRY C;  2KDK A;  2W27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...