2A28A

Atomic-resolution crystal structure of the second sh3 domain of yeast bzz1 determined from a pseudomerohedrally twinned crystal
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
GAMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords BZZ1 protein
total genus 14
structure length 54
sequence length 54
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a28A00
3REBB 1YCSB 1JQQA 1X6GA 5IHKA 4JZ4A 3ZL7C 1WXUA 2EPDA 1T0HA 3LH5A 1SPKA 2I0NA 2VVKA 4HVUA 4JJCA 3EG0A 2L0AA 2KBTA 4CC7A 4OMOA 2V1QA 1GFCA 1QWEA 1Y57A 1NM7A 1TG0A 2KT1A 5I11A 1WYXA 2JT4A 2FRYA 4Z88A 1K0SA 1GCQC 1UECA 3QWYA 1W1FA 2JXBA 2NWMA 3VS5A 2W0ZA 2PZ1A 4AFUC 2RQUA 4HCKA 2C0OA 1OPLA 1YWPA 2FPFA 2O2OA 4OMLA 1BU1A 4ZNXA 2KRNA 2HDAA 3M0UA 2XMFA 1ABOA 3TSZA 2DNUA 2EYZA 1ARKA 4J9DA 2CT3A 1AZGB 1NLOC 1XOVA 3I35A 4RTVA 4RTYA 1PKTA 2M0YA 2YUOA 2RQTA 1X2QA 2DJQA 2A36A 1T3SA 2EGCA 2D0NA 1WXBA 2LP5A 2X3WD 1CSKA 4OMMA 2FG0A 2YUQA 1K4US 2PNIA 3EG2A 2C0TA 2D8JA 4WCIA 1RUWA 2CUDA 2RN8A 2AK5A 4Y92A 4JJDA 1E7OA 3C0CA 1W70A 3VS1A 3SHWA 5IHNA 4AG2C 3NPFA 1UGVA 2K2MA 1NYFA 1UDLA 2CH4A 2DILA 1SRMA 1AWOA 2BTTA 3PE0A 1X43A 2DA9A 1BBZA 1J3TA 2O31A 1X69A 4A63B 2A28A 2KRMA 3KFVA 1B3QA 2NUZA 4J9CA 2AKLA 1JU5C 5EC7A 2LJ1A 2DL4A 1WIEA 2ESWA 2V1RA 4LUEA 2RPNA 3H0IA 2MCNA 1PKSA 4J9FA 2SRCA 1QLYA 1UFFA 3UA7A 1K1ZA 2AKKA 4F14A 2DM1A 2EQIA 2W10A 2K79A 2ENMA 2RF0A 1ZSGA 2LMJA 1U06A 2CH4W 2GGRA 1BB9A 1VYUA 2ROTA 3M0RA 3PVLA 2KXCA 1AD5A 2JTEA 4OMPA 2AZVA 1RLPC 1PWTA 3VS7A 2M51A 1OEBA 2C0IA 1T3LA 2BZXA 2O9VA 4JJBA 5I22A 1H92A 2F2XA 4GLMA 3I9QA 2EYWA 3TVTA 5FW9A 5GJWB 1JEGA 2YUPA 3M0PA 4IIMA 1X27A 2D1XA 1CKBA 2JM9A 2LJ0A 2GTOA 1UTIA 3VS3A 1MV0B 1I07A 4X1VA 2HBWA 1E6GA 2GNCA 1OV3A 1AVZC 1RLQC 1TUDA 2AZSA 4DEYA 4K11A 1B07A 4J9IA 4D8DA 1BK2A 4RTUA 2GQIA 5FWBA 2IIMA 3EGUA 1GBQA 1YP5A 2FEIA 1FMKA 2ABLA 2KR3A 2G6FX 2DBKA 2FPDA 3VS4A 2RQRA 1H3HA 1ZLMA 1OPKA 2O9SA 1AEYA 3EG3A 3M0QA 2J7IA 1K9AA 4DEXA 1WX6A 2DL8A 2OAWA 2P4RA 3H41A 2DMOA 1QKXA 1SRLA 4IIOA 2LQWA 1UJ0A 2EVRA 1WXTA 3A98A 2JMCA 1SEMA 2HCKA 2L3PA 2DRKA 2J6FA 1VYVA 4RTZA 5FWCA 1ZUUA 4J9BA 4RTWA 3UA6A 4CC3A 4AG1C 4LE9A 3UF4A 3H0FA 2CSIA 1U5SA 1YWOA 2BZYA 2A37A 1UHCA 2VKNA 4ORZA 2CREA 2DL3A 2J6OA 2FRWA 4CC2A 2HEQA 3GBQA 4EIKA 1X2KA 2L3SA 1K76A 2EGAA 1IO6A 1N5ZA 4R0KA 2E5KA 2H8HA 3REAB 2JS0A 1Z9QA 2LNHB 2KNBB 2LX7A 1NYGA 2K7AA 2D8HA 1UJYA 2CT4A 1KSWA 1UE9A 2K6DA 2KYBA 2DRMA 1A0NB 1ZUKA 3EHRA 4AFQC 1W6XA 1QCFA 1LCKA 1WFWA 2HSPA 1WI7A 1JXMA 4OMQA 2DBMA 1QWFA 2MIOA 2MOXA 1HD3A 2CDTA 3JV3A 4LUDA 2DF6A 2RQVA 4D8KA 2DL5A 1Y0MA 1WDXA 2EYXA 3R6NA 1HSQA 1UG1A 1H8KA 1YN8A 1AWJA 2EYYA 1I1JA 3M0SA 4J9GA 3IQLA 4HXJA 2J06A 3RBBB 1K0XA 2J6KA 1X6BA 3EHQA 4CC4B 4JPBW 1AWXA 1VYTA 2DE0X 4HVWA 1CKAA 1WA7A 5IHIA 2LQNA 4HVVA 2FO0A 2DX1A 1VA7A 2FPEA 1T0JA 3VS6A 1U3OA 2DVJA 3SEMA 1NEGA 1WLPB 2F2WA 4AFZC 1KJWA 4M4ZA 2KT8A 1KIKA 2LZ6B 2SEMA 5IH2A 4ESRA 1PNJA 2X3XD 2EKHA 2ED0A 4Z8AA 4RTXA 2OJ2A 3RNJA 2KEAA 3TSWA 5IXBA 3M0TA 2JMAA 1PRLC 1M3BA 1ZX6A 2B86A 1TUCA 2DLPA 2GBQA 3NGPA 2DL7A 1HJDA 1QKWA 2KYMA 3PVQA 1OOTA 1M30A 5ECAA 3I5RA 4RUGA 1AWWA 1ABQA 3NHNA 2CUBA 2VWFA 1ZUYA 2GTJA 2JM8A 2LCSA 1G2BA 5GJVB 2BZ8A 2CSQA 5HCKA 3FJ5A 5L23A 4LN2A 1M3AA 4LNPA 2KRSA 4J9HA 2J05A 4RTTA 1M3CA 1RI9A 2YUNA 1G83A 3VS2A 4GBQA 2L3QA 2ED1A 4AFSC 2KROA 4J9EA 1UUEA 2YSQA 1GL5A 2EGEA 1I0CA 3NMZC 4OMNA 4Z89A 2YT6A 2PTKA 1YNZA 3EG1A 2JS2A 3H0HA 3UATA 1AOJA 2KGTA 1FYNA 2KE9A 3CQTA 1V1CA 2EW3A 2RNAA 1PRMC 2ROLA 1SHFA 1UHFA 2OI3A 1NLPC 2DYBA 1ZBJA 4KRTA 1MUZA 1NEBA 2EBPA 2RMOA 2LJ3A 1GCQA 1SSHA 1JXOA 1MV3A 1Z9ZA 2YDLA 3QWXX 1M8MA 3U23A 1SHGA 4JZ3A 5IXFA 1KFZA 1AZEA 2RQWA 2F2VA 2JW4A 1JO8A 4F16A 3I5SA 3O5ZA 2O88A 2A08A 2KXDA 3VS0A 2QDLA 2K9GA 4E6RA 4FSSA 1GBRA 1PHTA 1NG2A 1GRIA 2ECZA 3VRYA 1E6HA 3THKA 2L2PA 4QT7A 3VRZA 4F17A 3ULRB 1M27C 1S1NA 1EFNA 1GCPA 1GFDA 2K3BA
chains in the Genus database with same CATH superfamily
2NUPA 5LJ5h 5IHKA 1OQKA 2FB7A 1WXUA 3G4SQ 3CCVQ 2OTLA 3G71Q 4O6JA 1YJWA 1TXQA 2CZ6B 4B9XA 5CR2A 2I0NA 4HVUA 1VQ7A 2R5AA 2DD4A 3E9GA 3G6ET 2KDSA 4OMOA 2DZ9A 1JBMA 1QWEA 3J81E 2KI7A 1ACMB 1G3YA 2KT1A 4FW1A 4Z88A 3RKWA 5GMKe 2YWWA 2YLBA 1JJ2P 3CBOA 4JRIA 3A8HB 2PZ1A 4HKEA 4AFUC 4BY6C 2C0OA 3M57A 2HKNA 1QVFS 4M75B 1OU9A 3CPWS 3D7SB 2KRNA 3RDVA 1NJIU 2PU9B 5J26A 2I2LA 2LDMA 4J9DA 1WPYA 2XKOC 1M5Q1 3JB9I 1BIAA 3OQ5A 4GY5A 2M0YA 2QASA 2XI9A 1X2QA 2DJQA 3CC2Q 3G6EQ 1G8XA 1OULA 4FL6A 2RD1A 2F1LA 1LNXA 2YUQA 4KGVB 2PNIA 2EIFA 3EG2A 1XTDA 2MAMA 4WCIA 2DIQA 3TREA 2LNVA 4DBFA 2E64A 1H3ZA 1E7OA 2VXFA 3RESA 1KQ2A 3VS1A 3SHWA 2KY9A 4IKFA 3BY7A 4AG2C 1IHWA 1UGVA 2A0FB 2K2MA 1XQHA 2LVMA 2QQSA 2GFAA 1IREB 2DA9A 1BBZA 1J3TA 3LWHA 2A3LA 1LOJA 1RADB 2CYZB 5HK0A 2KRMA 3KFVA 2ZPHB 2RI3A 3E1SA 3CCUT 2AKLA 3BDLA 3NFCA 5EC7A 3INZA 4E2FB 3PNWC 2ESWA 4M7DC 3A8MB 4JJNK 4M7AB 5KCHA 1Y07A 4M77B 1YJWQ 2MCNA 2QEXQ 4J9FA 1UFFA 3UA7A 4CRIA 1FWZA 4F14A 2E70A 1KQSP 2P84A 1IGQA 5FU7C 2W10A 3J7AF 4PL6A 3A8OB 2ENMA 3QYHB 1BB9A 3M59A 5GANf 2ROTA 3OBYA 9ATCB 1D1AA 1Y96A 1VQLT 4IUTA 4M7DE 2EQKA 1VQNT 1PWTA 2M51A 2C0IA 2M16A 2R57A 2O9VA 4BDZA 3QKJA 1VQKQ 4LDXA 5KYUB 3OS1A 3I9QA 4X9CA 2HQEA 5GJWB 4A4HA 5GAOm 2JTFA 5LJ3h 4F7UG 1X27A 5GAMh 2EJGA 3T9NA 1I07A 4EMGA 5GAMe 1OV3A 1UGQB 1QVFA 4DEYA 4XU1A 1B07A 4J9IA 3OYKA 2LT1A 4D8DA 3CCMQ 1BK2A 1K9MU 4C5GA 4LDYA 1BI0A 3EGUA 2FEIA 4HCZA 4LXCA 2KR3A 3FJPA 2FPDA 2RJCA 3EH2A 3EG3A 3RUXA 1NZ9A 3UT1A 2CP0A 2WSCE 4DEXA 2ZAEA 3JRZA 7AT1B 1SRLA 4IIOA 4QQ6A 4X34A 1UJ0A 1Q7YC 2EVRA 5GMKh 3CC7T 2L3PA 1VUBA 4PFZA 4N4IA 2J6FA 3OYYA 3JCMP 5FU6B 4RTWA 3UF4A 3H0FA 2BZYA 3CD6A 1UHCA 2ZZDA 3RR6A 1YI2A 2NYSA 3GNFB 3MPUB 2R5MA 3C94A 4B9WA 3CC7A 4EIKA 1X2KA 5A2QE 4BDYA 4C92F 5GAOr 4DQ2A 2L3SA 3A5ZB 4AT1B 1IO6A 1MNEA 2K3YA 4FCYA 4ZTJA 2DIGA 2EQUA 2RI5A 3JCMW 1M4ZA 1OZ2A 1Q81R 2LNHB 5DLQE 2DYIA 2CT4A 3OY9A 1KSWA 3G4ST 1UE9A 3OS0A 2QTVA 1AT1B 1VQLQ 3HHTB 4JS5A 4BUGA 3EHRA 2X35A 3H9NA 4J8OA 5LJ3e 4O5VA 1R77A 4FU6A 2ZPIB 1QWFA 2MOXA 2COWA 2RI2A 5D6XA 2DFUA 1Y0MA 2RJFA 1HSQA 3VUBA 3VJPA 1YN8A 1AWJA 3GNGA 1K0XA 3OYMA 3CEYA 1CKAA 2E5QA 1WA7A 4V2SA 5IHIA 1JJ2S 2DX1A 2FPEA 5A0GA 3DB4A 1QVFP 3L42A 2DVJA 3SEMA 4C8QG 1NEGA 1WLPB 1KJWA 2K4YA 5CQYA 1PNJA 1PD0A 2ED0A 3RNJA 3TSWA 2YLCA 3QO3A 3CC2A 1MMGA 2IPOB 1TUCA 1R0CB 2BE7D 2DJZA 3QG1A 1HJDA 2R58A 2KYMA 1OOTA 4XAXB 5ECAA 3M53A 1WZOA 4RUGA 4C8QD 1AWWA 4MMKA 1ZSZA 2F5TX 3EFSA 3Q1JA 3QUIA 2LCSA 3ER0A 2CP5A 3LW5E 1VQOT 1ZHIA 2H3EB 2VC8A 3CCMT 3VKIA 4N4HA 4JLGA 1WHLA 1TUGB 1N9SA 3E19A 1PCXA 4LNPA 2EQJA 2PVDB 1G83A 2K2VA 1JRIA 5CKBA 4J6YA 2ZPFB 2DERA 1VQ7T 5CKDA 2EGEA 4DBQA 3H6ZA 3CC2T 4OMNA 4Z89A 2CP3A 4E7KA 4M7DD 2PTKA 4A53A 1VQKT 3EG1A 2B8AA 3NTKA 2YHTA 2LQ8A 2RNAA 3G4SA 2RO0A 3L2ZA 5J39A 3HFOA 2ROLA 4FYXB 3SWNB 3OYEA 1QVGP 4OMFB 5KYWA 1MUZA 1FX7A 3M58A 1JXOA 4JZ3A 1KQSS 1KFZA 1QQJA 1BKBA 1AZEA 4RG2A 4L59A 2F2VA 5DM7R 3JB9J 2DTHA 3TU4K 3I5SA 3LGFA 2RHYA 4E6RA 4BE1A 1GBRA 1PHTA 3CD6T 1D0ZA 3JB9H 4L6V5 3CCQQ 2L2PA 3VRZA 3CCJA 3ULRB 3WXMB 2QQBA 1YITA 1EFNA 3TQ7P 2VV5A 1OU8A 4Z02A 2KAFA 2CP7A 2L3RA 1VIFA 2EPDA 4EMKA 4OVAA 3OYJA 2HAXA 1VQPA 2VVKA 2KMTA 4JJCA 3EG0A 2L0AA 5DLOA 1VQOQ 3SDZA 4AMCA 3SWNA 1Y57A 5I11A 1BCOA 3MKDA 2MF2A 1WYXA 2JT4A 4C92A 2QQAA 1UGSB 1WGSA 1GCQC 5AYFA 3QWYA 2KK4A 1N9RA 2LCCA 2VXEA 2JXBA 2W0ZA 5CKEA 2LTOA 3OSSC 2RQUA 1M2VA 5LJ3j 1VQ5Q 1OPLA 2O2OA 3L2QA 2F5KA 2K5IA 4E7IA 2COZA 2HDAA 3LYIA 1QP2A 2QI2A 1QVGA 2DZCA 4M77E 2EYZA 2YXYA 3M5AA 3N5BB 3PMIA 1NLOC 2F69A 2KQWA 3F70A 4XTWA 1PKTA 4MDWA 3DLLA 3PGGA 1VQ4Q 1WXBA 4J7FA 1PD1A 1CSKA 3CCJT 1VQNA 2C0TA 1RUWA 2CUDA 1QVGS 4Y92A 1RAEB 4C8QF 4LD9K 1UEBA 2QEXT 3OYFA 5GAMf 4FIBA 1AWOA 1U8RA 3MJXA 3RERA 2BTTA 2HQXA 1VQ5A 2VGMA 2GCXA 1QVPA 1QCNA 4M78A 4R56A 4PFPA 3HRUA 3A8LB 3LGLA 3JCMX 3V8LA 3CC4Q 1FMVA 1JU5C 5GANe 2XG8D 4LD6A 4ELZC 1WHKA 2P0KA 2JTMA 3RIRA 2X4YA 4LUEA 3H0IA 3MEVA 1M90R 3ZEHA 2CGHA 5CO7A 5CKHA 4IUUA 2SRCA 3MEAA 1IZ6A 2AKKA 2QA4T 2GQVA 2EQIA 3OA6A 3M55A 1M1GA 1NE8A 2K79A 3PIPA 2RF0A 2QDYB 1ZSGA 1K9MR 2LMJA 4QKUA 1U06A 1YFNA 1YIJA 3M0RA 3PVLA 3CCLA 2KXCA 4N0AC 2AZVA 1RLPC 3VS7A 4P5NA 4QVCA 2BZXA 4E7HA 1NJIR 5I22A 3VYGA 4GLMA 5CK9A 2HD0A 3V7CA 4C5HA 3V8KA 4IIMA 2JM9A 2NUTA 2LJ0A 3CXCS 4BI8B 5GMKj 2GNCA 3HPWA 1VQ6Q 1VQ8T 1RLQC 4KGZB 2DXUA 4JS4A 5FU7B 3SFMA 2DPPB 2X51A 3HRTA 5GAN2 4RKUE 4C8QC 3TEEA 2M0OA 1K73C 5FWBA 4PJOF 2BKDN 1G3WA 1SSFA 3VS4A 2RQRA 1ZLMA 1OPKA 2DD5A 1AEYA 1K8AC 2J7IA 1PSEA 4F7UA 1WX6A 2DL8A 4D6WA 4KUDK 3DLMA 2GFUA 2DMOA 2VB6A 3META 2QA4A 3UPUA 4BI4A 4F7UE 4BI3A 5GMKl 3OYBA 3CXCP 1WXTA 2JMCA 4BY6B 1VQMT 1SEMA 1N27A 3BE3A 2RJEA 4M75C 2DKGA 5I2MA 3UA6A 4CC3A 4XTUA 2VKNA 3P8DA 2CREA 1OX8A 2HEQA 4HT8A 2EFIA 5FRMA 1YITQ 1JB0E 2EGAA 2MYSA 4IUVA 3AHUA 2ATCB 4FT2A 2E5KA 1BI1A 4M77F 2KNBB 3VYHB 3E2UA 3GOXA 4M78G 4M75E 5HKCA 2KYBA 3RKXA 3X28B 1ZUKA 4AFQC 1W6XA 3QXEB 1Q86R 1WFWA 1Y96B 3FDRA 5KYXB 4X9DA 5D6WA 3UWNA 2D6FA 2JOYA 2P0PA 3QZ9B 1H641 2CDTA 2QEXA 2DF6A 1IXDA 4D8KA 1LPLA 4M77A 1PM3A 1YBYA 2EYYA 3OMCA 4M75G 3M0SA 3OS5A 4HXJA 2IG0A 3RBBB 4JRQA 1K73U 3EHQA 3EH1A 2PQWA 1V76A 1AWXA 1VYTA 3LH0A 3JSCA 3MEWA 1S72Q 3I56Q 2RM4A 2LQNA 4HVVA 1OZ3A 4OGEA 3A8GB 1YIJQ 4ZGDB 3VS6A 4OB2B 4HCBA 2OTJQ 5IH2A 1B7TA 2VUBA 4BACA 3X26B 2E6ZA 4RTXA 4A4KA 5IXBA 5CCAA 5KYXA 1VQPQ 1ZX6A 1SKUB 2Z0WA 1QKWA 4MZMA 2EJFA 4PFOA 4L5GA 3JCMh 1S72T 5GMKm 1HXDA 2D9TA 4FW2A 4RMOA 4ELYC 5GJVB 2CSQA 3CCQA 3JCMb 2MWOA 4LN2A 1M3AA 2KRSA 3CXCA 5KYNA 2RK1A 1TU0B 2YUNA 3OYGA 4GBQA 2L3QA 3CC4T 1UGPB 3ZFJA 2KROA 1Q7YR 1UUEA 1B34A 2YSQA 4BE2A 1YHQQ 1TH7A 4ZTFA 1Y71A 2AT1B 3I55Q 2YT6A 5LJ5j 1M1KU 2XDDA 2QYZA 4JRKA 3CCMA 1C0MA 3JB9F 3CBPA 2JS2A 2PUKB 3H0HA 3CC7Q 1AOJA 2KGTA 1V1CA 5GAN8 1RAHB 1BIBA 2CP2A 2V8IA 3QDFA 4NL3A 4ATOA 3G71A 1PRMC 2OTLQ 2OI3A 2EWNA 1NLPC 3PMTA 3J80E 1RAFB 3MP6A 1SSHA 1EX4A 1KD1R 3QWXX 2PVOB 4F7UB 1SHGA 2GF7A 1WHGA 4RG8A 5IXFA 2DEQA 3TCJA 1LJOA 4R55A 2CS7A 2RHXA 3O5ZA 1I4K1 2ZCFB 3P8BB 2A08A 4ZGEB 4NOYA 1TTHB 1NG2A 1GRIA 3VRYA 1RL2A 1E6HA 1D09B 2HNIA 2RK2A 4F17A 3M54A 1M27C 1S1NA 3KXTA 3MP1A 2JJ9A 1ZSZC 4KBMB 1VQ9Q 1YCSB 1JQQA 1X6GA 4E7LA 5CQXA 3ZL7C 5LL6S 4J83A 3CD6Q 3GP8A 3OSVA 1SPKA 2QG9B 4LDWA 2NUTB 5CIUA 2KBTA 4CC7A 3GPLA 2HQHA 1BI3A 1Y7XA 1NM7A 1TG0A 3M4GA 4PJOD 1OYXA 2FRYA 4C5EA 3EG9B 4ZGJB 2FZKB 2DETA 3R6OA 1W1FA 2FHDA 2HSEB 3FRNA 4C8QA 4HT9A 1YWPA 5HK3A 3KUFA 2WSFE 5GANj 3CCRA 1F1BB 1K8AU 1VQ4T 3M0UA 4M75D 4J6WA 2XMFA 3TSZA 5LJ3f 1VQ8Q 3L1AA 2DNUA 2V26A 1ARKA 1WHJA 2CT3A 4DBHA 5LJ5d 4EMHA 1AZGB 3CCLT 1XOVA 3L2VA 4RTVA 4RTYA 3EGXB 3C4SA 2DK3A 2JN0A 2RQTA 2YUOA 2OX7A 3S3NA 1T3SA 3PTAA 2EGCA 5GANh 2D0NA 4KT0E 2LP5A 2X3WD 5KYYB 4OMMA 1M1KC 5GAN6 1K4US 2ZGWA 5GAMd 3QJYA 1KC8C 2RN8A 2V8KA 1G3SA 3C0CA 1W70A 5IHNA 1G5VA 3NPFA 3GLXA 5GAOl 1KD1U 2EAYA 3FB9A 2MMPA 1UDLA 1WJSA 3PE0A 1X43A 1Q95G 1W2BS 2O31A 3CBMA 1X69A 1O9SA 4A63B 1OI1A 2OAUA 1NBEB 1BI2A 2LJ1A 3JAME 2DL4A 1WIEA 1YJNA 2V1RA 1UGRB 2VASA 2RPNA 5J3BA 2RHZA 1Q81C 1PKSA 1QLYA 3FIFA 5LJ5e 2DM1A 2Y90A 4QQDA 2E6NA 5FROA 1M2VB 2DXTA 3SWNC 1VQ8A 4C8QB 2DXBA 4M7AG 4ANJA 1YITT 2GGRA 1VYUA 2EQMA 3EG9A 2L5QA 2G3RA 1AD5A 3DKMA 2A7YA 4C92B 2MPXC 1IRXA 1T3LA 3CCEQ 1WQ7A 2EYWA 5FW9A 1JEGA 2YUPA 3M0PA 1SG5A 3QPHA 2D1XA 1CKBA 2E4HA 4YTLA 3CCVT 4M75F 3HTRA 2YRCA 3VS3A 1MV0B 2DEUA 3JCMJ 5D7UA 6AT1B 1VQOA 5GANd 5I2SA 3OBWA 1TUDA 4EDUA 1VQ7Q 4BB7A 4K11A 4A4EA 3ZBDA 1WJQA 2CZ0B 4RTUA 2GQIA 2IIMA 4CI0C 1GBQA 1YP5A 3ASKA 1FMKA 1VQLA 4FYYB 1ZQ1A 2G6FX 2HL3A 5CVIA 4C0DB 2DBKA 2X9HA 1H3HA 1D3BA 2LX9A 2O9SA 3OMGA 1VQKA 1K9AA 2P4RA 1UB4A 3CCST 4ZN3A 3CMEQ 3EFOB 1LVKA 4M78E 5LJ5f 2EJ9A 4PKCC 4BE0A 1KHCA 5KYWB 1VQ5T 2QQRA 2ZPGB 3A98A 3QBYA 4WF2A 1W2BP 3BW1A 1D3BB 3V7SA 4DOWA 2BIVA 2DRKA 1XNIA 4A54A 3QDRB 4RTZA 5A0DA 4MDXA 5FWCA 1ZUUA 4J9BA 5HY6A 1G3TA 1KK7A 4XTVA 1U5SA 3CCQT 4JRPA 2A37A 1N8RR 3HSBA 4ORZA 2J6OA 1D0YA 4M7AE 2FRWA 4CC2A 1B34B 3OW2A 1YJNQ 3CCSA 4ZN1A 1VQ6A 1VQPT 3I55A 1EIFA 5D6YA 1KC8R 1N5ZA 1EZZB 3BDUA 2HZYA 4E47A 2WSEE 1ZBXA 2V8JA 2H8HA 1AHJB 2KSSA 5GAOq 8ATCB 2FL7A 1M90C 2XICA 1NYGA 1TS9A 1ZSZB 3LLRA 1S72A 3JCMQ 2K6DA 3CMAQ 2DRMA 1Q82R 5KE3A 3LX7A 1QCFA 1Q86C 1I5OB 5FLXE 1YJNT 3MHXA 4C92D 2H3JA 4IUQA 2FZGB 1WI7A 1C1AA 4QQGA 4IUPA 1JJ2A 2DBMA 2MIOA 2K5FA 3JV3A 2PUOB 2DO3A 1MMDA 5GAMg 2DL5A 4II1A 1U1SA 1WDXA 2EYXA 3R6NA 2XIDA 1UG1A 1H8KA 4PJOC 4J9GA 4PJOA 4IURA 2J06A 4CC4B 3CMET 1MNDA 4C92G 3ME9A 4JPBW 4WTOB 1V29B 3GF5A 5EG2A 2LT4A 2E12A 2CKKA 4F7UF 2FO0A 3CPWA 3OB9A 1VA7A 1ZA2B 5IT9E 2QXFA 2EKOA 2F2WA 1YCYA 4M4ZA 2X4JA 5GAN3 1KIKA 2LZ6B 2SEMA 3C95A 4ESRA 4NL2A 4XK8E 4M7AD 2RJDA 1X75C 2KEAA 4J7IA 3M0TA 1PRLC 3L2WA 4Y28E 2DLPA 3NGPA 4C5IA 1VQ4A 3OYNA 4EMKC 3CCVA 5GAOp 4B6MA 1M30A 4M7DF 3I5RA 1X6OA 2QAZA 3NHNA 1VQ9A 1ZUYA 2GTJA 2QTXA 4DBRA 2JM8A 2MWPA 3EGXA 5I21A 1WHMA 1G2BA 3RMQA 1YJWT 2FVUA 2O4XA 1Q7YU 2XDPA 5L23A 1MMAA 2HMAA 4NS5A 3CPFA 4J9HA 4RTTA 3QIIA 3CCUQ 1RI9A 1HYOA 1M1KR 3MCAB 3RKYA 3VS2A 1KG1A 2ED1A 2QQ9A 3JCMg 4KH0B 4EPCA 1GL5A 4OB0B 3KBGA 4M77C 1I0CA 3CMAT 3CCSQ 2DVEA 4PLLA 3HKSA 2L89A 3CCET 3UATA 2LRQA 4PJLA 1NPRA 4A4FA 2HBPA 1VOMA 2KE9A 5GANg 2E1HA 3CCRT 4KUIA 1SHFA 4QW2A 1UHFA 5AT1B 1NEBA 2EBPA 1X01A 3MP8A 1R0BG 4F04B 1MV3A 2YDLA 1KD1C 3U23A 3CCRQ 4M7DG 2PVGB 2COYA 5IN1A 2MK5A 3P8HA 2JW4A 4E7SA 1JO8A 4F16A 3X24B 5L8RE 3L2UA 2KXDA 2QDLA 2K9GA 4FSSA 2P4TA 3THKA 5GAOn 4QT7A 1Q82U 3S3MA 1OX9A 1GCPA 4E7ZA 1GFDA 3C12A 3REBB 4C92E 4JZ4A 2K3XA 5GAN5 3OS2A 2P0QA 1T0HA 1N8RC 3LH5A 1KQSA 2C06A 4XTZA 5KE2A 3M4YA 2DAQA 2DXCA 4UC4A 3S6WA 2RA2A 3HFNA 2V1QA 5KYUA 1GFCA 3VU3C 4QVZA 1DJ7B 1K0SA 1UECA 3VUZA 5GAN7 2RHIA 3VS5A 1I81A 2NWMA 3CCUA 4HCKA 2FPFA 2LCLA 2K5LA 4OMLA 1BU1A 2HL5C 3DB3A 4ZNXA 4PJJA 1ABOA 3X25B 4OF1A 2O4XB 4M7AA 3QSUA 4KGXB 2FZCB 2X4WA 1KC8U 3I35A 3SB2A 3O8VA 1YIJT 2A36A 1TOVA 2QK0A 1M2OA 2FG0A 1TWBA 4M78D 1U1TA 2D8JA 3FLGA 1YHQA 4XU2A 4M78B 2AK5A 3CC4A 1QCOA 4JJDA 5CKFA 2E65A 4OB3B 1RAAB 2OTJT 1NYFA 2XK0A 2CH4A 2DILA 1SRMA 5A0LA 2FYKA 2AIRB 3CCLQ 3VV0A 1IB8A 2XHCA 8AT1B 1K73R 3EAEA 3HRSA 3PIOA 1VQ9T 4HCCA 3FEOA 3S3OA 4FSXA 2M1HA 2A28A 4C92C 1B3QA 3G7ZA 2NUZA 4J9CA 2IVWA 4PNOA 4PJOB 3G6EA 1WJRA 1K1ZA 5LJ3g 1GXIE 2OTJA 2LC4A 4M75A 3I56T 3CCJQ 3G1JA 1YI2T 2CH4W 2OTLT 1YJ9A 1HK9A 2JTEA 4OMPA 3I56A 2VGNA 1OEBA 4JJBA 1VQ6T 1H92A 4J5YA 1MMNA 2F2XA 3TVTA 2QGGA 5FRNA 4JDSA 2GTOA 4M7AC 1UTIA 1RACB 1VQNQ 4X1VA 3OW2S 3PT9A 1QMCA 4LDVA 2HBWA 1E6GA 4EMKB 2E3IA 4N4GA 1AVZC 2NUPB 5LJ3d 3NTIA 4OB1B 2AZSA 3L2RA 2ZPEB 1PG5B 1Q82C 4FM4B 1I5LA 1XJWB 1Q86U 2WACA 1R8OB 3GIBA 4C0FA 2ABLA 1PC0A 2QGFB 4FT4A 4J6XA 1N8RU 2HKQB 1M8VA 3WVEB 2NLUA 1MGQA 3M0QA 4XTYA 2OAWA 3CMEA 4QVDA 5GMKi 2BE9B 3H41A 3OYLA 1QKXA 1M90U 4N0AA 2LQWA 1YHQT 1RAIB 4FYVB 1QP3A 1KQ1A 3EFOA 3OYDA 2JZ2A 3OYCA 4KULA 4M77D 4RCCA 4RCBA 3OW2P 1P92A 1BCMA 3JCMV 2HCKA 2KVQG 1VYVA 4Q5WA 1VQMA 4AG1C 4LE9A 2CSIA 1YWOA 5LJ5g 2DL3A 5M9OA 4Y91A 1NJIC 1VQMQ 2X4XA 1QW1A 5GAN4 1W2BA 2M9UA 3BFMA 3JB9G 3GBQA 3QJ6A 4ME7A 4PLIA 1K76A 2L8DA 1N6AA 3QYGB 3QZ5B 5C0MA 2RH2A 1TSFA 2CZ1B 4R0KA 2QA4Q 4XTXA 3REAB 2JS0A 1M1FA 2BUDA 3FC3A 1Z9QA 3LWIA 2LX7A 1FXXA 2K7AA 4XQ3A 2D8HA 2JNGA 1UJYA 3JB9D 1D1CA 3I55T 1O75A 4FYWB 4JLIA 3WVDB 2XDBA 1A0NB 2Y4YA 2AHJB 1LCKA 2Y4XA 4MZTA 4C0GA 1K9MC 2ZPBB 4PJOG 2E3HA 2O01E 2HSPA 1JXMA 3NTHA 4JUVA 2XD0A 1K8AR 3M56A 4OMQA 1HD3A 4C0ZA 4LUDA 5DY9A 3MEUA 3EGDB 2RQVA 2K57A 4XU0A 2JUFA 2VYTA 3E9FA 1BYMA 4M7DB 4DA4A 1SF9A 1I1JA 3IQLA 2DTIA 3A1PA 2J6KA 1X6BA 3V7RA 3H8ZA 4PJNA 2LQKA 3JCMc 1IHVA 3UDCA 2DE0X 2RHUA 2D0QB 4M78F 1D0XA 4HVWA 3OYAA 3X20B 5KH6A 2MI6A 3EFRA 1WHHA 2RB6A 4LDUA 3OYHA 1YJ9Q 1T0JA 4M7DA 2YRVA 4HA8A 4MMLA 4DOVA 1U3OA 4AFZC 1WNLA 2KT8A 3EGDA 4GLKA 1KHIA 2X3XD 4OGCA 2EKHA 4Z8AA 4M7AF 2OJ2A 1RABB 3HL8A 1FMWA 2JMAA 1M3BA 3JCMf 2B86A 2E41A 2GBQA 4M78C 1YI2Q 1W4SA 1IGUA 2DL7A 2CP6A 2EYQA 3OYIA 2DTOA 1I8FA 5KYYA 3PVQA 1PSFA 1ABQA 2CUBA 2VWFA 5CAIA 1C6VX 3RMSA 1M9SA 1RI0A 4A4GA 1VIEA 2BZ8A 5HCKA 3FJ5A 3CMAA 3JCMe 4PJMA 2J05A 1M3CA 4C0DC 4OP0A 1RAGB 4AFSC 5IAYA 4BD3A 4J9EA 2JVVA 5KCOA 4KH1B 5GAMj 2E10A 2XU8A 3JCMd 3NMZC 3QHSA 1YNZA 4PJOE 1ZA1B 1WQWA 1FYNA 4TVRA 3CQTA 2EW3A 2M02A 5FU6C 3MO8A 2DYBA 1ZBJA 3AT1B 4KRTA 1MHNA 4E7JA 3M9QA 4M77G 2RMOA 4MZPA 2LJ3A 1GCQA 1Z9ZA 1Q81U 1M8MA 3PFSA 1NPPA 4VUBA 4C8QE 2RQWA 3CCEA 1D1BA 2O88A 3V8JA 3VS0A 2CZ7B 3URGA 5C6SA 4XU3A 3SD4A 2ECZA 3G71T 3HP9A 2YRDA 1YJ9T 3CPWP 4PK4A 2K3BA
chains in the Genus database with same CATH topology
3REBB 1YCSB 1JQQA 1X6GA 5IHKA 4JZ4A 3ZL7C 1WXUA 2EPDA 1T0HA 3LH5A 1SPKA 2I0NA 2VVKA 4HVUA 4JJCA 3EG0A 2L0AA 2KBTA 4CC7A 4OMOA 2V1QA 1GFCA 1QWEA 1Y57A 1NM7A 1TG0A 2KT1A 5I11A 1WYXA 2JT4A 2FRYA 4Z88A 1K0SA 1GCQC 1UECA 3QWYA 1W1FA 2JXBA 2NWMA 3VS5A 2W0ZA 2PZ1A 4AFUC 2RQUA 4HCKA 2C0OA 1OPLA 1YWPA 2FPFA 2O2OA 4OMLA 1BU1A 4ZNXA 2KRNA 2HDAA 3M0UA 2XMFA 1ABOA 3TSZA 2DNUA 2EYZA 1ARKA 4J9DA 2CT3A 1AZGB 1NLOC 1XOVA 3I35A 4RTVA 4RTYA 1PKTA 2M0YA 2YUOA 2RQTA 1X2QA 2DJQA 2A36A 1T3SA 2EGCA 2D0NA 1WXBA 2LP5A 2X3WD 1CSKA 4OMMA 2FG0A 2YUQA 1K4US 2PNIA 3EG2A 2C0TA 2D8JA 4WCIA 1RUWA 2CUDA 2RN8A 2AK5A 4Y92A 4JJDA 1E7OA 3C0CA 1W70A 3VS1A 3SHWA 5IHNA 4AG2C 3NPFA 1UGVA 2K2MA 1NYFA 1UDLA 2CH4A 2DILA 1SRMA 1AWOA 2BTTA 3PE0A 1X43A 2DA9A 1BBZA 1J3TA 2O31A 1X69A 4A63B 2A28A 2KRMA 3KFVA 1B3QA 2NUZA 4J9CA 2AKLA 1JU5C 5EC7A 2LJ1A 2DL4A 1WIEA 2ESWA 2V1RA 4LUEA 2RPNA 3H0IA 2MCNA 1PKSA 4J9FA 2SRCA 1QLYA 1UFFA 3UA7A 1K1ZA 2AKKA 4F14A 2DM1A 2EQIA 2W10A 2K79A 2ENMA 2RF0A 1ZSGA 2LMJA 1U06A 2CH4W 2GGRA 1BB9A 1VYUA 2ROTA 3M0RA 3PVLA 2KXCA 1AD5A 2JTEA 4OMPA 2AZVA 1RLPC 1PWTA 3VS7A 2M51A 1OEBA 2C0IA 1T3LA 2BZXA 2O9VA 4JJBA 5I22A 1H92A 2F2XA 4GLMA 3I9QA 2EYWA 3TVTA 5FW9A 5GJWB 1JEGA 2YUPA 3M0PA 4IIMA 1X27A 2D1XA 1CKBA 2JM9A 2LJ0A 2GTOA 1UTIA 3VS3A 1MV0B 1I07A 4X1VA 2HBWA 1E6GA 2GNCA 1OV3A 1AVZC 1RLQC 1TUDA 2AZSA 4DEYA 4K11A 1B07A 4J9IA 4D8DA 1BK2A 4RTUA 2GQIA 5FWBA 2IIMA 3EGUA 1GBQA 1YP5A 2FEIA 1FMKA 2ABLA 2KR3A 2G6FX 2DBKA 2FPDA 3VS4A 2RQRA 1H3HA 1ZLMA 1OPKA 2O9SA 1AEYA 3EG3A 3M0QA 2J7IA 1K9AA 4DEXA 1WX6A 2DL8A 2OAWA 2P4RA 3H41A 2DMOA 1QKXA 1SRLA 4IIOA 2LQWA 1UJ0A 2EVRA 1WXTA 3A98A 2JMCA 1SEMA 2HCKA 2L3PA 2DRKA 2J6FA 1VYVA 4RTZA 5FWCA 1ZUUA 4J9BA 4RTWA 3UA6A 4CC3A 4AG1C 4LE9A 3UF4A 3H0FA 2CSIA 1U5SA 1YWOA 2BZYA 2A37A 1UHCA 2VKNA 4ORZA 2CREA 2DL3A 2J6OA 2FRWA 4CC2A 2HEQA 3GBQA 4EIKA 1X2KA 2L3SA 1K76A 2EGAA 1IO6A 1N5ZA 4R0KA 2E5KA 2H8HA 3REAB 2JS0A 1Z9QA 2LNHB 2KNBB 2LX7A 1NYGA 2K7AA 2D8HA 1UJYA 2CT4A 1KSWA 1UE9A 2K6DA 2KYBA 2DRMA 1A0NB 1ZUKA 3EHRA 4AFQC 1W6XA 1QCFA 1LCKA 1WFWA 2HSPA 1WI7A 1JXMA 4OMQA 2DBMA 1QWFA 2MIOA 2MOXA 1HD3A 2CDTA 3JV3A 4LUDA 2DF6A 2RQVA 4D8KA 2DL5A 1Y0MA 1WDXA 2EYXA 3R6NA 1HSQA 1UG1A 1H8KA 1YN8A 1AWJA 2EYYA 1I1JA 3M0SA 4J9GA 3IQLA 4HXJA 2J06A 3RBBB 1K0XA 2J6KA 1X6BA 3EHQA 4CC4B 4JPBW 1AWXA 1VYTA 2DE0X 4HVWA 1CKAA 1WA7A 5IHIA 2LQNA 4HVVA 2FO0A 2DX1A 1VA7A 2FPEA 1T0JA 3VS6A 1U3OA 2DVJA 3SEMA 1NEGA 1WLPB 2F2WA 4AFZC 1KJWA 4M4ZA 2KT8A 1KIKA 2LZ6B 2SEMA 5IH2A 4ESRA 1PNJA 2X3XD 2EKHA 2ED0A 4Z8AA 4RTXA 2OJ2A 3RNJA 2KEAA 3TSWA 5IXBA 3M0TA 2JMAA 1PRLC 1M3BA 1ZX6A 2B86A 1TUCA 2DLPA 2GBQA 3NGPA 2DL7A 1HJDA 1QKWA 2KYMA 3PVQA 1OOTA 1M30A 5ECAA 3I5RA 4RUGA 1AWWA 1ABQA 3NHNA 2CUBA 2VWFA 1ZUYA 2GTJA 2JM8A 2LCSA 1G2BA 5GJVB 2BZ8A 2CSQA 5HCKA 3FJ5A 5L23A 4LN2A 1M3AA 4LNPA 2KRSA 4J9HA 2J05A 4RTTA 1M3CA 1RI9A 2YUNA 1G83A 3VS2A 4GBQA 2L3QA 2ED1A 4AFSC 2KROA 4J9EA 1UUEA 2YSQA 1GL5A 2EGEA 1I0CA 3NMZC 4OMNA 4Z89A 2YT6A 2PTKA 1YNZA 3EG1A 2JS2A 3H0HA 3UATA 1AOJA 2KGTA 1FYNA 2KE9A 3CQTA 1V1CA 2EW3A 2RNAA 1PRMC 2ROLA 1SHFA 1UHFA 2OI3A 1NLPC 2DYBA 1ZBJA 4KRTA 1MUZA 1NEBA 2EBPA 2RMOA 2LJ3A 1GCQA 1SSHA 1JXOA 1MV3A 1Z9ZA 2YDLA 3QWXX 1M8MA 3U23A 1SHGA 4JZ3A 5IXFA 1KFZA 1AZEA 2RQWA 2F2VA 2JW4A 1JO8A 4F16A 3I5SA 3O5ZA 2O88A 2A08A 2KXDA 3VS0A 2QDLA 2K9GA 4E6RA 4FSSA 1GBRA 1PHTA 1NG2A 1GRIA 2ECZA 3VRYA 1E6HA 3THKA 2L2PA 4QT7A 3VRZA 4F17A 3ULRB 1M27C 1S1NA 1EFNA 1GCPA 1GFDA 2K3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REB B;  1YCS B;  1JQQ A;  1X6G A;  5IHK A;  4JZ4 A;  3ZL7 C;  1WXU A;  2EPD A;  1T0H A;  3LH5 A;  1SPK A;  2I0N A;  2VVK A;  4HVU A;  4JJC A;  3EG0 A;  2L0A A;  2KBT A;  4CC7 A;  4OMO A;  2V1Q A;  1GFC A;  1QWE A;  1Y57 A;  1NM7 A;  1TG0 A;  2KT1 A;  5I11 A;  1WYX A;  2JT4 A;  2FRY A;  4Z88 A;  1K0S A;  1GCQ C;  1UEC A;  3QWY A;  1W1F A;  2JXB A;  2NWM A;  3VS5 A;  2W0Z A;  2PZ1 A;  4AFU C;  2RQU A;  4HCK A;  2C0O A;  1OPL A;  1YWP A;  2FPF A;  2O2O A;  4OML A;  1BU1 A;  4ZNX A;  2KRN A;  2HDA A;  3M0U A;  2XMF A;  1ABO A;  3TSZ A;  2DNU A;  2EYZ A;  1ARK A;  4J9D A;  2CT3 A;  1AZG B;  1NLO C;  1XOV A;  3I35 A;  4RTV A;  4RTY A;  1PKT A;  2M0Y A;  2YUO A;  2RQT A;  1X2Q A;  2DJQ A;  2A36 A;  1T3S A;  2EGC A;  2D0N A;  1WXB A;  2LP5 A;  2X3W D;  1CSK A;  4OMM A;  2FG0 A;  2YUQ A;  1K4U S;  2PNI A;  3EG2 A;  2C0T A;  2D8J A;  4WCI A;  1RUW A;  2CUD A;  2RN8 A;  2AK5 A;  4Y92 A;  4JJD A;  1E7O A;  3C0C A;  1W70 A;  3VS1 A;  3SHW A;  5IHN A;  4AG2 C;  3NPF A;  1UGV A;  2K2M A;  1NYF A;  1UDL A;  2CH4 A;  2DIL A;  1SRM A;  1AWO A;  2BTT A;  3PE0 A;  1X43 A;  2DA9 A;  1BBZ A;  1J3T A;  2O31 A;  1X69 A;  4A63 B;  2A28 A;  2KRM A;  3KFV A;  1B3Q A;  2NUZ A;  4J9C A;  2AKL A;  1JU5 C;  5EC7 A;  2LJ1 A;  2DL4 A;  1WIE A;  2ESW A;  2V1R A;  4LUE A;  2RPN A;  3H0I A;  2MCN A;  1PKS A;  4J9F A;  2SRC A;  1QLY A;  1UFF A;  3UA7 A;  1K1Z A;  2AKK A;  4F14 A;  2DM1 A;  2EQI A;  2W10 A;  2K79 A;  2ENM A;  2RF0 A;  1ZSG A;  2LMJ A;  1U06 A;  2CH4 W;  2GGR A;  1BB9 A;  1VYU A;  2ROT A;  3M0R A;  3PVL A;  2KXC A;  1AD5 A;  2JTE A;  4OMP A;  2AZV A;  1RLP C;  1PWT A;  3VS7 A;  2M51 A;  1OEB A;  2C0I A;  1T3L A;  2BZX A;  2O9V A;  4JJB A;  5I22 A;  1H92 A;  2F2X A;  4GLM A;  3I9Q A;  2EYW A;  3TVT A;  5FW9 A;  5GJW B;  1JEG A;  2YUP A;  3M0P A;  4IIM A;  1X27 A;  2D1X A;  1CKB A;  2JM9 A;  2LJ0 A;  2GTO A;  1UTI A;  3VS3 A;  1MV0 B;  1I07 A;  4X1V A;  2HBW A;  1E6G A;  2GNC A;  1OV3 A;  1AVZ C;  1RLQ C;  1TUD A;  2AZS A;  4DEY A;  4K11 A;  1B07 A;  4J9I A;  4D8D A;  1BK2 A;  4RTU A;  2GQI A;  5FWB A;  2IIM A;  3EGU A;  1GBQ A;  1YP5 A;  2FEI A;  1FMK A;  2ABL A;  2KR3 A;  2G6F X;  2DBK A;  2FPD A;  3VS4 A;  2RQR A;  1H3H A;  1ZLM A;  1OPK A;  2O9S A;  1AEY A;  3EG3 A;  3M0Q A;  2J7I A;  1K9A A;  4DEX A;  1WX6 A;  2DL8 A;  2OAW A;  2P4R A;  3H41 A;  2DMO A;  1QKX A;  1SRL A;  4IIO A;  2LQW A;  1UJ0 A;  2EVR A;  1WXT A;  3A98 A;  2JMC A;  1SEM A;  2HCK A;  2L3P A;  2DRK A;  2J6F A;  1VYV A;  4RTZ A;  5FWC A;  1ZUU A;  4J9B A;  4RTW A;  3UA6 A;  4CC3 A;  4AG1 C;  4LE9 A;  3UF4 A;  3H0F A;  2CSI A;  1U5S A;  1YWO A;  2BZY A;  2A37 A;  1UHC A;  2VKN A;  4ORZ A;  2CRE A;  2DL3 A;  2J6O A;  2FRW A;  4CC2 A;  2HEQ A;  3GBQ A;  4EIK A;  1X2K A;  2L3S A;  1K76 A;  2EGA A;  1IO6 A;  1N5Z A;  4R0K A;  2E5K A;  2H8H A;  3REA B;  2JS0 A;  1Z9Q A;  2LNH B;  2KNB B;  2LX7 A;  1NYG A;  2K7A A;  2D8H A;  1UJY A;  2CT4 A;  1KSW A;  1UE9 A;  2K6D A;  2KYB A;  2DRM A;  1A0N B;  1ZUK A;  3EHR A;  4AFQ C;  1W6X A;  1QCF A;  1LCK A;  1WFW A;  2HSP A;  1WI7 A;  1JXM A;  4OMQ A;  2DBM A;  1QWF A;  2MIO A;  2MOX A;  1HD3 A;  2CDT A;  3JV3 A;  4LUD A;  2DF6 A;  2RQV A;  4D8K A;  2DL5 A;  1Y0M A;  1WDX A;  2EYX A;  3R6N A;  1HSQ A;  1UG1 A;  1H8K A;  1YN8 A;  1AWJ A;  2EYY A;  1I1J A;  3M0S A;  4J9G A;  3IQL A;  4HXJ A;  2J06 A;  3RBB B;  1K0X A;  2J6K A;  1X6B A;  3EHQ A;  4CC4 B;  4JPB W;  1AWX A;  1VYT A;  2DE0 X;  4HVW A;  1CKA A;  1WA7 A;  5IHI A;  2LQN A;  4HVV A;  2FO0 A;  2DX1 A;  1VA7 A;  2FPE A;  1T0J A;  3VS6 A;  1U3O A;  2DVJ A;  3SEM A;  1NEG A;  1WLP B;  2F2W A;  4AFZ C;  1KJW A;  4M4Z A;  2KT8 A;  1KIK A;  2LZ6 B;  2SEM A;  5IH2 A;  4ESR A;  1PNJ A;  2X3X D;  2EKH A;  2ED0 A;  4Z8A A;  4RTX A;  2OJ2 A;  3RNJ A;  2KEA A;  3TSW A;  5IXB A;  3M0T A;  2JMA A;  1PRL C;  1M3B A;  1ZX6 A;  2B86 A;  1TUC A;  2DLP A;  2GBQ A;  3NGP A;  2DL7 A;  1HJD A;  1QKW A;  2KYM A;  3PVQ A;  1OOT A;  1M30 A;  5ECA A;  3I5R A;  4RUG A;  1AWW A;  1ABQ A;  3NHN A;  2CUB A;  2VWF A;  1ZUY A;  2GTJ A;  2JM8 A;  2LCS A;  1G2B A;  5GJV B;  2BZ8 A;  2CSQ A;  5HCK A;  3FJ5 A;  5L23 A;  4LN2 A;  1M3A A;  4LNP A;  2KRS A;  4J9H A;  2J05 A;  4RTT A;  1M3C A;  1RI9 A;  2YUN A;  1G83 A;  3VS2 A;  4GBQ A;  2L3Q A;  2ED1 A;  4AFS C;  2KRO A;  4J9E A;  1UUE A;  2YSQ A;  1GL5 A;  2EGE A;  1I0C A;  3NMZ C;  4OMN A;  4Z89 A;  2YT6 A;  2PTK A;  1YNZ A;  3EG1 A;  2JS2 A;  3H0H A;  3UAT A;  1AOJ A;  2KGT A;  1FYN A;  2KE9 A;  3CQT A;  1V1C A;  2EW3 A;  2RNA A;  1PRM C;  2ROL A;  1SHF A;  1UHF A;  2OI3 A;  1NLP C;  2DYB A;  1ZBJ A;  4KRT A;  1MUZ A;  1NEB A;  2EBP A;  2RMO A;  2LJ3 A;  1GCQ A;  1SSH A;  1JXO A;  1MV3 A;  1Z9Z A;  2YDL A;  3QWX X;  1M8M A;  3U23 A;  1SHG A;  4JZ3 A;  5IXF A;  1KFZ A;  1AZE A;  2RQW A;  2F2V A;  2JW4 A;  1JO8 A;  4F16 A;  3I5S A;  3O5Z A;  2O88 A;  2A08 A;  2KXD A;  3VS0 A;  2QDL A;  2K9G A;  4E6R A;  4FSS A;  1GBR A;  1PHT A;  1NG2 A;  1GRI A;  2ECZ A;  3VRY A;  1E6H A;  3THK A;  2L2P A;  4QT7 A;  3VRZ A;  4F17 A;  3ULR B;  1M27 C;  1S1N A;  1EFN A;  1GCP A;  1GFD A;  2K3B A; 
#chains in the Genus database with same CATH topology
 2NUP A;  5LJ5 h;  5IHK A;  1OQK A;  2FB7 A;  1WXU A;  3G4S Q;  3CCV Q;  2OTL A;  3G71 Q;  4O6J A;  1YJW A;  1TXQ A;  2CZ6 B;  4B9X A;  5CR2 A;  2I0N A;  4HVU A;  1VQ7 A;  2R5A A;  2DD4 A;  3E9G A;  3G6E T;  2KDS A;  4OMO A;  2DZ9 A;  1JBM A;  1QWE A;  3J81 E;  2KI7 A;  1ACM B;  1G3Y A;  2KT1 A;  4FW1 A;  4Z88 A;  3RKW A;  5GMK e;  2YWW A;  2YLB A;  1JJ2 P;  3CBO A;  4JRI A;  3A8H B;  2PZ1 A;  4HKE A;  4AFU C;  4BY6 C;  2C0O A;  3M57 A;  2HKN A;  1QVF S;  4M75 B;  1OU9 A;  3CPW S;  3D7S B;  2KRN A;  3RDV A;  1NJI U;  2PU9 B;  5J26 A;  2I2L A;  2LDM A;  4J9D A;  1WPY A;  2XKO C;  1M5Q 1;  3JB9 I;  1BIA A;  3OQ5 A;  4GY5 A;  2M0Y A;  2QAS A;  2XI9 A;  1X2Q A;  2DJQ A;  3CC2 Q;  3G6E Q;  1G8X A;  1OUL A;  4FL6 A;  2RD1 A;  2F1L A;  1LNX A;  2YUQ A;  4KGV B;  2PNI A;  2EIF A;  3EG2 A;  1XTD A;  2MAM A;  4WCI A;  2DIQ A;  3TRE A;  2LNV A;  4DBF A;  2E64 A;  1H3Z A;  1E7O A;  2VXF A;  3RES A;  1KQ2 A;  3VS1 A;  3SHW A;  2KY9 A;  4IKF A;  3BY7 A;  4AG2 C;  1IHW A;  1UGV A;  2A0F B;  2K2M A;  1XQH A;  2LVM A;  2QQS A;  2GFA A;  1IRE B;  2DA9 A;  1BBZ A;  1J3T A;  3LWH A;  2A3L A;  1LOJ A;  1RAD B;  2CYZ B;  5HK0 A;  2KRM A;  3KFV A;  2ZPH B;  2RI3 A;  3E1S A;  3CCU T;  2AKL A;  3BDL A;  3NFC A;  5EC7 A;  3INZ A;  4E2F B;  3PNW C;  2ESW A;  4M7D C;  3A8M B;  4JJN K;  4M7A B;  5KCH A;  1Y07 A;  4M77 B;  1YJW Q;  2MCN A;  2QEX Q;  4J9F A;  1UFF A;  3UA7 A;  4CRI A;  1FWZ A;  4F14 A;  2E70 A;  1KQS P;  2P84 A;  1IGQ A;  5FU7 C;  2W10 A;  3J7A F;  4PL6 A;  3A8O B;  2ENM A;  3QYH B;  1BB9 A;  3M59 A;  5GAN f;  2ROT A;  3OBY A;  9ATC B;  1D1A A;  1Y96 A;  1VQL T;  4IUT A;  4M7D E;  2EQK A;  1VQN T;  1PWT A;  2M51 A;  2C0I A;  2M16 A;  2R57 A;  2O9V A;  4BDZ A;  3QKJ A;  1VQK Q;  4LDX A;  5KYU B;  3OS1 A;  3I9Q A;  4X9C A;  2HQE A;  5GJW B;  4A4H A;  5GAO m;  2JTF A;  5LJ3 h;  4F7U G;  1X27 A;  5GAM h;  2EJG A;  3T9N A;  1I07 A;  4EMG A;  5GAM e;  1OV3 A;  1UGQ B;  1QVF A;  4DEY A;  4XU1 A;  1B07 A;  4J9I A;  3OYK A;  2LT1 A;  4D8D A;  3CCM Q;  1BK2 A;  1K9M U;  4C5G A;  4LDY A;  1BI0 A;  3EGU A;  2FEI A;  4HCZ A;  4LXC A;  2KR3 A;  3FJP A;  2FPD A;  2RJC A;  3EH2 A;  3EG3 A;  3RUX A;  1NZ9 A;  3UT1 A;  2CP0 A;  2WSC E;  4DEX A;  2ZAE A;  3JRZ A;  7AT1 B;  1SRL A;  4IIO A;  4QQ6 A;  4X34 A;  1UJ0 A;  1Q7Y C;  2EVR A;  5GMK h;  3CC7 T;  2L3P A;  1VUB A;  4PFZ A;  4N4I A;  2J6F A;  3OYY A;  3JCM P;  5FU6 B;  4RTW A;  3UF4 A;  3H0F A;  2BZY A;  3CD6 A;  1UHC A;  2ZZD A;  3RR6 A;  1YI2 A;  2NYS A;  3GNF B;  3MPU B;  2R5M A;  3C94 A;  4B9W A;  3CC7 A;  4EIK A;  1X2K A;  5A2Q E;  4BDY A;  4C92 F;  5GAO r;  4DQ2 A;  2L3S A;  3A5Z B;  4AT1 B;  1IO6 A;  1MNE A;  2K3Y A;  4FCY A;  4ZTJ A;  2DIG A;  2EQU A;  2RI5 A;  3JCM W;  1M4Z A;  1OZ2 A;  1Q81 R;  2LNH B;  5DLQ E;  2DYI A;  2CT4 A;  3OY9 A;  1KSW A;  3G4S T;  1UE9 A;  3OS0 A;  2QTV A;  1AT1 B;  1VQL Q;  3HHT B;  4JS5 A;  4BUG A;  3EHR A;  2X35 A;  3H9N A;  4J8O A;  5LJ3 e;  4O5V A;  1R77 A;  4FU6 A;  2ZPI B;  1QWF A;  2MOX A;  2COW A;  2RI2 A;  5D6X A;  2DFU A;  1Y0M A;  2RJF A;  1HSQ A;  3VUB A;  3VJP A;  1YN8 A;  1AWJ A;  3GNG A;  1K0X A;  3OYM A;  3CEY A;  1CKA A;  2E5Q A;  1WA7 A;  4V2S A;  5IHI A;  1JJ2 S;  2DX1 A;  2FPE A;  5A0G A;  3DB4 A;  1QVF P;  3L42 A;  2DVJ A;  3SEM A;  4C8Q G;  1NEG A;  1WLP B;  1KJW A;  2K4Y A;  5CQY A;  1PNJ A;  1PD0 A;  2ED0 A;  3RNJ A;  3TSW A;  2YLC A;  3QO3 A;  3CC2 A;  1MMG A;  2IPO B;  1TUC A;  1R0C B;  2BE7 D;  2DJZ A;  3QG1 A;  1HJD A;  2R58 A;  2KYM A;  1OOT A;  4XAX B;  5ECA A;  3M53 A;  1WZO A;  4RUG A;  4C8Q D;  1AWW A;  4MMK A;  1ZSZ A;  2F5T X;  3EFS A;  3Q1J A;  3QUI A;  2LCS A;  3ER0 A;  2CP5 A;  3LW5 E;  1VQO T;  1ZHI A;  2H3E B;  2VC8 A;  3CCM T;  3VKI A;  4N4H A;  4JLG A;  1WHL A;  1TUG B;  1N9S A;  3E19 A;  1PCX A;  4LNP A;  2EQJ A;  2PVD B;  1G83 A;  2K2V A;  1JRI A;  5CKB A;  4J6Y A;  2ZPF B;  2DER A;  1VQ7 T;  5CKD A;  2EGE A;  4DBQ A;  3H6Z A;  3CC2 T;  4OMN A;  4Z89 A;  2CP3 A;  4E7K A;  4M7D D;  2PTK A;  4A53 A;  1VQK T;  3EG1 A;  2B8A A;  3NTK A;  2YHT A;  2LQ8 A;  2RNA A;  3G4S A;  2RO0 A;  3L2Z A;  5J39 A;  3HFO A;  2ROL A;  4FYX B;  3SWN B;  3OYE A;  1QVG P;  4OMF B;  5KYW A;  1MUZ A;  1FX7 A;  3M58 A;  1JXO A;  4JZ3 A;  1KQS S;  1KFZ A;  1QQJ A;  1BKB A;  1AZE A;  4RG2 A;  4L59 A;  2F2V A;  5DM7 R;  3JB9 J;  2DTH A;  3TU4 K;  3I5S A;  3LGF A;  2RHY A;  4E6R A;  4BE1 A;  1GBR A;  1PHT A;  3CD6 T;  1D0Z A;  3JB9 H;  4L6V 5;  3CCQ Q;  2L2P A;  3VRZ A;  3CCJ A;  3ULR B;  3WXM B;  2QQB A;  1YIT A;  1EFN A;  3TQ7 P;  2VV5 A;  1OU8 A;  4Z02 A;  2KAF A;  2CP7 A;  2L3R A;  1VIF A;  2EPD A;  4EMK A;  4OVA A;  3OYJ A;  2HAX A;  1VQP A;  2VVK A;  2KMT A;  4JJC A;  3EG0 A;  2L0A A;  5DLO A;  1VQO Q;  3SDZ A;  4AMC A;  3SWN A;  1Y57 A;  5I11 A;  1BCO A;  3MKD A;  2MF2 A;  1WYX A;  2JT4 A;  4C92 A;  2QQA A;  1UGS B;  1WGS A;  1GCQ C;  5AYF A;  3QWY A;  2KK4 A;  1N9R A;  2LCC A;  2VXE A;  2JXB A;  2W0Z A;  5CKE A;  2LTO A;  3OSS C;  2RQU A;  1M2V A;  5LJ3 j;  1VQ5 Q;  1OPL A;  2O2O A;  3L2Q A;  2F5K A;  2K5I A;  4E7I A;  2COZ A;  2HDA A;  3LYI A;  1QP2 A;  2QI2 A;  1QVG A;  2DZC A;  4M77 E;  2EYZ A;  2YXY A;  3M5A A;  3N5B B;  3PMI A;  1NLO C;  2F69 A;  2KQW A;  3F70 A;  4XTW A;  1PKT A;  4MDW A;  3DLL A;  3PGG A;  1VQ4 Q;  1WXB A;  4J7F A;  1PD1 A;  1CSK A;  3CCJ T;  1VQN A;  2C0T A;  1RUW A;  2CUD A;  1QVG S;  4Y92 A;  1RAE B;  4C8Q F;  4LD9 K;  1UEB A;  2QEX T;  3OYF A;  5GAM f;  4FIB A;  1AWO A;  1U8R A;  3MJX A;  3RER A;  2BTT A;  2HQX A;  1VQ5 A;  2VGM A;  2GCX A;  1QVP A;  1QCN A;  4M78 A;  4R56 A;  4PFP A;  3HRU A;  3A8L B;  3LGL A;  3JCM X;  3V8L A;  3CC4 Q;  1FMV A;  1JU5 C;  5GAN e;  2XG8 D;  4LD6 A;  4ELZ C;  1WHK A;  2P0K A;  2JTM A;  3RIR A;  2X4Y A;  4LUE A;  3H0I A;  3MEV A;  1M90 R;  3ZEH A;  2CGH A;  5CO7 A;  5CKH A;  4IUU A;  2SRC A;  3MEA A;  1IZ6 A;  2AKK A;  2QA4 T;  2GQV A;  2EQI A;  3OA6 A;  3M55 A;  1M1G A;  1NE8 A;  2K79 A;  3PIP A;  2RF0 A;  2QDY B;  1ZSG A;  1K9M R;  2LMJ A;  4QKU A;  1U06 A;  1YFN A;  1YIJ A;  3M0R A;  3PVL A;  3CCL A;  2KXC A;  4N0A C;  2AZV A;  1RLP C;  3VS7 A;  4P5N A;  4QVC A;  2BZX A;  4E7H A;  1NJI R;  5I22 A;  3VYG A;  4GLM A;  5CK9 A;  2HD0 A;  3V7C A;  4C5H A;  3V8K A;  4IIM A;  2JM9 A;  2NUT A;  2LJ0 A;  3CXC S;  4BI8 B;  5GMK j;  2GNC A;  3HPW A;  1VQ6 Q;  1VQ8 T;  1RLQ C;  4KGZ B;  2DXU A;  4JS4 A;  5FU7 B;  3SFM A;  2DPP B;  2X51 A;  3HRT A;  5GAN 2;  4RKU E;  4C8Q C;  3TEE A;  2M0O A;  1K73 C;  5FWB A;  4PJO F;  2BKD N;  1G3W A;  1SSF A;  3VS4 A;  2RQR A;  1ZLM A;  1OPK A;  2DD5 A;  1AEY A;  1K8A C;  2J7I A;  1PSE A;  4F7U A;  1WX6 A;  2DL8 A;  4D6W A;  4KUD K;  3DLM A;  2GFU A;  2DMO A;  2VB6 A;  3MET A;  2QA4 A;  3UPU A;  4BI4 A;  4F7U E;  4BI3 A;  5GMK l;  3OYB A;  3CXC P;  1WXT A;  2JMC A;  4BY6 B;  1VQM T;  1SEM A;  1N27 A;  3BE3 A;  2RJE A;  4M75 C;  2DKG A;  5I2M A;  3UA6 A;  4CC3 A;  4XTU A;  2VKN A;  3P8D A;  2CRE A;  1OX8 A;  2HEQ A;  4HT8 A;  2EFI A;  5FRM A;  1YIT Q;  1JB0 E;  2EGA A;  2MYS A;  4IUV A;  3AHU A;  2ATC B;  4FT2 A;  2E5K A;  1BI1 A;  4M77 F;  2KNB B;  3VYH B;  3E2U A;  3GOX A;  4M78 G;  4M75 E;  5HKC A;  2KYB A;  3RKX A;  3X28 B;  1ZUK A;  4AFQ C;  1W6X A;  3QXE B;  1Q86 R;  1WFW A;  1Y96 B;  3FDR A;  5KYX B;  4X9D A;  5D6W A;  3UWN A;  2D6F A;  2JOY A;  2P0P A;  3QZ9 B;  1H64 1;  2CDT A;  2QEX A;  2DF6 A;  1IXD A;  4D8K A;  1LPL A;  4M77 A;  1PM3 A;  1YBY A;  2EYY A;  3OMC A;  4M75 G;  3M0S A;  3OS5 A;  4HXJ A;  2IG0 A;  3RBB B;  4JRQ A;  1K73 U;  3EHQ A;  3EH1 A;  2PQW A;  1V76 A;  1AWX A;  1VYT A;  3LH0 A;  3JSC A;  3MEW A;  1S72 Q;  3I56 Q;  2RM4 A;  2LQN A;  4HVV A;  1OZ3 A;  4OGE A;  3A8G B;  1YIJ Q;  4ZGD B;  3VS6 A;  4OB2 B;  4HCB A;  2OTJ Q;  5IH2 A;  1B7T A;  2VUB A;  4BAC A;  3X26 B;  2E6Z A;  4RTX A;  4A4K A;  5IXB A;  5CCA A;  5KYX A;  1VQP Q;  1ZX6 A;  1SKU B;  2Z0W A;  1QKW A;  4MZM A;  2EJF A;  4PFO A;  4L5G A;  3JCM h;  1S72 T;  5GMK m;  1HXD A;  2D9T A;  4FW2 A;  4RMO A;  4ELY C;  5GJV B;  2CSQ A;  3CCQ A;  3JCM b;  2MWO A;  4LN2 A;  1M3A A;  2KRS A;  3CXC A;  5KYN A;  2RK1 A;  1TU0 B;  2YUN A;  3OYG A;  4GBQ A;  2L3Q A;  3CC4 T;  1UGP B;  3ZFJ A;  2KRO A;  1Q7Y R;  1UUE A;  1B34 A;  2YSQ A;  4BE2 A;  1YHQ Q;  1TH7 A;  4ZTF A;  1Y71 A;  2AT1 B;  3I55 Q;  2YT6 A;  5LJ5 j;  1M1K U;  2XDD A;  2QYZ A;  4JRK A;  3CCM A;  1C0M A;  3JB9 F;  3CBP A;  2JS2 A;  2PUK B;  3H0H A;  3CC7 Q;  1AOJ A;  2KGT A;  1V1C A;  5GAN 8;  1RAH B;  1BIB A;  2CP2 A;  2V8I A;  3QDF A;  4NL3 A;  4ATO A;  3G71 A;  1PRM C;  2OTL Q;  2OI3 A;  2EWN A;  1NLP C;  3PMT A;  3J80 E;  1RAF B;  3MP6 A;  1SSH A;  1EX4 A;  1KD1 R;  3QWX X;  2PVO B;  4F7U B;  1SHG A;  2GF7 A;  1WHG A;  4RG8 A;  5IXF A;  2DEQ A;  3TCJ A;  1LJO A;  4R55 A;  2CS7 A;  2RHX A;  3O5Z A;  1I4K 1;  2ZCF B;  3P8B B;  2A08 A;  4ZGE B;  4NOY A;  1TTH B;  1NG2 A;  1GRI A;  3VRY A;  1RL2 A;  1E6H A;  1D09 B;  2HNI A;  2RK2 A;  4F17 A;  3M54 A;  1M27 C;  1S1N A;  3KXT A;  3MP1 A;  2JJ9 A;  1ZSZ C;  4KBM B;  1VQ9 Q;  1YCS B;  1JQQ A;  1X6G A;  4E7L A;  5CQX A;  3ZL7 C;  5LL6 S;  4J83 A;  3CD6 Q;  3GP8 A;  3OSV A;  1SPK A;  2QG9 B;  4LDW A;  2NUT B;  5CIU A;  2KBT A;  4CC7 A;  3GPL A;  2HQH A;  1BI3 A;  1Y7X A;  1NM7 A;  1TG0 A;  3M4G A;  4PJO D;  1OYX A;  2FRY A;  4C5E A;  3EG9 B;  4ZGJ B;  2FZK B;  2DET A;  3R6O A;  1W1F A;  2FHD A;  2HSE B;  3FRN A;  4C8Q A;  4HT9 A;  1YWP A;  5HK3 A;  3KUF A;  2WSF E;  5GAN j;  3CCR A;  1F1B B;  1K8A U;  1VQ4 T;  3M0U A;  4M75 D;  4J6W A;  2XMF A;  3TSZ A;  5LJ3 f;  1VQ8 Q;  3L1A A;  2DNU A;  2V26 A;  1ARK A;  1WHJ A;  2CT3 A;  4DBH A;  5LJ5 d;  4EMH A;  1AZG B;  3CCL T;  1XOV A;  3L2V A;  4RTV A;  4RTY A;  3EGX B;  3C4S A;  2DK3 A;  2JN0 A;  2RQT A;  2YUO A;  2OX7 A;  3S3N A;  1T3S A;  3PTA A;  2EGC A;  5GAN h;  2D0N A;  4KT0 E;  2LP5 A;  2X3W D;  5KYY B;  4OMM A;  1M1K C;  5GAN 6;  1K4U S;  2ZGW A;  5GAM d;  3QJY A;  1KC8 C;  2RN8 A;  2V8K A;  1G3S A;  3C0C A;  1W70 A;  5IHN A;  1G5V A;  3NPF A;  3GLX A;  5GAO l;  1KD1 U;  2EAY A;  3FB9 A;  2MMP A;  1UDL A;  1WJS A;  3PE0 A;  1X43 A;  1Q95 G;  1W2B S;  2O31 A;  3CBM A;  1X69 A;  1O9S A;  4A63 B;  1OI1 A;  2OAU A;  1NBE B;  1BI2 A;  2LJ1 A;  3JAM E;  2DL4 A;  1WIE A;  1YJN A;  2V1R A;  1UGR B;  2VAS A;  2RPN A;  5J3B A;  2RHZ A;  1Q81 C;  1PKS A;  1QLY A;  3FIF A;  5LJ5 e;  2DM1 A;  2Y90 A;  4QQD A;  2E6N A;  5FRO A;  1M2V B;  2DXT A;  3SWN C;  1VQ8 A;  4C8Q B;  2DXB A;  4M7A G;  4ANJ A;  1YIT T;  2GGR A;  1VYU A;  2EQM A;  3EG9 A;  2L5Q A;  2G3R A;  1AD5 A;  3DKM A;  2A7Y A;  4C92 B;  2MPX C;  1IRX A;  1T3L A;  3CCE Q;  1WQ7 A;  2EYW A;  5FW9 A;  1JEG A;  2YUP A;  3M0P A;  1SG5 A;  3QPH A;  2D1X A;  1CKB A;  2E4H A;  4YTL A;  3CCV T;  4M75 F;  3HTR A;  2YRC A;  3VS3 A;  1MV0 B;  2DEU A;  3JCM J;  5D7U A;  6AT1 B;  1VQO A;  5GAN d;  5I2S A;  3OBW A;  1TUD A;  4EDU A;  1VQ7 Q;  4BB7 A;  4K11 A;  4A4E A;  3ZBD A;  1WJQ A;  2CZ0 B;  4RTU A;  2GQI A;  2IIM A;  4CI0 C;  1GBQ A;  1YP5 A;  3ASK A;  1FMK A;  1VQL A;  4FYY B;  1ZQ1 A;  2G6F X;  2HL3 A;  5CVI A;  4C0D B;  2DBK A;  2X9H A;  1H3H A;  1D3B A;  2LX9 A;  2O9S A;  3OMG A;  1VQK A;  1K9A A;  2P4R A;  1UB4 A;  3CCS T;  4ZN3 A;  3CME Q;  3EFO B;  1LVK A;  4M78 E;  5LJ5 f;  2EJ9 A;  4PKC C;  4BE0 A;  1KHC A;  5KYW B;  1VQ5 T;  2QQR A;  2ZPG B;  3A98 A;  3QBY A;  4WF2 A;  1W2B P;  3BW1 A;  1D3B B;  3V7S A;  4DOW A;  2BIV A;  2DRK A;  1XNI A;  4A54 A;  3QDR B;  4RTZ A;  5A0D A;  4MDX A;  5FWC A;  1ZUU A;  4J9B A;  5HY6 A;  1G3T A;  1KK7 A;  4XTV A;  1U5S A;  3CCQ T;  4JRP A;  2A37 A;  1N8R R;  3HSB A;  4ORZ A;  2J6O A;  1D0Y A;  4M7A E;  2FRW A;  4CC2 A;  1B34 B;  3OW2 A;  1YJN Q;  3CCS A;  4ZN1 A;  1VQ6 A;  1VQP T;  3I55 A;  1EIF A;  5D6Y A;  1KC8 R;  1N5Z A;  1EZZ B;  3BDU A;  2HZY A;  4E47 A;  2WSE E;  1ZBX A;  2V8J A;  2H8H A;  1AHJ B;  2KSS A;  5GAO q;  8ATC B;  2FL7 A;  1M90 C;  2XIC A;  1NYG A;  1TS9 A;  1ZSZ B;  3LLR A;  1S72 A;  3JCM Q;  2K6D A;  3CMA Q;  2DRM A;  1Q82 R;  5KE3 A;  3LX7 A;  1QCF A;  1Q86 C;  1I5O B;  5FLX E;  1YJN T;  3MHX A;  4C92 D;  2H3J A;  4IUQ A;  2FZG B;  1WI7 A;  1C1A A;  4QQG A;  4IUP A;  1JJ2 A;  2DBM A;  2MIO A;  2K5F A;  3JV3 A;  2PUO B;  2DO3 A;  1MMD A;  5GAM g;  2DL5 A;  4II1 A;  1U1S A;  1WDX A;  2EYX A;  3R6N A;  2XID A;  1UG1 A;  1H8K A;  4PJO C;  4J9G A;  4PJO A;  4IUR A;  2J06 A;  4CC4 B;  3CME T;  1MND A;  4C92 G;  3ME9 A;  4JPB W;  4WTO B;  1V29 B;  3GF5 A;  5EG2 A;  2LT4 A;  2E12 A;  2CKK A;  4F7U F;  2FO0 A;  3CPW A;  3OB9 A;  1VA7 A;  1ZA2 B;  5IT9 E;  2QXF A;  2EKO A;  2F2W A;  1YCY A;  4M4Z A;  2X4J A;  5GAN 3;  1KIK A;  2LZ6 B;  2SEM A;  3C95 A;  4ESR A;  4NL2 A;  4XK8 E;  4M7A D;  2RJD A;  1X75 C;  2KEA A;  4J7I A;  3M0T A;  1PRL C;  3L2W A;  4Y28 E;  2DLP A;  3NGP A;  4C5I A;  1VQ4 A;  3OYN A;  4EMK C;  3CCV A;  5GAO p;  4B6M A;  1M30 A;  4M7D F;  3I5R A;  1X6O A;  2QAZ A;  3NHN A;  1VQ9 A;  1ZUY A;  2GTJ A;  2QTX A;  4DBR A;  2JM8 A;  2MWP A;  3EGX A;  5I21 A;  1WHM A;  1G2B A;  3RMQ A;  1YJW T;  2FVU A;  2O4X A;  1Q7Y U;  2XDP A;  5L23 A;  1MMA A;  2HMA A;  4NS5 A;  3CPF A;  4J9H A;  4RTT A;  3QII A;  3CCU Q;  1RI9 A;  1HYO A;  1M1K R;  3MCA B;  3RKY A;  3VS2 A;  1KG1 A;  2ED1 A;  2QQ9 A;  3JCM g;  4KH0 B;  4EPC A;  1GL5 A;  4OB0 B;  3KBG A;  4M77 C;  1I0C A;  3CMA T;  3CCS Q;  2DVE A;  4PLL A;  3HKS A;  2L89 A;  3CCE T;  3UAT A;  2LRQ A;  4PJL A;  1NPR A;  4A4F A;  2HBP A;  1VOM A;  2KE9 A;  5GAN g;  2E1H A;  3CCR T;  4KUI A;  1SHF A;  4QW2 A;  1UHF A;  5AT1 B;  1NEB A;  2EBP A;  1X01 A;  3MP8 A;  1R0B G;  4F04 B;  1MV3 A;  2YDL A;  1KD1 C;  3U23 A;  3CCR Q;  4M7D G;  2PVG B;  2COY A;  5IN1 A;  2MK5 A;  3P8H A;  2JW4 A;  4E7S A;  1JO8 A;  4F16 A;  3X24 B;  5L8R E;  3L2U A;  2KXD A;  2QDL A;  2K9G A;  4FSS A;  2P4T A;  3THK A;  5GAO n;  4QT7 A;  1Q82 U;  3S3M A;  1OX9 A;  1GCP A;  4E7Z A;  1GFD A;  3C12 A;  3REB B;  4C92 E;  4JZ4 A;  2K3X A;  5GAN 5;  3OS2 A;  2P0Q A;  1T0H A;  1N8R C;  3LH5 A;  1KQS A;  2C06 A;  4XTZ A;  5KE2 A;  3M4Y A;  2DAQ A;  2DXC A;  4UC4 A;  3S6W A;  2RA2 A;  3HFN A;  2V1Q A;  5KYU A;  1GFC A;  3VU3 C;  4QVZ A;  1DJ7 B;  1K0S A;  1UEC A;  3VUZ A;  5GAN 7;  2RHI A;  3VS5 A;  1I81 A;  2NWM A;  3CCU A;  4HCK A;  2FPF A;  2LCL A;  2K5L A;  4OML A;  1BU1 A;  2HL5 C;  3DB3 A;  4ZNX A;  4PJJ A;  1ABO A;  3X25 B;  4OF1 A;  2O4X B;  4M7A A;  3QSU A;  4KGX B;  2FZC B;  2X4W A;  1KC8 U;  3I35 A;  3SB2 A;  3O8V A;  1YIJ T;  2A36 A;  1TOV A;  2QK0 A;  1M2O A;  2FG0 A;  1TWB A;  4M78 D;  1U1T A;  2D8J A;  3FLG A;  1YHQ A;  4XU2 A;  4M78 B;  2AK5 A;  3CC4 A;  1QCO A;  4JJD A;  5CKF A;  2E65 A;  4OB3 B;  1RAA B;  2OTJ T;  1NYF A;  2XK0 A;  2CH4 A;  2DIL A;  1SRM A;  5A0L A;  2FYK A;  2AIR B;  3CCL Q;  3VV0 A;  1IB8 A;  2XHC A;  8AT1 B;  1K73 R;  3EAE A;  3HRS A;  3PIO A;  1VQ9 T;  4HCC A;  3FEO A;  3S3O A;  4FSX A;  2M1H A;  2A28 A;  4C92 C;  1B3Q A;  3G7Z A;  2NUZ A;  4J9C A;  2IVW A;  4PNO A;  4PJO B;  3G6E A;  1WJR A;  1K1Z A;  5LJ3 g;  1GXI E;  2OTJ A;  2LC4 A;  4M75 A;  3I56 T;  3CCJ Q;  3G1J A;  1YI2 T;  2CH4 W;  2OTL T;  1YJ9 A;  1HK9 A;  2JTE A;  4OMP A;  3I56 A;  2VGN A;  1OEB A;  4JJB A;  1VQ6 T;  1H92 A;  4J5Y A;  1MMN A;  2F2X A;  3TVT A;  2QGG A;  5FRN A;  4JDS A;  2GTO A;  4M7A C;  1UTI A;  1RAC B;  1VQN Q;  4X1V A;  3OW2 S;  3PT9 A;  1QMC A;  4LDV A;  2HBW A;  1E6G A;  4EMK B;  2E3I A;  4N4G A;  1AVZ C;  2NUP B;  5LJ3 d;  3NTI A;  4OB1 B;  2AZS A;  3L2R A;  2ZPE B;  1PG5 B;  1Q82 C;  4FM4 B;  1I5L A;  1XJW B;  1Q86 U;  2WAC A;  1R8O B;  3GIB A;  4C0F A;  2ABL A;  1PC0 A;  2QGF B;  4FT4 A;  4J6X A;  1N8R U;  2HKQ B;  1M8V A;  3WVE B;  2NLU A;  1MGQ A;  3M0Q A;  4XTY A;  2OAW A;  3CME A;  4QVD A;  5GMK i;  2BE9 B;  3H41 A;  3OYL A;  1QKX A;  1M90 U;  4N0A A;  2LQW A;  1YHQ T;  1RAI B;  4FYV B;  1QP3 A;  1KQ1 A;  3EFO A;  3OYD A;  2JZ2 A;  3OYC A;  4KUL A;  4M77 D;  4RCC A;  4RCB A;  3OW2 P;  1P92 A;  1BCM A;  3JCM V;  2HCK A;  2KVQ G;  1VYV A;  4Q5W A;  1VQM A;  4AG1 C;  4LE9 A;  2CSI A;  1YWO A;  5LJ5 g;  2DL3 A;  5M9O A;  4Y91 A;  1NJI C;  1VQM Q;  2X4X A;  1QW1 A;  5GAN 4;  1W2B A;  2M9U A;  3BFM A;  3JB9 G;  3GBQ A;  3QJ6 A;  4ME7 A;  4PLI A;  1K76 A;  2L8D A;  1N6A A;  3QYG B;  3QZ5 B;  5C0M A;  2RH2 A;  1TSF A;  2CZ1 B;  4R0K A;  2QA4 Q;  4XTX A;  3REA B;  2JS0 A;  1M1F A;  2BUD A;  3FC3 A;  1Z9Q A;  3LWI A;  2LX7 A;  1FXX A;  2K7A A;  4XQ3 A;  2D8H A;  2JNG A;  1UJY A;  3JB9 D;  1D1C A;  3I55 T;  1O75 A;  4FYW B;  4JLI A;  3WVD B;  2XDB A;  1A0N B;  2Y4Y A;  2AHJ B;  1LCK A;  2Y4X A;  4MZT A;  4C0G A;  1K9M C;  2ZPB B;  4PJO G;  2E3H A;  2O01 E;  2HSP A;  1JXM A;  3NTH A;  4JUV A;  2XD0 A;  1K8A R;  3M56 A;  4OMQ A;  1HD3 A;  4C0Z A;  4LUD A;  5DY9 A;  3MEU A;  3EGD B;  2RQV A;  2K57 A;  4XU0 A;  2JUF A;  2VYT A;  3E9F A;  1BYM A;  4M7D B;  4DA4 A;  1SF9 A;  1I1J A;  3IQL A;  2DTI A;  3A1P A;  2J6K A;  1X6B A;  3V7R A;  3H8Z A;  4PJN A;  2LQK A;  3JCM c;  1IHV A;  3UDC A;  2DE0 X;  2RHU A;  2D0Q B;  4M78 F;  1D0X A;  4HVW A;  3OYA A;  3X20 B;  5KH6 A;  2MI6 A;  3EFR A;  1WHH A;  2RB6 A;  4LDU A;  3OYH A;  1YJ9 Q;  1T0J A;  4M7D A;  2YRV A;  4HA8 A;  4MML A;  4DOV A;  1U3O A;  4AFZ C;  1WNL A;  2KT8 A;  3EGD A;  4GLK A;  1KHI A;  2X3X D;  4OGC A;  2EKH A;  4Z8A A;  4M7A F;  2OJ2 A;  1RAB B;  3HL8 A;  1FMW A;  2JMA A;  1M3B A;  3JCM f;  2B86 A;  2E41 A;  2GBQ A;  4M78 C;  1YI2 Q;  1W4S A;  1IGU A;  2DL7 A;  2CP6 A;  2EYQ A;  3OYI A;  2DTO A;  1I8F A;  5KYY A;  3PVQ A;  1PSF A;  1ABQ A;  2CUB A;  2VWF A;  5CAI A;  1C6V X;  3RMS A;  1M9S A;  1RI0 A;  4A4G A;  1VIE A;  2BZ8 A;  5HCK A;  3FJ5 A;  3CMA A;  3JCM e;  4PJM A;  2J05 A;  1M3C A;  4C0D C;  4OP0 A;  1RAG B;  4AFS C;  5IAY A;  4BD3 A;  4J9E A;  2JVV A;  5KCO A;  4KH1 B;  5GAM j;  2E10 A;  2XU8 A;  3JCM d;  3NMZ C;  3QHS A;  1YNZ A;  4PJO E;  1ZA1 B;  1WQW A;  1FYN A;  4TVR A;  3CQT A;  2EW3 A;  2M02 A;  5FU6 C;  3MO8 A;  2DYB A;  1ZBJ A;  3AT1 B;  4KRT A;  1MHN A;  4E7J A;  3M9Q A;  4M77 G;  2RMO A;  4MZP A;  2LJ3 A;  1GCQ A;  1Z9Z A;  1Q81 U;  1M8M A;  3PFS A;  1NPP A;  4VUB A;  4C8Q E;  2RQW A;  3CCE A;  1D1B A;  2O88 A;  3V8J A;  3VS0 A;  2CZ7 B;  3URG A;  5C6S A;  4XU3 A;  3SD4 A;  2ECZ A;  3G71 T;  3HP9 A;  2YRD A;  1YJ9 T;  3CPW P;  4PK4 A;  2K3B A; 
#chains in the Genus database with same CATH homology
 3REB B;  1YCS B;  1JQQ A;  1X6G A;  5IHK A;  4JZ4 A;  3ZL7 C;  1WXU A;  2EPD A;  1T0H A;  3LH5 A;  1SPK A;  2I0N A;  2VVK A;  4HVU A;  4JJC A;  3EG0 A;  2L0A A;  2KBT A;  4CC7 A;  4OMO A;  2V1Q A;  1GFC A;  1QWE A;  1Y57 A;  1NM7 A;  1TG0 A;  2KT1 A;  5I11 A;  1WYX A;  2JT4 A;  2FRY A;  4Z88 A;  1K0S A;  1GCQ C;  1UEC A;  3QWY A;  1W1F A;  2JXB A;  2NWM A;  3VS5 A;  2W0Z A;  2PZ1 A;  4AFU C;  2RQU A;  4HCK A;  2C0O A;  1OPL A;  1YWP A;  2FPF A;  2O2O A;  4OML A;  1BU1 A;  4ZNX A;  2KRN A;  2HDA A;  3M0U A;  2XMF A;  1ABO A;  3TSZ A;  2DNU A;  2EYZ A;  1ARK A;  4J9D A;  2CT3 A;  1AZG B;  1NLO C;  1XOV A;  3I35 A;  4RTV A;  4RTY A;  1PKT A;  2M0Y A;  2YUO A;  2RQT A;  1X2Q A;  2DJQ A;  2A36 A;  1T3S A;  2EGC A;  2D0N A;  1WXB A;  2LP5 A;  2X3W D;  1CSK A;  4OMM A;  2FG0 A;  2YUQ A;  1K4U S;  2PNI A;  3EG2 A;  2C0T A;  2D8J A;  4WCI A;  1RUW A;  2CUD A;  2RN8 A;  2AK5 A;  4Y92 A;  4JJD A;  1E7O A;  3C0C A;  1W70 A;  3VS1 A;  3SHW A;  5IHN A;  4AG2 C;  3NPF A;  1UGV A;  2K2M A;  1NYF A;  1UDL A;  2CH4 A;  2DIL A;  1SRM A;  1AWO A;  2BTT A;  3PE0 A;  1X43 A;  2DA9 A;  1BBZ A;  1J3T A;  2O31 A;  1X69 A;  4A63 B;  2A28 A;  2KRM A;  3KFV A;  1B3Q A;  2NUZ A;  4J9C A;  2AKL A;  1JU5 C;  5EC7 A;  2LJ1 A;  2DL4 A;  1WIE A;  2ESW A;  2V1R A;  4LUE A;  2RPN A;  3H0I A;  2MCN A;  1PKS A;  4J9F A;  2SRC A;  1QLY A;  1UFF A;  3UA7 A;  1K1Z A;  2AKK A;  4F14 A;  2DM1 A;  2EQI A;  2W10 A;  2K79 A;  2ENM A;  2RF0 A;  1ZSG A;  2LMJ A;  1U06 A;  2CH4 W;  2GGR A;  1BB9 A;  1VYU A;  2ROT A;  3M0R A;  3PVL A;  2KXC A;  1AD5 A;  2JTE A;  4OMP A;  2AZV A;  1RLP C;  1PWT A;  3VS7 A;  2M51 A;  1OEB A;  2C0I A;  1T3L A;  2BZX A;  2O9V A;  4JJB A;  5I22 A;  1H92 A;  2F2X A;  4GLM A;  3I9Q A;  2EYW A;  3TVT A;  5FW9 A;  5GJW B;  1JEG A;  2YUP A;  3M0P A;  4IIM A;  1X27 A;  2D1X A;  1CKB A;  2JM9 A;  2LJ0 A;  2GTO A;  1UTI A;  3VS3 A;  1MV0 B;  1I07 A;  4X1V A;  2HBW A;  1E6G A;  2GNC A;  1OV3 A;  1AVZ C;  1RLQ C;  1TUD A;  2AZS A;  4DEY A;  4K11 A;  1B07 A;  4J9I A;  4D8D A;  1BK2 A;  4RTU A;  2GQI A;  5FWB A;  2IIM A;  3EGU A;  1GBQ A;  1YP5 A;  2FEI A;  1FMK A;  2ABL A;  2KR3 A;  2G6F X;  2DBK A;  2FPD A;  3VS4 A;  2RQR A;  1H3H A;  1ZLM A;  1OPK A;  2O9S A;  1AEY A;  3EG3 A;  3M0Q A;  2J7I A;  1K9A A;  4DEX A;  1WX6 A;  2DL8 A;  2OAW A;  2P4R A;  3H41 A;  2DMO A;  1QKX A;  1SRL A;  4IIO A;  2LQW A;  1UJ0 A;  2EVR A;  1WXT A;  3A98 A;  2JMC A;  1SEM A;  2HCK A;  2L3P A;  2DRK A;  2J6F A;  1VYV A;  4RTZ A;  5FWC A;  1ZUU A;  4J9B A;  4RTW A;  3UA6 A;  4CC3 A;  4AG1 C;  4LE9 A;  3UF4 A;  3H0F A;  2CSI A;  1U5S A;  1YWO A;  2BZY A;  2A37 A;  1UHC A;  2VKN A;  4ORZ A;  2CRE A;  2DL3 A;  2J6O A;  2FRW A;  4CC2 A;  2HEQ A;  3GBQ A;  4EIK A;  1X2K A;  2L3S A;  1K76 A;  2EGA A;  1IO6 A;  1N5Z A;  4R0K A;  2E5K A;  2H8H A;  3REA B;  2JS0 A;  1Z9Q A;  2LNH B;  2KNB B;  2LX7 A;  1NYG A;  2K7A A;  2D8H A;  1UJY A;  2CT4 A;  1KSW A;  1UE9 A;  2K6D A;  2KYB A;  2DRM A;  1A0N B;  1ZUK A;  3EHR A;  4AFQ C;  1W6X A;  1QCF A;  1LCK A;  1WFW A;  2HSP A;  1WI7 A;  1JXM A;  4OMQ A;  2DBM A;  1QWF A;  2MIO A;  2MOX A;  1HD3 A;  2CDT A;  3JV3 A;  4LUD A;  2DF6 A;  2RQV A;  4D8K A;  2DL5 A;  1Y0M A;  1WDX A;  2EYX A;  3R6N A;  1HSQ A;  1UG1 A;  1H8K A;  1YN8 A;  1AWJ A;  2EYY A;  1I1J A;  3M0S A;  4J9G A;  3IQL A;  4HXJ A;  2J06 A;  3RBB B;  1K0X A;  2J6K A;  1X6B A;  3EHQ A;  4CC4 B;  4JPB W;  1AWX A;  1VYT A;  2DE0 X;  4HVW A;  1CKA A;  1WA7 A;  5IHI A;  2LQN A;  4HVV A;  2FO0 A;  2DX1 A;  1VA7 A;  2FPE A;  1T0J A;  3VS6 A;  1U3O A;  2DVJ A;  3SEM A;  1NEG A;  1WLP B;  2F2W A;  4AFZ C;  1KJW A;  4M4Z A;  2KT8 A;  1KIK A;  2LZ6 B;  2SEM A;  5IH2 A;  4ESR A;  1PNJ A;  2X3X D;  2EKH A;  2ED0 A;  4Z8A A;  4RTX A;  2OJ2 A;  3RNJ A;  2KEA A;  3TSW A;  5IXB A;  3M0T A;  2JMA A;  1PRL C;  1M3B A;  1ZX6 A;  2B86 A;  1TUC A;  2DLP A;  2GBQ A;  3NGP A;  2DL7 A;  1HJD A;  1QKW A;  2KYM A;  3PVQ A;  1OOT A;  1M30 A;  5ECA A;  3I5R A;  4RUG A;  1AWW A;  1ABQ A;  3NHN A;  2CUB A;  2VWF A;  1ZUY A;  2GTJ A;  2JM8 A;  2LCS A;  1G2B A;  5GJV B;  2BZ8 A;  2CSQ A;  5HCK A;  3FJ5 A;  5L23 A;  4LN2 A;  1M3A A;  4LNP A;  2KRS A;  4J9H A;  2J05 A;  4RTT A;  1M3C A;  1RI9 A;  2YUN A;  1G83 A;  3VS2 A;  4GBQ A;  2L3Q A;  2ED1 A;  4AFS C;  2KRO A;  4J9E A;  1UUE A;  2YSQ A;  1GL5 A;  2EGE A;  1I0C A;  3NMZ C;  4OMN A;  4Z89 A;  2YT6 A;  2PTK A;  1YNZ A;  3EG1 A;  2JS2 A;  3H0H A;  3UAT A;  1AOJ A;  2KGT A;  1FYN A;  2KE9 A;  3CQT A;  1V1C A;  2EW3 A;  2RNA A;  1PRM C;  2ROL A;  1SHF A;  1UHF A;  2OI3 A;  1NLP C;  2DYB A;  1ZBJ A;  4KRT A;  1MUZ A;  1NEB A;  2EBP A;  2RMO A;  2LJ3 A;  1GCQ A;  1SSH A;  1JXO A;  1MV3 A;  1Z9Z A;  2YDL A;  3QWX X;  1M8M A;  3U23 A;  1SHG A;  4JZ3 A;  5IXF A;  1KFZ A;  1AZE A;  2RQW A;  2F2V A;  2JW4 A;  1JO8 A;  4F16 A;  3I5S A;  3O5Z A;  2O88 A;  2A08 A;  2KXD A;  3VS0 A;  2QDL A;  2K9G A;  4E6R A;  4FSS A;  1GBR A;  1PHT A;  1NG2 A;  1GRI A;  2ECZ A;  3VRY A;  1E6H A;  3THK A;  2L2P A;  4QT7 A;  3VRZ A;  4F17 A;  3ULR B;  1M27 C;  1S1N A;  1EFN A;  1GCP A;  1GFD A;  2K3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...