2A28A

Atomic-resolution crystal structure of the second sh3 domain of yeast bzz1 determined from a pseudomerohedrally twinned crystal
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
GAMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BZZ1 protein
publication title Structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 14
structure length 54
sequence length 54
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a28A00
4K11A 1FMKA 4RTWA 4F14A 2LJ0A 2J05A 1TG0A 4LE9A 1K76A 2X3XD 4GBQA 1K0SA 1X43A 3H41A 1SHFA 2L3PA 2DJQA 2D0NA 2PZ1A 2D8HA 2DL4A 1QKWA 4AFUC 2CH4A 1M3BA 3RBBB 4M4ZA 3M0QA 2DRMA 1W1FA 3VS4A 2A28A 1JU5C 2OJ2A 2A08A 3SEMA 1RI9A 2DL8A 2KT1A 5IHKA 1X2QA 3EG2A 4Z8AA 1WIEA 1AD5A 2LX7A 1UJYA 2FPFA 2G6FX 1I0CA 2RNAA 4DEXA 1OPKA 3VS7A 2FPEA 1KSWA 1MV3A 1YCSB 1CKBA 1WLPB 4GLMA 1X6BA 1QCFA 3THKA 1W70A 2DLPA 1YN8A 2LCSA 1HJDA 2D8JA 2AK5A 2DL5A 3QWXX 2ECZA 1KIKA 1AZGB 3VRZA 3TSZA 2O2OA 2XMFA 1QKXA 3QWYA 2AZVA 2NWMA 2PNIA 4Y92A 1A0NB 5GJWB 1H3HA 2JM9A 4Z88A 4IIMA 1WXUA 1K9AA 1NEGA 1OOTA 3M0RA 3ULRB 2K7AA 4IIOA 4R0KA 1U5SA 1M30A 1YNZA 2I0NA 1M8MA 5ECAA 2RF0A 3PVQA 1ABOA 1QWEA 1UE9A 2YDLA 2KYBA 1Y0MA 3R6NA 1CKAA 1JXMA 4KRTA 1UGVA 1YP5A 2O9SA 5FWCA 2CH4W 4OMNA 1UDLA 1AEYA 2RMOA 5GJVB 2EYYA 1G2BA 1X27A 2JMCA 1H8KA 2BTTA 2AKLA 2K9GA 2EGCA 2CT3A 1X6GA 2YUNA 4RTYA 2L3SA 1RLPC 2HSPA 2OAWA 4OMLA 2DBMA 2KBTA 1M27C 2L0AA 2RPNA 1OPLA 1AOJA 1ZUKA 4JJDA 3VRYA 1K0XA 1QLYA 1UFFA 1ZSGA 1ZX6A 4OMOA 1GFDA 4RTZA 4HVVA 1ZUYA 1JQQA 4OMPA 3NGPA 3EG0A 1ABQA 3M0PA 2VVKA 3ZL7C 2RN8A 3M0TA 2ED0A 1GRIA 3IQLA 5IXBA 5EC7A 1AVZC 2KYMA 3PE0A 2MIOA 3EGUA 1GCQA 2BZYA 3EG3A 2YT6A 2DX1A 2JMAA 4LN2A 1UTIA 2K3BA 1WXBA 4A63B 2EPDA 4HVWA 1K1ZA 1WFWA 2B86A 2JT4A 2ROTA 5FW9A 1WYXA 1MUZA 1GCQC 1RUWA 5HCKA 4J9GA 2PTKA 4LNPA 3UF4A 1WX6A 2F2XA 2FEIA 2CUBA 2EBPA 2F2WA 2X3WD 2LNHB 1NLPC 2EW3A 3VS2A 1Y57A 4AFQC 1NYFA 4JPBW 5FWBA 1I07A 2DL3A 1NEBA 4J9HA 1SSHA 3I5SA 1T3LA 2JS2A 2RQUA 1MV0B 2GTOA 2LJ1A 4JJBA 2CT4A 2HDAA 2KXDA 1Z9QA 2EGAA 3RNJA 4LUDA 1GBRA 2RQWA 1HD3A 2C0IA 3VS3A 1X2KA 2FG0A 2KRMA 2IIMA 2RQRA 3H0HA 4RTUA 1UECA 2CSQA 2K6DA 2JM8A 4D8KA 1BU1A 1PHTA 3FJ5A 5IHIA 2KNBB 1WXTA 2YSQA 4DEYA 4X1VA 5I22A 1N5ZA 1S1NA 2OI3A 1W6XA 2EYXA 2M51A 1UHFA 4OMMA 3EHRA 1SRLA 1VYTA 1U3OA 2SRCA 2EYWA 1B07A 1OEBA 3PVLA 2FO0A 3TSWA 4RTXA 1NYGA 1WA7A 1BBZA 2EGEA 3I35A 2KR3A 2HEQA 2EKHA 2O31A 1V1CA 3H0FA 1AWJA 1E6GA 1YWOA 4EIKA 2GNCA 2FRWA 2BZ8A 2YUPA 2LZ6B 2W0ZA 4LUEA 2ABLA 1XOVA 1ARKA 3H0IA 2AKKA 2D1XA 4WCIA 5L23A 1IO6A 2GBQA 2DE0X 1KFZA 3M0SA 2CDTA 1GBQA 5I11A 1HSQA 4RUGA 1K4US 2YUQA 2NUZA 2L3QA 1SHGA 4AFZC 1VYVA 2MCNA 3UATA 4CC3A 2KXCA 3EG1A 1VYUA 4CC4B 4ESRA 4JZ3A 3NMZC 3NPFA 2A37A 2JTEA 2QDLA 4CC2A 2LMJA 1OV3A 2VWFA 1U06A 3NHNA 4JJCA 1GL5A 2AZSA 2LQWA 1ZLMA 2J6OA 1PNJA 1VA7A 1E7OA 1BB9A 1TUCA 2K2MA 2DBKA 2LJ3A 2DM1A 3A98A 3I5RA 1GFCA 2DYBA 1FYNA 4RTVA 5IXFA 2M0YA 3KFVA 4HVUA 4JZ4A 2L2PA 3UA6A 2O88A 2A36A 2LQNA 2J6FA 1G83A 1CSKA 3CQTA 1JXOA 3I9QA 2DILA 4Z89A 2E5KA 2K79A 4J9DA 1WDXA 2FPDA 5IH2A 2KRSA 1AWOA 2CUDA 1M3AA 1ZUUA 1I1JA 2DA9A 1UG1A 4F16A 1B3QA 2CREA 2GQIA 2HCKA 1SRMA 2KROA 4ORZA 4D8DA 3LH5A 2SEMA 2ESWA 2H8HA 2BZXA 2LP5A 2ROLA 2JS0A 2C0OA 3VS5A 1J3TA 4RTTA 1RLQC 1T3SA 1AZEA 2W10A 4HCKA 2EQIA 2KGTA 4AG1C 2EYZA 2P4RA 1GCPA 4J9FA 4QT7A 3TVTA 2KEAA 3VS6A 2O9VA 3VS0A 1Z9ZA 2JW4A 1EFNA 1PWTA 4E6RA 1LCKA 2DVJA 2V1RA 1SPKA 2J6KA 2RQTA 1SEMA 2YUOA 2KRNA 2J06A 1H92A 4J9EA 2J7IA 4AG2C 2DNUA 2RQVA 2DF6A 4ZNXA 1T0JA 1JEGA 3U23A 1ZBJA 1AWXA 3GBQA 1JO8A 1NM7A 4J9IA 2ED1A 3JV3A 3C0CA 2GGRA 3REBB 1PRLC 4HXJA 1BK2A 1UUEA 2F2VA 1T0HA 1M3CA 2ENMA 1PKTA 3O5ZA 2V1QA 1QWFA 1PKSA 2KT8A 1TUDA 3UA7A 2GTJA 1YWPA 4J9BA 4AFSC 1X69A 2CSIA 2MOXA 4CC7A 2HBWA 1E6HA 2DMOA 2VKNA 2FRYA 4F17A 2DRKA 3SHWA 1UHCA 1KJWA 3REAB 1WI7A 4FSSA 1NLOC 2C0TA 2EVRA 2KE9A 1PRMC 3EHQA 5IHNA 3VS1A 1NG2A 2JXBA 4OMQA 1AWWA 1UJ0A 2DL7A 4J9CA 3M0UA
chains in the Genus database with same CATH superfamily
4K11A 1FMKA 3OW2S 2A0FB 4GBQA 4DQ2A 2JZ2A 1X43A 3HTRA 2CP5A 2DL4A 3CMAT 2LRQA 4EPCA 4M75B 3RBBB 3MPUB 3M0QA 1WHJA 2DRMA 1M9SA 4OB2B 1XJWB 1LOJA 1YIJA 3JCMQ 1VQMA 2R58A 2Z0WA 2WACA 2EJFA 1WIEA 2LX7A 1K8AC 4E7HA 2YXYA 1Q81U 2XDDA 1OPKA 3VS7A 4M78C 1YCSB 4OGCA 1F1BB 3C95A 3EGDA 4C5HA 2HD0A 1X6BA 2RJDA 3EFRA 3LGLA 3WVDB 4EMKB 4J5YA 4HCZA 1MNDA 3EFOB 3FLGA 3JCMf 2CS7A 1AZGB 5D6WA 3TSZA 4XK8E 1QP3A 1VQKA 3E9GA 1Y71A 2JM9A 4OMFB 4J7FA 3JSCA 4M7DE 1VQ9Q 4HKEA 4R0KA 3DKMA 3GIBA 4C8QF 1YNZA 2BKDN 3JCMJ 4GY5A 2RK1A 2E3IA 3TQ7P 3BDUA 3KBGA 5GAOp 2DXUA 5FU6C 1N8RC 1JXMA 3CMAA 4JJNK 1G8XA 1IZ6A 2WSCE 2RI5A 3SD4A 3G7ZA 1AEYA 4C8QD 1VIFA 2RI3A 1WPYA 4PJOF 4C92F 1RACB 2ZPEB 2M0OA 2AKLA 3CCRQ 2DZCA 1X6GA 5KYWB 4BDYA 2X4WA 4MMLA 3ZFJA 1D1CA 2OAWA 4PJLA 2KBTA 2RO0A 1Q82U 1M27C 1NPRA 2L0AA 1WQWA 4PJOD 4C92D 1OPLA 5FROA 1OZ2A 1ZUKA 5GAOl 3L2QA 1K0XA 1ZSGA 3QXEB 4RTZA 4HVVA 1JQQA 5GAOq 2CP3A 2RN8A 3M0TA 3RUXA 5EC7A 5CKFA 3HSBA 2KYMA 4LDWA 2LTOA 1G3WA 3T9NA 3E1SA 1B7TA 2I2LA 3LW5E 3JB9G 2HMAA 3G1JA 1W2BA 1MMAA 5IT9E 1WXBA 4A63B 4HVWA 1XTDA 3EH1A 2B86A 2R5MA 2JT4A 2DIQA 1MUZA 1IGUA 2PTKA 1WX6A 5L8RE 1OQKA 2F2WA 2DO3A 4XTWA 1PCXA 4N0AC 3VS2A 2RK2A 5FWBA 3VJPA 3CCEQ 4M77F 3I5SA 1N9RA 4ZN1A 2AHJB 2V8IA 1EZZB 4YTLA 2R57A 2YRVA 2XICA 4M78B 4KGVB 4O5VA 1KHCA 4M77D 1I8FA 1Z9QA 4PKCC 3RNJA 3A1PA 4PJMA 1YFNA 2EQKA 2RQWA 2IIMA 2RQRA 1UECA 3OMCA 4XTZA 4C0FA 3META 5LJ3g 3JAME 3JB9H 4ANJA 2CGHA 1IB8A 1G3SA 5AT1B 1UHFA 1SRLA 3JB9I 3PTAA 4WTOB 4C0GA 2EYWA 3QYGB 3MEUA 1Q95G 2M02A 3AHUA 5LJ3h 4E2FB 2EKOA 4JS5A 3TSWA 5HKCA 1WQ7A 4FYYB 2FYKA 2ZPBB 4MZMA 1YIJQ 1VQMQ 2HEQA 2X4YA 1UB4A 4EIKA 2K57A 2BZ8A 2LZ6B 3V8JA 1TH7A 1BI2A 4FYWB 1JB0E 3X25B 3H0IA 2D1XA 2FL7A 2DE0X 4LD6A 1VQLT 1KFZA 3FC3A 2QA4T 1WJQA 2DPPB 1K4US 1VQKQ 4M75A 1SHGA 5GMKi 1RAEB 4AFZC 1VYVA 4M7DF 1OX9A 2KXCA 3EG1A 2K4YA 4JRPA 3A8OB 1Q81C 4CC2A 2VWFA 1YHQT 3RDVA 4NL2A 2O4XB 2AZSA 2ZCFB 2DZ9A 4J6YA 1BB9A 5GAMg 4M7DD 5A0DA 4RMOA 3TCJA 4DBRA 1LJOA 2LJ3A 3MEWA 3A98A 3CCQT 2OX7A 3CMAQ 2LCCA 3INZA 1GFCA 2DYBA 2NYSA 2FHDA 3H8ZA 5GMKj 2PQWA 1FXXA 3UA6A 2O88A 2VGNA 4E7IA 2CP0A 1KQSA 5GANd 3CQTA 1VQNT 3FJPA 4Z89A 1QVPA 1KHIA 1M1FA 5GAMh 4DBFA 2HQXA 3PMIA 5IH2A 4XTYA 1ZA2B 4E7KA 2ZPFB 2CUDA 6AT1B 2KQWA 5FLXE 3RR6A 2QQAA 3RKWA 5CCAA 1SRMA 4ORZA 5LJ5j 3LH5A 1VQLA 2QA4A 2H8HA 3BFMA 1YBYA 5AYFA 2ROLA 4JRIA 2RHIA 2JS0A 1RLQC 3HRUA 1AZEA 2W10A 3OBYA 2OTJT 3FRNA 4E7SA 2MPXC 4IURA 3PIPA 2EYZA 1ZSZA 2M16A 4M77A 1Q82C 2EQJA 1PWTA 5KYWA 2DVJA 1YHQA 2C06A 2E1HA 1SPKA 2VXFA 1SSFA 1FX7A 2CP6A 1VQ6Q 4KGZB 5HY6A 2CYZB 3N5BB 3PGGA 3RMQA 4DOVA 1RAAB 2DNUA 3MP8A 3CCQA 5J26A 1T0JA 3F70A 3X28B 1ZBJA 4OB3B 3SWNC 1RI0A 1JO8A 1QVFS 3OYNA 2YHTA 1UEBA 1WJRA 4VUBA 1VQNA 2GGRA 1PRLC 4HXJA 3FIFA 3KUFA 4E47A 2F2VA 2ENMA 2DJZA 5DLOA 3O5ZA 2QQ9A 5HK3A 1IGQA 2QEXT 1PKSA 3M4YA 1TUDA 3CMET 4GLKA 2GTJA 4QVZA 4J9BA 4F7UE 4J6WA 2LQ8A 2CSIA 3FDRA 4FW2A 2EIFA 4CC7A 4AT1B 1QVGS 2DMOA 2DETA 2VKNA 4C8QC 2DRKA 4NOYA 3VKIA 2DYIA 2OTJA 3REAB 3L2UA 4FSSA 3RKYA 4JLGA 3CPWP 2C0TA 4BI4A 1NPPA 2RM4A 1YITA 3OY9A 3JRZA 3QYHB 5IHNA 4PJOC 4C92C 4PLIA 1OX8A 4DA4A 5EG2A 3HFOA 4J9CA 3M55A 2K5FA 1HK9A 4RTWA 1TG0A 4LE9A 3CEYA 3LH0A 2FZGB 1K76A 4KULA 1MHNA 1SHFA 1KG1A 2D0NA 2D8HA 3OS0A 3EGXB 2X35A 4M78A 3QKJA 2YLBA 4PJOE 3VS4A 2A28A 3QPHA 2OJ2A 1U1TA 1RI9A 1D0ZA 4LDUA 4O6JA 1OZ3A 3E9FA 1VQ8T 1PM3A 5LJ3e 1AD5A 3CMEA 1UJYA 2FPFA 4LXCA 3H9NA 3CC4T 2FPEA 1KSWA 3SDZA 1CKBA 3EAEA 3CCVT 1WLPB 1YN8A 2LCSA 2FVUA 2DL5A 3QWXX 4OB0B 2XMFA 1QKXA 1TS9A 2NWMA 3OW2P 4Y92A 2X4XA 3OS2A 2E65A 1VQPT 4Z88A 4FU6A 1FMWA 1K9AA 2QQBA 3ULRB 4X34A 3OMGA 5DLQE 3X20B 5C6SA 1M8MA 1BI0A 2DD5A 5ECAA 3PVQA 1QWEA 3PFSA 3RERA 2YDLA 5CKHA 1CKAA 3I56T 1B34B 1UGSB 4KRTA 1YP5A 1YJ9T 1UDLA 4BDZA 2RMOA 2EYYA 4PFPA 3JCMd 3A8LB 5GAOm 3CC2T 1R0BG 1M2OA 2K9GA 5FU7B 3BE3A 2CT3A 1BCOA 1FMVA 3OYJA 1Y7XA 4BACA 1VQ8A 1M1KR 4OMLA 1M8VA 3CC4A 3CXCS 3HP9A 2WSEE 1WHMA 2DFUA 4JJDA 5GAOr 4FW1A 5CIUA 5D7UA 1NBEB 5DY9A 4PL6A 2O4XA 1LVKA 3A8HB 5GAMe 4OMPA 1VQLQ 3AT1B 2QA4Q 2VVKA 3ZL7C 4FL6A 2ED0A 2QK0A 4C8QB 3A8MB 1GRIA 1ZHIA 2KDSA 3IQLA 1Q86R 1OULA 4E7JA 1VQPA 2MIOA 2BZYA 1EIFA 1PSEA 3TEEA 3CBOA 1D3BB 4PJJA 2DX1A 2JMAA 1YHQQ 2IPOB 4N0AA 4WF2A 4C92B 1K9MR 3ZBDA 4FCYA 3GNFB 3I56A 2JNGA 3CCQQ 2ROTA 1YJ9A 2HQHA 3MO8A 3CPFA 3QG1A 1KQSS 3A5ZB 3UF4A 7AT1B 2EBPA 3CC2A 1NLPC 1VQNQ 1M2VB 2EJ9A 1Y57A 2QTVA 5CK9A 4AFQC 4LD9K 1NJIR 1FWZA 2Y4XA 4Y28E 1NEBA 4HT9A 3M58A 4F7UF 1SSHA 5KE3A 4M7AE 3ER0A 4M7DC 3VYHB 2EAYA 3QJ6A 2HKNA 1D1AA 2GTOA 4Y91A 2LJ1A 4JJBA 5CVIA 1BCMA 1V29B 2V26A 3MCAB 2RHYA 3VU3C 2EGAA 4LUDA 1HD3A 2C0IA 1K73U 1RAHB 2E4HA 2FG0A 1VQ5T 2OTJQ 5DM7R 2NUTB 2DAQA 4RTUA 4FT2A 3L1AA 2CSQA 3UT1A 2EJGA 2JM8A 4QW2A 1YITQ 1BU1A 3FJ5A 2KNBB 2RHZA 1TSFA 4DEYA 5I22A 1PG5B 2D6FA 1S1NA 1W6XA 4HCCA 2M51A 1N27A 8AT1B 2SRCA 3GP8A 2FZKB 1ZSZB 3QO3A 4M77B 2ZPHB 1I5LA 3MJXA 1NYGA 1WA7A 3L2ZA 3I35A 2EKHA 3J7AF 3I55T 1E6GA 1D0XA 2FRWA 3CBPA 4FM4B 3CMEQ 3JCMb 2W0ZA 4LUEA 3GF5A 4WCIA 4NL3A 4LDXA 5GAN3 2JTFA 3BDLA 3HPWA 3VUZA 2F5TX 2JOYA 4JLIA 1GBQA 5I11A 3ASKA 1HSQA 4MZPA 4RUGA 1WHHA 1VQ5A 1IXDA 2L3QA 3EGXA 3L42A 4QQDA 2COWA 4QVCA 4FSXA 3UATA 4CC3A 4ESRA 2JTEA 2YLCA 3GOXA 1OV3A 5CKEA 3NHNA 2LQWA 1KD1R 4B9XA 1O75A 1AT1B 1VA7A 1S72Q 1QCNA 3HRSA 4HCBA 4RTVA 5GANg 4JZ4A 4ELZC 2LQNA 2J6FA 4A4HA 3TREA 1CSKA 5IN1A 1JXOA 3I55A 2K79A 4AMCA 3X26B 1VQ8Q 2KRSA 1WJSA 3DB3A 3CC4Q 1ZUUA 1H641 1I1JA 2B8AA 5GANh 2F69A 1B3QA 3KXTA 2MYSA 1X01A 4ZGJB 4M7DB 4EMGA 4D8DA 2SEMA 4CRIA 2ESWA 2GFAA 4PLLA 2OTLT 5GAN4 1B34A 3BW1A 1WHKA 4AG1C 3RESA 2PU9B 2HL5C 4QT7A 3QSUA 3VS6A 2O9VA 3VS0A 4ZGDB 2BUDA 3SWNA 1MMDA 2JW4A 4N4HA 2ZGWA 4KBMB 3ZEHA 3PNWC 2KRNA 1H92A 2J7IA 5KCOA 3I56Q 3OS5A 5FU6B 3CCMT 2DF6A 1R8OB 2E5QA 3MEVA 1M90R 1YJ9Q 5FRNA 3U23A 1JEGA 2RB6A 3MEAA 3CPWA 2CKKA 3SFMA 1NM7A 4QQGA 2ED1A 3JV3A 3CC2Q 4C8QA 2FZCB 3OYLA 1BK2A 2X51A 2MI6A 4J7IA 4M7AF 1V76A 1JJ2A 2RJFA 1D3BA 2DERA 1QP2A 3OYCA 4PJNA 1YJNT 4PJOA 4C92A 2RH2A 4M7AD 3OYDA 3LX7A 3OQ5A 3QDFA 2OTLA 1KC8R 1OU9A 4XU1A 3SHWA 1KJWA 1WI7A 2XIDA 3E19A 5A0GA 3P8HA 3M54A 4PK4A 3L2VA 2HZYA 1M2VA 3EHQA 2RJCA 1X75C 2VGMA 3SB2A 2CP7A 4IUTA 1QVFP 2LJ0A 3RIRA 1R77A 5KYNA 3H41A 3NTKA 2HKQB 2DJQA 2PZ1A 1K73C 1C0MA 4AFUC 3OW2A 3QZ9B 1C1AA 1M3BA 4IUQA 3LWIA 1PC0A 4RG8A 1W1FA 2H3JA 1QVGP 2A08A 2NUTA 5IHKA 1U8RA 1X2QA 3EG2A 4Z8AA 1KQ2A 1UGPB 4XU0A 2PVOB 2G6FX 2LT4A 1I0CA 5GAN5 2QQSA 4XTUA 5CQYA 1YJNA 5LJ5d 4GLMA 1UGQB 2K2VA 3CCJT 2DLPA 1ZQ1A 1HJDA 2QGFB 2ECZA 1KIKA 2O2OA 3L2WA 3QWYA 2A3LA 1VQ5Q 2PNIA 1A0NB 4MDWA 1VUBA 3LYIA 1IREB 1OOTA 3M0RA 3J80E 4IKFA 3MKDA 3G71T 1M30A 2I0NA 5LJ3j 1WHLA 3LGFA 2JJ9A 4LDYA 1Y0MA 3R6NA 8ATCB 3CCLT 1UGVA 2O9SA 4C0DC 4Q5WA 2PUKB 3JCMg 4C8QG 2E3HA 1BIAA 1X27A 3LWHA 2GCXA 1H8KA 3HHTB 1JBMA 4E7ZA 5D6XA 4RTYA 2X4JA 2HSPA 2G3RA 3C4SA 2DBMA 3R6OA 1DJ7B 5KYUB 4RKUE 4II1A 3JCMh 1BKBA 2RPNA 5A0LA 4UC4A 1Q7YR 4C92G 4JUVA 3P8BB 4F04B 3VRYA 1QLYA 1UFFA 1ZX6A 1GFDA 4M75G 3CCJA 1ZUYA 3DLMA 3EG0A 1N9SA 1ABQA 5D6YA 3JB9F 2E6NA 4FIBA 4HA8A 5GANe 2DEQA 3G6ET 3Q1JA 4BE1A 2RJEA 2D9TA 3PE0A 1W2BS 3EGUA 5LJ5f 1YI2T 4X9DA 3EG3A 1RAFB 2YT6A 2E6ZA 3G71A 3OYKA 3JB9D 2R5AA 4IUPA 1TWBA 3LLRA 1UTIA 4OP0A 3D7SB 4X9CA 2K3BA 1M1KU 2QYZA 3RMSA 1WFWA 3CCLA 4XTVA 5FW9A 2KVQG 4BB7A 1BIBA 5GAMj 1GCQC 4M7DA 1RUWA 2RA2A 4J9GA 4LNPA 2F2XA 3CXCP 1D09B 3VV0A 2QEXA 2XK0A 5I2SA 3CC7T 2DKGA 2LC4A 1EX4A 1NYFA 2Y90A 1JRIA 1Y07A 1Q86U 1I07A 1K8AR 2DL3A 1T3LA 2JS2A 2RQUA 1KK7A 4PNOA 4ZN3A 2QQRA 2HDAA 4A54A 3GPLA 4EMKC 3VYGA 2KXDA 1K9MU 4ATOA 1U1SA 2OTLQ 4M77G 1NE8A 2E64A 3VS3A 5HK0A 3G6EA 1LNXA 1OYXA 2KRMA 2DTOA 2F5KA 3H0HA 1QCOA 4D8KA 1PHTA 5IHIA 1YI2A 1WXTA 3HL8A 2ZAEA 1MMGA 5CQXA 1X6OA 3HRTA 1KQSP 1N5ZA 4ELYC 4OMMA 3EHRA 1VYTA 1NJIU 1N8RR 2LCLA 2A7YA 3OYEA 1BI1A 2E10A 2LVMA 4F7UB 1B07A 2VXEA 3P8DA 1OEBA 1XNIA 2ATCB 2K3XA 3SWNB 3PVLA 2FO0A 4C0DB 3CC7A 1BBZA 2KR3A 1NZ9A 2P0PA 2LX9A 1YWOA 4JDSA 2P0QA 4QQ6A 2GNCA 1JJ2S 2GFUA 2YUPA 3CCVA 2ABLA 2NUPB 1XOVA 4FYXB 5GAMf 5LL6S 1YJNQ 5L23A 4D6WA 2CZ7B 2DD4A 1SKUB 1SF9A 9ATCB 1IRXA 2NUZA 2YUQA 2PVDB 1MGQA 2CZ0B 2MCNA 4N4GA 3JCMX 3DLLA 2XU8A 4NS5A 2L5QA 2NLUA 3M57A 4CC4B 4BI3A 4PJOB 3NTIA 5GAN7 4BI8B 3JCMP 2IVWA 4JJCA 3M5AA 3M9QA 2J6OA 4M78G 3OYYA 4M7AC 1VOMA 4C0ZA 1E7OA 4M7DG 2K2MA 2DBKA 2KK4A 2DM1A 3I5RA 3OYFA 2VYTA 2CP2A 5IXFA 2M0YA 2YRCA 4HVUA 4ZGEB 2L2PA 1PD0A 2A36A 1G83A 1I81A 3I9QA 2DILA 2EQMA 1G5VA 2K5LA 4BE2A 1ZA1B 1HXDA 1WDXA 2FPDA 3MP6A 3M53A 1Y96B 5CO7A 3CCUT 2WSFE 5KH6A 1M3AA 2DA9A 2MWOA 2XI9A 2CREA 3QIIA 2GQIA 2HCKA 4A4EA 5A2QE 3CCJQ 1KD1U 2LP5A 2C0OA 3VS5A 1J3TA 1WHGA 4L5GA 3JCMe 3PT9A 2EQIA 1TTHB 2KGTA 2Y4YA 4XQ3A 5J39A 4FT4A 5KYXA 2P4RA 1GCPA 3A8GB 3L2RA 2LT1A 3TVTA 1EFNA 3G71Q 2PUOB 4E6RA 1LCKA 2E12A 4M78E 5CKDA 3WXMB 1D0YA 1PSFA 1G3TA 2J06A 2COYA 5KYUA 1VQ6T 3CCLQ 2RQVA 4ZTFA 2JUFA 3GBQA 4L59A 3V7SA 4DBHA 3S3NA 1PD1A 4J9IA 3C0CA 2DIGA 3QJYA 2XG8D 2QEXQ 3S6WA 1UUEA 1T0HA 1M3CA 4FYVB 1MNEA 2MF2A 1QVFA 1QWFA 4XAXB 3CCUA 2KT8A 2LDMA 4M75F 4AFSC 1X69A 1M1KC 3M59A 2AT1B 3URGA 1E6HA 4RG2A 4RCBA 1RADB 4ZTJA 4M75D 1QVGA 3OSSC 2KSSA 1UHCA 3V7RA 3G6EQ 1M90U 3QZ5B 1Q86C 2EVRA 1Q81R 2KE9A 4QKUA 3WVEB 1YI2Q 1XQHA 1PRMC 2QASA 3VS1A 1NG2A 2JXBA 2YRDA 1UJ0A 2DL7A 3M0UA 1TXQA 4F14A 2VV5A 2J05A 5C0MA 4KUDK 5GAOn 3V7CA 2X3XD 1K9MC 1K0SA 3CD6T 1VQ6A 2L3PA 4M7AB 4R56A 1QKWA 2CH4A 4BY6C 1K73R 1R0CB 4M4ZA 4Z02A 3CC7Q 1JU5C 1KC8U 3SEMA 2DL8A 5GMKh 2KT1A 2DEUA 5FRMA 1I5OB 4KGXB 2VASA 1M1GA 1UGRB 2COZA 3CCVQ 1NJIC 3OSVA 2RNAA 4DEXA 2QXFA 5LJ5g 1YJWT 3OB9A 1VQ4T 1MV3A 1RL2A 3HKSA 2KI7A 1QCFA 1QW1A 3THKA 1W70A 2QTXA 2D8JA 2AK5A 1H3ZA 3NTHA 4JS4A 3TU4K 2DTHA 3VRZA 4RCCA 1VQPQ 2AZVA 4F7UA 2HNIA 4QVDA 2VUBA 1RAGB 5J3BA 1HYOA 5LJ5h 1C6VX 5GJWB 1Q82R 2XDBA 1H3HA 2VB6A 2O01E 2K3YA 4IIMA 1WXUA 1NEGA 2K7AA 4IIOA 3OYIA 1U5SA 1WGSA 2YWWA 2RD1A 3EH2A 2P4TA 2RF0A 3X24B 2MMPA 1ABOA 2KY9A 3BY7A 2NUPA 3CD6A 1TUGB 1UE9A 3OBWA 2KYBA 2RHUA 4BUGA 4C5EA 5FWCA 1RABB 2CH4W 4OMNA 4A53A 3M4GA 1VQOT 5GJVB 1G2BA 4TVRA 3CCST 4JRQA 2JMCA 2BTTA 3G4ST 2CZ1B 2DXBA 5KYYB 2EGCA 4E7LA 2YUNA 2L3SA 3QHSA 4MMKA 1RLPC 2GF7A 1P92A 1YJWA 2KAFA 3S3OA 1VQ4A 1AOJA 3C12A 3OYBA 2H3EB 4OMOA 2D0QB 4A4FA 1IHWA 3NGPA 3CXCA 3M0PA 4BE0A 4KH0B 1GXIE 2QI2A 2BE9B 1G3YA 5IXBA 1W4SA 1AVZC 2KMTA 3JB9J 1VQ7T 1RAIB 5IAYA 2FB7A 3RKXA 1GCQA 3J81E 3EG9B 4M78F 2JTMA 4LN2A 1QQJA 3CCMA 1WZOA 1Y96A 3V8KA 5KCHA 2EPDA 2V8JA 1KD1C 3MHXA 1K1ZA 4M78D 1WYXA 1Q7YU 4HT8A 5HCKA 2EFIA 1VQOA 2FEIA 2V8KA 2CUBA 3CCSA 2X3WD 3FEOA 2LNHB 2MK5A 4BY6B 3G4SA 5GANj 2EW3A 4EMKA 2E70A 3EFOA 4JPBW 2HL3A 4J9HA 3CCUQ 2JVVA 1N6AA 1MV0B 2RHXA 4P5NA 2BIVA 2CT4A 2EYQA 1OU8A 3UDCA 4IUVA 1W2BP 2K5IA 4MDXA 4F7UG 3C94A 1GBRA 1X2KA 2HQEA 1VQ7A 2QAZA 3OS1A 2K6DA 3OYHA 4PFOA 2YSQA 1VIEA 1VQ9T 3PMTA 4X1VA 4KUIA 5LJ3d 2F1LA 5GMKm 2OI3A 1YITT 3EGDB 1IHVA 2EYXA 1TOVA 4A4GA 2M1HA 1U3OA 1K8AU 4J83A 2VC8A 5KYXB 1OI1A 2LQKA 3CBMA 4DBQA 2JN0A 2BE7D 1M90C 2M9UA 4C5IA 2MAMA 4RTXA 3I55Q 2EGEA 3DB4A 5FU7C 3O8VA 4L6V5 3CCRT 2O31A 5GAN8 1V1CA 5CKBA 3H0FA 2ZZDA 3NFCA 1AWJA 2L8DA 4PJOG 2P0KA 1SG5A 3OA6A 3VUBA 1ARKA 5KE2A 1I4K1 2AKKA 3JCMV 1IO6A 3GNGA 4N4IA 5GMKe 3UPUA 2GBQA 4OGEA 3M0SA 2CDTA 2QGGA 5GANf 2DK3A 2EWNA 2OAUA 1N8RU 3GLXA 1YCYA 4M7AA 1KC8C 2MWPA 4B6MA 2L89A 4A4KA 1MMNA 4J6XA 4CI0C 5CR2A 1VYUA 1VQ9A 2DXCA 4JZ3A 3NMZC 1KQ1A 3NPFA 2A37A 2QDLA 1BYMA 2LMJA 1U06A 2DVEA 1GL5A 1ZLMA 1M4ZA 4C8QE 1AHJB 3ME9A 2DXTA 1PNJA 5LJ5e 1TUCA 3CD6Q 4M75C 4ME7A 3OYMA 5GAMd 3QDRB 1S72T 1FYNA 1JJ2P 2EQUA 3KFVA 2HSEB 2AIRB 4BD3A 5LJ3f 1TU0B 3CCRA 3JCMW 4C92E 3UWNA 2E5KA 4J9DA 4M75E 3V8LA 5I2MA 5GAN2 3CCET 4LDVA 1AWOA 4XTXA 1YJWQ 1UG1A 4C5GA 1VQ4Q 4F16A 4PFZA 3PIOA 2DTIA 1WNLA 4IUUA 4B9WA 2KROA 2QG9B 2BZXA 4RTTA 1T3SA 2XHCA 4HCKA 1BI3A 2L3RA 4OB1B 4J9FA 2HAXA 4DOWA 2KEAA 3QUIA 1M5Q1 4MZTA 1Z9ZA 5KYYA 2CZ6B 3FB9A 2HBPA 4XU3A 2V1RA 3JCMc 4R55A 2J6KA 5GAN6 2RQTA 3OYAA 3CCMQ 3E2UA 1SEMA 2YUOA 3CPWS 3EFSA 2QDYB 2PVGB 4J9EA 4OF1A 4AG2C 5GMKl 4ZNXA 1ZSZC 1S72A 2P84A 4M77C 2GQVA 4V2SA 1AWXA 1VQOQ 4OVAA 2XD0A 3CCSQ 3HFNA 3H6ZA 1O9SA 3REBB 3G4SQ 1YIJT 5M9OA 1VQMT 1PKTA 2V1QA 3MP1A 2ZPGB 3CCEA 3UA7A 1YWPA 3EG9A 4XU2A 3QBYA 4M77E 5I21A 2MOXA 3S3MA 2HBWA 2RI2A 1Q7YC 2LNVA 2FRYA 4F17A 4M7AG 2X9HA 4EMHA 1ZBXA 2E41A 2IG0A 2XKOC 4EDUA 4J8OA 1VQKT 1NLOC 1LPLA 1VQ7Q 1QMCA 3OYGA 4KT0E 4KH1B 1ACMB 4OMQA 1D1BA 5CAIA 1AWWA 2XDPA 2ZPIB 3M56A 4JRKA
chains in the Genus database with same CATH topology
4K11A 1FMKA 4RTWA 4F14A 2LJ0A 2J05A 1TG0A 4LE9A 1K76A 2X3XD 4GBQA 1K0SA 1X43A 3H41A 1SHFA 2L3PA 2DJQA 2D0NA 2PZ1A 2D8HA 2DL4A 1QKWA 4AFUC 2CH4A 1M3BA 3RBBB 4M4ZA 3M0QA 2DRMA 1W1FA 3VS4A 2A28A 1JU5C 2OJ2A 2A08A 3SEMA 1RI9A 2DL8A 2KT1A 5IHKA 1X2QA 3EG2A 4Z8AA 1WIEA 1AD5A 2LX7A 1UJYA 2FPFA 2G6FX 1I0CA 2RNAA 4DEXA 1OPKA 3VS7A 2FPEA 1KSWA 1MV3A 1YCSB 1CKBA 1WLPB 4GLMA 1X6BA 1QCFA 3THKA 1W70A 2DLPA 1YN8A 2LCSA 1HJDA 2D8JA 2AK5A 2DL5A 3QWXX 2ECZA 1KIKA 1AZGB 3VRZA 3TSZA 2O2OA 2XMFA 1QKXA 3QWYA 2AZVA 2NWMA 2PNIA 4Y92A 1A0NB 5GJWB 1H3HA 2JM9A 4Z88A 4IIMA 1WXUA 1K9AA 1NEGA 1OOTA 3M0RA 3ULRB 2K7AA 4IIOA 4R0KA 1U5SA 1M30A 1YNZA 2I0NA 1M8MA 5ECAA 2RF0A 3PVQA 1ABOA 1QWEA 1UE9A 2YDLA 2KYBA 1Y0MA 3R6NA 1CKAA 1JXMA 4KRTA 1UGVA 1YP5A 2O9SA 5FWCA 2CH4W 4OMNA 1UDLA 1AEYA 2RMOA 5GJVB 2EYYA 1G2BA 1X27A 2JMCA 1H8KA 2BTTA 2AKLA 2K9GA 2EGCA 2CT3A 1X6GA 2YUNA 4RTYA 2L3SA 1RLPC 2HSPA 2OAWA 4OMLA 2DBMA 2KBTA 1M27C 2L0AA 2RPNA 1OPLA 1AOJA 1ZUKA 4JJDA 3VRYA 1K0XA 1QLYA 1UFFA 1ZSGA 1ZX6A 4OMOA 1GFDA 4RTZA 4HVVA 1ZUYA 1JQQA 4OMPA 3NGPA 3EG0A 1ABQA 3M0PA 2VVKA 3ZL7C 2RN8A 3M0TA 2ED0A 1GRIA 3IQLA 5IXBA 5EC7A 1AVZC 2KYMA 3PE0A 2MIOA 3EGUA 1GCQA 2BZYA 3EG3A 2YT6A 2DX1A 2JMAA 4LN2A 1UTIA 2K3BA 1WXBA 4A63B 2EPDA 4HVWA 1K1ZA 1WFWA 2B86A 2JT4A 2ROTA 5FW9A 1WYXA 1MUZA 1GCQC 1RUWA 5HCKA 4J9GA 2PTKA 4LNPA 3UF4A 1WX6A 2F2XA 2FEIA 2CUBA 2EBPA 2F2WA 2X3WD 2LNHB 1NLPC 2EW3A 3VS2A 1Y57A 4AFQC 1NYFA 4JPBW 5FWBA 1I07A 2DL3A 1NEBA 4J9HA 1SSHA 3I5SA 1T3LA 2JS2A 2RQUA 1MV0B 2GTOA 2LJ1A 4JJBA 2CT4A 2HDAA 2KXDA 1Z9QA 2EGAA 3RNJA 4LUDA 1GBRA 2RQWA 1HD3A 2C0IA 3VS3A 1X2KA 2FG0A 2KRMA 2IIMA 2RQRA 3H0HA 4RTUA 1UECA 2CSQA 2K6DA 2JM8A 4D8KA 1BU1A 1PHTA 3FJ5A 5IHIA 2KNBB 1WXTA 2YSQA 4DEYA 4X1VA 5I22A 1N5ZA 1S1NA 2OI3A 1W6XA 2EYXA 2M51A 1UHFA 4OMMA 3EHRA 1SRLA 1VYTA 1U3OA 2SRCA 2EYWA 1B07A 1OEBA 3PVLA 2FO0A 3TSWA 4RTXA 1NYGA 1WA7A 1BBZA 2EGEA 3I35A 2KR3A 2HEQA 2EKHA 2O31A 1V1CA 3H0FA 1AWJA 1E6GA 1YWOA 4EIKA 2GNCA 2FRWA 2BZ8A 2YUPA 2LZ6B 2W0ZA 4LUEA 2ABLA 1XOVA 1ARKA 3H0IA 2AKKA 2D1XA 4WCIA 5L23A 1IO6A 2GBQA 2DE0X 1KFZA 3M0SA 2CDTA 1GBQA 5I11A 1HSQA 4RUGA 1K4US 2YUQA 2NUZA 2L3QA 1SHGA 4AFZC 1VYVA 2MCNA 3UATA 4CC3A 2KXCA 3EG1A 1VYUA 4CC4B 4ESRA 4JZ3A 3NMZC 3NPFA 2A37A 2JTEA 2QDLA 4CC2A 2LMJA 1OV3A 2VWFA 1U06A 3NHNA 4JJCA 1GL5A 2AZSA 2LQWA 1ZLMA 2J6OA 1PNJA 1VA7A 1E7OA 1BB9A 1TUCA 2K2MA 2DBKA 2LJ3A 2DM1A 3A98A 3I5RA 1GFCA 2DYBA 1FYNA 4RTVA 5IXFA 2M0YA 3KFVA 4HVUA 4JZ4A 2L2PA 3UA6A 2O88A 2A36A 2LQNA 2J6FA 1G83A 1CSKA 3CQTA 1JXOA 3I9QA 2DILA 4Z89A 2E5KA 2K79A 4J9DA 1WDXA 2FPDA 5IH2A 2KRSA 1AWOA 2CUDA 1M3AA 1ZUUA 1I1JA 2DA9A 1UG1A 4F16A 1B3QA 2CREA 2GQIA 2HCKA 1SRMA 2KROA 4ORZA 4D8DA 3LH5A 2SEMA 2ESWA 2H8HA 2BZXA 2LP5A 2ROLA 2JS0A 2C0OA 3VS5A 1J3TA 4RTTA 1RLQC 1T3SA 1AZEA 2W10A 4HCKA 2EQIA 2KGTA 4AG1C 2EYZA 2P4RA 1GCPA 4J9FA 4QT7A 3TVTA 2KEAA 3VS6A 2O9VA 3VS0A 1Z9ZA 2JW4A 1EFNA 1PWTA 4E6RA 1LCKA 2DVJA 2V1RA 1SPKA 2J6KA 2RQTA 1SEMA 2YUOA 2KRNA 2J06A 1H92A 4J9EA 2J7IA 4AG2C 2DNUA 2RQVA 2DF6A 4ZNXA 1T0JA 1JEGA 3U23A 1ZBJA 1AWXA 3GBQA 1JO8A 1NM7A 4J9IA 2ED1A 3JV3A 3C0CA 2GGRA 3REBB 1PRLC 4HXJA 1BK2A 1UUEA 2F2VA 1T0HA 1M3CA 2ENMA 1PKTA 3O5ZA 2V1QA 1QWFA 1PKSA 2KT8A 1TUDA 3UA7A 2GTJA 1YWPA 4J9BA 4AFSC 1X69A 2CSIA 2MOXA 4CC7A 2HBWA 1E6HA 2DMOA 2VKNA 2FRYA 4F17A 2DRKA 3SHWA 1UHCA 1KJWA 3REAB 1WI7A 4FSSA 1NLOC 2C0TA 2EVRA 2KE9A 1PRMC 3EHQA 5IHNA 3VS1A 1NG2A 2JXBA 4OMQA 1AWWA 1UJ0A 2DL7A 4J9CA 3M0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K11 A;  1FMK A;  4RTW A;  4F14 A;  2LJ0 A;  2J05 A;  1TG0 A;  4LE9 A;  1K76 A;  2X3X D;  4GBQ A;  1K0S A;  1X43 A;  3H41 A;  1SHF A;  2L3P A;  2DJQ A;  2D0N A;  2PZ1 A;  2D8H A;  2DL4 A;  1QKW A;  4AFU C;  2CH4 A;  1M3B A;  3RBB B;  4M4Z A;  3M0Q A;  2DRM A;  1W1F A;  3VS4 A;  2A28 A;  1JU5 C;  2OJ2 A;  2A08 A;  3SEM A;  1RI9 A;  2DL8 A;  2KT1 A;  5IHK A;  1X2Q A;  3EG2 A;  4Z8A A;  1WIE A;  1AD5 A;  2LX7 A;  1UJY A;  2FPF A;  2G6F X;  1I0C A;  2RNA A;  4DEX A;  1OPK A;  3VS7 A;  2FPE A;  1KSW A;  1MV3 A;  1YCS B;  1CKB A;  1WLP B;  4GLM A;  1X6B A;  1QCF A;  3THK A;  1W70 A;  2DLP A;  1YN8 A;  2LCS A;  1HJD A;  2D8J A;  2AK5 A;  2DL5 A;  3QWX X;  2ECZ A;  1KIK A;  1AZG B;  3VRZ A;  3TSZ A;  2O2O A;  2XMF A;  1QKX A;  3QWY A;  2AZV A;  2NWM A;  2PNI A;  4Y92 A;  1A0N B;  5GJW B;  1H3H A;  2JM9 A;  4Z88 A;  4IIM A;  1WXU A;  1K9A A;  1NEG A;  1OOT A;  3M0R A;  3ULR B;  2K7A A;  4IIO A;  4R0K A;  1U5S A;  1M30 A;  1YNZ A;  2I0N A;  1M8M A;  5ECA A;  2RF0 A;  3PVQ A;  1ABO A;  1QWE A;  1UE9 A;  2YDL A;  2KYB A;  1Y0M A;  3R6N A;  1CKA A;  1JXM A;  4KRT A;  1UGV A;  1YP5 A;  2O9S A;  5FWC A;  2CH4 W;  4OMN A;  1UDL A;  1AEY A;  2RMO A;  5GJV B;  2EYY A;  1G2B A;  1X27 A;  2JMC A;  1H8K A;  2BTT A;  2AKL A;  2K9G A;  2EGC A;  2CT3 A;  1X6G A;  2YUN A;  4RTY A;  2L3S A;  1RLP C;  2HSP A;  2OAW A;  4OML A;  2DBM A;  2KBT A;  1M27 C;  2L0A A;  2RPN A;  1OPL A;  1AOJ A;  1ZUK A;  4JJD A;  3VRY A;  1K0X A;  1QLY A;  1UFF A;  1ZSG A;  1ZX6 A;  4OMO A;  1GFD A;  4RTZ A;  4HVV A;  1ZUY A;  1JQQ A;  4OMP A;  3NGP A;  3EG0 A;  1ABQ A;  3M0P A;  2VVK A;  3ZL7 C;  2RN8 A;  3M0T A;  2ED0 A;  1GRI A;  3IQL A;  5IXB A;  5EC7 A;  1AVZ C;  2KYM A;  3PE0 A;  2MIO A;  3EGU A;  1GCQ A;  2BZY A;  3EG3 A;  2YT6 A;  2DX1 A;  2JMA A;  4LN2 A;  1UTI A;  2K3B A;  1WXB A;  4A63 B;  2EPD A;  4HVW A;  1K1Z A;  1WFW A;  2B86 A;  2JT4 A;  2ROT A;  5FW9 A;  1WYX A;  1MUZ A;  1GCQ C;  1RUW A;  5HCK A;  4J9G A;  2PTK A;  4LNP A;  3UF4 A;  1WX6 A;  2F2X A;  2FEI A;  2CUB A;  2EBP A;  2F2W A;  2X3W D;  2LNH B;  1NLP C;  2EW3 A;  3VS2 A;  1Y57 A;  4AFQ C;  1NYF A;  4JPB W;  5FWB A;  1I07 A;  2DL3 A;  1NEB A;  4J9H A;  1SSH A;  3I5S A;  1T3L A;  2JS2 A;  2RQU A;  1MV0 B;  2GTO A;  2LJ1 A;  4JJB A;  2CT4 A;  2HDA A;  2KXD A;  1Z9Q A;  2EGA A;  3RNJ A;  4LUD A;  1GBR A;  2RQW A;  1HD3 A;  2C0I A;  3VS3 A;  1X2K A;  2FG0 A;  2KRM A;  2IIM A;  2RQR A;  3H0H A;  4RTU A;  1UEC A;  2CSQ A;  2K6D A;  2JM8 A;  4D8K A;  1BU1 A;  1PHT A;  3FJ5 A;  5IHI A;  2KNB B;  1WXT A;  2YSQ A;  4DEY A;  4X1V A;  5I22 A;  1N5Z A;  1S1N A;  2OI3 A;  1W6X A;  2EYX A;  2M51 A;  1UHF A;  4OMM A;  3EHR A;  1SRL A;  1VYT A;  1U3O A;  2SRC A;  2EYW A;  1B07 A;  1OEB A;  3PVL A;  2FO0 A;  3TSW A;  4RTX A;  1NYG A;  1WA7 A;  1BBZ A;  2EGE A;  3I35 A;  2KR3 A;  2HEQ A;  2EKH A;  2O31 A;  1V1C A;  3H0F A;  1AWJ A;  1E6G A;  1YWO A;  4EIK A;  2GNC A;  2FRW A;  2BZ8 A;  2YUP A;  2LZ6 B;  2W0Z A;  4LUE A;  2ABL A;  1XOV A;  1ARK A;  3H0I A;  2AKK A;  2D1X A;  4WCI A;  5L23 A;  1IO6 A;  2GBQ A;  2DE0 X;  1KFZ A;  3M0S A;  2CDT A;  1GBQ A;  5I11 A;  1HSQ A;  4RUG A;  1K4U S;  2YUQ A;  2NUZ A;  2L3Q A;  1SHG A;  4AFZ C;  1VYV A;  2MCN A;  3UAT A;  4CC3 A;  2KXC A;  3EG1 A;  1VYU A;  4CC4 B;  4ESR A;  4JZ3 A;  3NMZ C;  3NPF A;  2A37 A;  2JTE A;  2QDL A;  4CC2 A;  2LMJ A;  1OV3 A;  2VWF A;  1U06 A;  3NHN A;  4JJC A;  1GL5 A;  2AZS A;  2LQW A;  1ZLM A;  2J6O A;  1PNJ A;  1VA7 A;  1E7O A;  1BB9 A;  1TUC A;  2K2M A;  2DBK A;  2LJ3 A;  2DM1 A;  3A98 A;  3I5R A;  1GFC A;  2DYB A;  1FYN A;  4RTV A;  5IXF A;  2M0Y A;  3KFV A;  4HVU A;  4JZ4 A;  2L2P A;  3UA6 A;  2O88 A;  2A36 A;  2LQN A;  2J6F A;  1G83 A;  1CSK A;  3CQT A;  1JXO A;  3I9Q A;  2DIL A;  4Z89 A;  2E5K A;  2K79 A;  4J9D A;  1WDX A;  2FPD A;  5IH2 A;  2KRS A;  1AWO A;  2CUD A;  1M3A A;  1ZUU A;  1I1J A;  2DA9 A;  1UG1 A;  4F16 A;  1B3Q A;  2CRE A;  2GQI A;  2HCK A;  1SRM A;  2KRO A;  4ORZ A;  4D8D A;  3LH5 A;  2SEM A;  2ESW A;  2H8H A;  2BZX A;  2LP5 A;  2ROL A;  2JS0 A;  2C0O A;  3VS5 A;  1J3T A;  4RTT A;  1RLQ C;  1T3S A;  1AZE A;  2W10 A;  4HCK A;  2EQI A;  2KGT A;  4AG1 C;  2EYZ A;  2P4R A;  1GCP A;  4J9F A;  4QT7 A;  3TVT A;  2KEA A;  3VS6 A;  2O9V A;  3VS0 A;  1Z9Z A;  2JW4 A;  1EFN A;  1PWT A;  4E6R A;  1LCK A;  2DVJ A;  2V1R A;  1SPK A;  2J6K A;  2RQT A;  1SEM A;  2YUO A;  2KRN A;  2J06 A;  1H92 A;  4J9E A;  2J7I A;  4AG2 C;  2DNU A;  2RQV A;  2DF6 A;  4ZNX A;  1T0J A;  1JEG A;  3U23 A;  1ZBJ A;  1AWX A;  3GBQ A;  1JO8 A;  1NM7 A;  4J9I A;  2ED1 A;  3JV3 A;  3C0C A;  2GGR A;  3REB B;  1PRL C;  4HXJ A;  1BK2 A;  1UUE A;  2F2V A;  1T0H A;  1M3C A;  2ENM A;  1PKT A;  3O5Z A;  2V1Q A;  1QWF A;  1PKS A;  2KT8 A;  1TUD A;  3UA7 A;  2GTJ A;  1YWP A;  4J9B A;  4AFS C;  1X69 A;  2CSI A;  2MOX A;  4CC7 A;  2HBW A;  1E6H A;  2DMO A;  2VKN A;  2FRY A;  4F17 A;  2DRK A;  3SHW A;  1UHC A;  1KJW A;  3REA B;  1WI7 A;  4FSS A;  1NLO C;  2C0T A;  2EVR A;  2KE9 A;  1PRM C;  3EHQ A;  5IHN A;  3VS1 A;  1NG2 A;  2JXB A;  4OMQ A;  1AWW A;  1UJ0 A;  2DL7 A;  4J9C A;  3M0U A; 
#chains in the Genus database with same CATH topology
 4K11 A;  1FMK A;  3OW2 S;  2A0F B;  4GBQ A;  4DQ2 A;  2JZ2 A;  1X43 A;  3HTR A;  2CP5 A;  2DL4 A;  3CMA T;  2LRQ A;  4EPC A;  4M75 B;  3RBB B;  3MPU B;  3M0Q A;  1WHJ A;  2DRM A;  1M9S A;  4OB2 B;  1XJW B;  1LOJ A;  1YIJ A;  3JCM Q;  1VQM A;  2R58 A;  2Z0W A;  2WAC A;  2EJF A;  1WIE A;  2LX7 A;  1K8A C;  4E7H A;  2YXY A;  1Q81 U;  2XDD A;  1OPK A;  3VS7 A;  4M78 C;  1YCS B;  4OGC A;  1F1B B;  3C95 A;  3EGD A;  4C5H A;  2HD0 A;  1X6B A;  2RJD A;  3EFR A;  3LGL A;  3WVD B;  4EMK B;  4J5Y A;  4HCZ A;  1MND A;  3EFO B;  3FLG A;  3JCM f;  2CS7 A;  1AZG B;  5D6W A;  3TSZ A;  4XK8 E;  1QP3 A;  1VQK A;  3E9G A;  1Y71 A;  2JM9 A;  4OMF B;  4J7F A;  3JSC A;  4M7D E;  1VQ9 Q;  4HKE A;  4R0K A;  3DKM A;  3GIB A;  4C8Q F;  1YNZ A;  2BKD N;  3JCM J;  4GY5 A;  2RK1 A;  2E3I A;  3TQ7 P;  3BDU A;  3KBG A;  5GAO p;  2DXU A;  5FU6 C;  1N8R C;  1JXM A;  3CMA A;  4JJN K;  1G8X A;  1IZ6 A;  2WSC E;  2RI5 A;  3SD4 A;  3G7Z A;  1AEY A;  4C8Q D;  1VIF A;  2RI3 A;  1WPY A;  4PJO F;  4C92 F;  1RAC B;  2ZPE B;  2M0O A;  2AKL A;  3CCR Q;  2DZC A;  1X6G A;  5KYW B;  4BDY A;  2X4W A;  4MML A;  3ZFJ A;  1D1C A;  2OAW A;  4PJL A;  2KBT A;  2RO0 A;  1Q82 U;  1M27 C;  1NPR A;  2L0A A;  1WQW A;  4PJO D;  4C92 D;  1OPL A;  5FRO A;  1OZ2 A;  1ZUK A;  5GAO l;  3L2Q A;  1K0X A;  1ZSG A;  3QXE B;  4RTZ A;  4HVV A;  1JQQ A;  5GAO q;  2CP3 A;  2RN8 A;  3M0T A;  3RUX A;  5EC7 A;  5CKF A;  3HSB A;  2KYM A;  4LDW A;  2LTO A;  1G3W A;  3T9N A;  3E1S A;  1B7T A;  2I2L A;  3LW5 E;  3JB9 G;  2HMA A;  3G1J A;  1W2B A;  1MMA A;  5IT9 E;  1WXB A;  4A63 B;  4HVW A;  1XTD A;  3EH1 A;  2B86 A;  2R5M A;  2JT4 A;  2DIQ A;  1MUZ A;  1IGU A;  2PTK A;  1WX6 A;  5L8R E;  1OQK A;  2F2W A;  2DO3 A;  4XTW A;  1PCX A;  4N0A C;  3VS2 A;  2RK2 A;  5FWB A;  3VJP A;  3CCE Q;  4M77 F;  3I5S A;  1N9R A;  4ZN1 A;  2AHJ B;  2V8I A;  1EZZ B;  4YTL A;  2R57 A;  2YRV A;  2XIC A;  4M78 B;  4KGV B;  4O5V A;  1KHC A;  4M77 D;  1I8F A;  1Z9Q A;  4PKC C;  3RNJ A;  3A1P A;  4PJM A;  1YFN A;  2EQK A;  2RQW A;  2IIM A;  2RQR A;  1UEC A;  3OMC A;  4XTZ A;  4C0F A;  3MET A;  5LJ3 g;  3JAM E;  3JB9 H;  4ANJ A;  2CGH A;  1IB8 A;  1G3S A;  5AT1 B;  1UHF A;  1SRL A;  3JB9 I;  3PTA A;  4WTO B;  4C0G A;  2EYW A;  3QYG B;  3MEU A;  1Q95 G;  2M02 A;  3AHU A;  5LJ3 h;  4E2F B;  2EKO A;  4JS5 A;  3TSW A;  5HKC A;  1WQ7 A;  4FYY B;  2FYK A;  2ZPB B;  4MZM A;  1YIJ Q;  1VQM Q;  2HEQ A;  2X4Y A;  1UB4 A;  4EIK A;  2K57 A;  2BZ8 A;  2LZ6 B;  3V8J A;  1TH7 A;  1BI2 A;  4FYW B;  1JB0 E;  3X25 B;  3H0I A;  2D1X A;  2FL7 A;  2DE0 X;  4LD6 A;  1VQL T;  1KFZ A;  3FC3 A;  2QA4 T;  1WJQ A;  2DPP B;  1K4U S;  1VQK Q;  4M75 A;  1SHG A;  5GMK i;  1RAE B;  4AFZ C;  1VYV A;  4M7D F;  1OX9 A;  2KXC A;  3EG1 A;  2K4Y A;  4JRP A;  3A8O B;  1Q81 C;  4CC2 A;  2VWF A;  1YHQ T;  3RDV A;  4NL2 A;  2O4X B;  2AZS A;  2ZCF B;  2DZ9 A;  4J6Y A;  1BB9 A;  5GAM g;  4M7D D;  5A0D A;  4RMO A;  3TCJ A;  4DBR A;  1LJO A;  2LJ3 A;  3MEW A;  3A98 A;  3CCQ T;  2OX7 A;  3CMA Q;  2LCC A;  3INZ A;  1GFC A;  2DYB A;  2NYS A;  2FHD A;  3H8Z A;  5GMK j;  2PQW A;  1FXX A;  3UA6 A;  2O88 A;  2VGN A;  4E7I A;  2CP0 A;  1KQS A;  5GAN d;  3CQT A;  1VQN T;  3FJP A;  4Z89 A;  1QVP A;  1KHI A;  1M1F A;  5GAM h;  4DBF A;  2HQX A;  3PMI A;  5IH2 A;  4XTY A;  1ZA2 B;  4E7K A;  2ZPF B;  2CUD A;  6AT1 B;  2KQW A;  5FLX E;  3RR6 A;  2QQA A;  3RKW A;  5CCA A;  1SRM A;  4ORZ A;  5LJ5 j;  3LH5 A;  1VQL A;  2QA4 A;  2H8H A;  3BFM A;  1YBY A;  5AYF A;  2ROL A;  4JRI A;  2RHI A;  2JS0 A;  1RLQ C;  3HRU A;  1AZE A;  2W10 A;  3OBY A;  2OTJ T;  3FRN A;  4E7S A;  2MPX C;  4IUR A;  3PIP A;  2EYZ A;  1ZSZ A;  2M16 A;  4M77 A;  1Q82 C;  2EQJ A;  1PWT A;  5KYW A;  2DVJ A;  1YHQ A;  2C06 A;  2E1H A;  1SPK A;  2VXF A;  1SSF A;  1FX7 A;  2CP6 A;  1VQ6 Q;  4KGZ B;  5HY6 A;  2CYZ B;  3N5B B;  3PGG A;  3RMQ A;  4DOV A;  1RAA B;  2DNU A;  3MP8 A;  3CCQ A;  5J26 A;  1T0J A;  3F70 A;  3X28 B;  1ZBJ A;  4OB3 B;  3SWN C;  1RI0 A;  1JO8 A;  1QVF S;  3OYN A;  2YHT A;  1UEB A;  1WJR A;  4VUB A;  1VQN A;  2GGR A;  1PRL C;  4HXJ A;  3FIF A;  3KUF A;  4E47 A;  2F2V A;  2ENM A;  2DJZ A;  5DLO A;  3O5Z A;  2QQ9 A;  5HK3 A;  1IGQ A;  2QEX T;  1PKS A;  3M4Y A;  1TUD A;  3CME T;  4GLK A;  2GTJ A;  4QVZ A;  4J9B A;  4F7U E;  4J6W A;  2LQ8 A;  2CSI A;  3FDR A;  4FW2 A;  2EIF A;  4CC7 A;  4AT1 B;  1QVG S;  2DMO A;  2DET A;  2VKN A;  4C8Q C;  2DRK A;  4NOY A;  3VKI A;  2DYI A;  2OTJ A;  3REA B;  3L2U A;  4FSS A;  3RKY A;  4JLG A;  3CPW P;  2C0T A;  4BI4 A;  1NPP A;  2RM4 A;  1YIT A;  3OY9 A;  3JRZ A;  3QYH B;  5IHN A;  4PJO C;  4C92 C;  4PLI A;  1OX8 A;  4DA4 A;  5EG2 A;  3HFO A;  4J9C A;  3M55 A;  2K5F A;  1HK9 A;  4RTW A;  1TG0 A;  4LE9 A;  3CEY A;  3LH0 A;  2FZG B;  1K76 A;  4KUL A;  1MHN A;  1SHF A;  1KG1 A;  2D0N A;  2D8H A;  3OS0 A;  3EGX B;  2X35 A;  4M78 A;  3QKJ A;  2YLB A;  4PJO E;  3VS4 A;  2A28 A;  3QPH A;  2OJ2 A;  1U1T A;  1RI9 A;  1D0Z A;  4LDU A;  4O6J A;  1OZ3 A;  3E9F A;  1VQ8 T;  1PM3 A;  5LJ3 e;  1AD5 A;  3CME A;  1UJY A;  2FPF A;  4LXC A;  3H9N A;  3CC4 T;  2FPE A;  1KSW A;  3SDZ A;  1CKB A;  3EAE A;  3CCV T;  1WLP B;  1YN8 A;  2LCS A;  2FVU A;  2DL5 A;  3QWX X;  4OB0 B;  2XMF A;  1QKX A;  1TS9 A;  2NWM A;  3OW2 P;  4Y92 A;  2X4X A;  3OS2 A;  2E65 A;  1VQP T;  4Z88 A;  4FU6 A;  1FMW A;  1K9A A;  2QQB A;  3ULR B;  4X34 A;  3OMG A;  5DLQ E;  3X20 B;  5C6S A;  1M8M A;  1BI0 A;  2DD5 A;  5ECA A;  3PVQ A;  1QWE A;  3PFS A;  3RER A;  2YDL A;  5CKH A;  1CKA A;  3I56 T;  1B34 B;  1UGS B;  4KRT A;  1YP5 A;  1YJ9 T;  1UDL A;  4BDZ A;  2RMO A;  2EYY A;  4PFP A;  3JCM d;  3A8L B;  5GAO m;  3CC2 T;  1R0B G;  1M2O A;  2K9G A;  5FU7 B;  3BE3 A;  2CT3 A;  1BCO A;  1FMV A;  3OYJ A;  1Y7X A;  4BAC A;  1VQ8 A;  1M1K R;  4OML A;  1M8V A;  3CC4 A;  3CXC S;  3HP9 A;  2WSE E;  1WHM A;  2DFU A;  4JJD A;  5GAO r;  4FW1 A;  5CIU A;  5D7U A;  1NBE B;  5DY9 A;  4PL6 A;  2O4X A;  1LVK A;  3A8H B;  5GAM e;  4OMP A;  1VQL Q;  3AT1 B;  2QA4 Q;  2VVK A;  3ZL7 C;  4FL6 A;  2ED0 A;  2QK0 A;  4C8Q B;  3A8M B;  1GRI A;  1ZHI A;  2KDS A;  3IQL A;  1Q86 R;  1OUL A;  4E7J A;  1VQP A;  2MIO A;  2BZY A;  1EIF A;  1PSE A;  3TEE A;  3CBO A;  1D3B B;  4PJJ A;  2DX1 A;  2JMA A;  1YHQ Q;  2IPO B;  4N0A A;  4WF2 A;  4C92 B;  1K9M R;  3ZBD A;  4FCY A;  3GNF B;  3I56 A;  2JNG A;  3CCQ Q;  2ROT A;  1YJ9 A;  2HQH A;  3MO8 A;  3CPF A;  3QG1 A;  1KQS S;  3A5Z B;  3UF4 A;  7AT1 B;  2EBP A;  3CC2 A;  1NLP C;  1VQN Q;  1M2V B;  2EJ9 A;  1Y57 A;  2QTV A;  5CK9 A;  4AFQ C;  4LD9 K;  1NJI R;  1FWZ A;  2Y4X A;  4Y28 E;  1NEB A;  4HT9 A;  3M58 A;  4F7U F;  1SSH A;  5KE3 A;  4M7A E;  3ER0 A;  4M7D C;  3VYH B;  2EAY A;  3QJ6 A;  2HKN A;  1D1A A;  2GTO A;  4Y91 A;  2LJ1 A;  4JJB A;  5CVI A;  1BCM A;  1V29 B;  2V26 A;  3MCA B;  2RHY A;  3VU3 C;  2EGA A;  4LUD A;  1HD3 A;  2C0I A;  1K73 U;  1RAH B;  2E4H A;  2FG0 A;  1VQ5 T;  2OTJ Q;  5DM7 R;  2NUT B;  2DAQ A;  4RTU A;  4FT2 A;  3L1A A;  2CSQ A;  3UT1 A;  2EJG A;  2JM8 A;  4QW2 A;  1YIT Q;  1BU1 A;  3FJ5 A;  2KNB B;  2RHZ A;  1TSF A;  4DEY A;  5I22 A;  1PG5 B;  2D6F A;  1S1N A;  1W6X A;  4HCC A;  2M51 A;  1N27 A;  8AT1 B;  2SRC A;  3GP8 A;  2FZK B;  1ZSZ B;  3QO3 A;  4M77 B;  2ZPH B;  1I5L A;  3MJX A;  1NYG A;  1WA7 A;  3L2Z A;  3I35 A;  2EKH A;  3J7A F;  3I55 T;  1E6G A;  1D0X A;  2FRW A;  3CBP A;  4FM4 B;  3CME Q;  3JCM b;  2W0Z A;  4LUE A;  3GF5 A;  4WCI A;  4NL3 A;  4LDX A;  5GAN 3;  2JTF A;  3BDL A;  3HPW A;  3VUZ A;  2F5T X;  2JOY A;  4JLI A;  1GBQ A;  5I11 A;  3ASK A;  1HSQ A;  4MZP A;  4RUG A;  1WHH A;  1VQ5 A;  1IXD A;  2L3Q A;  3EGX A;  3L42 A;  4QQD A;  2COW A;  4QVC A;  4FSX A;  3UAT A;  4CC3 A;  4ESR A;  2JTE A;  2YLC A;  3GOX A;  1OV3 A;  5CKE A;  3NHN A;  2LQW A;  1KD1 R;  4B9X A;  1O75 A;  1AT1 B;  1VA7 A;  1S72 Q;  1QCN A;  3HRS A;  4HCB A;  4RTV A;  5GAN g;  4JZ4 A;  4ELZ C;  2LQN A;  2J6F A;  4A4H A;  3TRE A;  1CSK A;  5IN1 A;  1JXO A;  3I55 A;  2K79 A;  4AMC A;  3X26 B;  1VQ8 Q;  2KRS A;  1WJS A;  3DB3 A;  3CC4 Q;  1ZUU A;  1H64 1;  1I1J A;  2B8A A;  5GAN h;  2F69 A;  1B3Q A;  3KXT A;  2MYS A;  1X01 A;  4ZGJ B;  4M7D B;  4EMG A;  4D8D A;  2SEM A;  4CRI A;  2ESW A;  2GFA A;  4PLL A;  2OTL T;  5GAN 4;  1B34 A;  3BW1 A;  1WHK A;  4AG1 C;  3RES A;  2PU9 B;  2HL5 C;  4QT7 A;  3QSU A;  3VS6 A;  2O9V A;  3VS0 A;  4ZGD B;  2BUD A;  3SWN A;  1MMD A;  2JW4 A;  4N4H A;  2ZGW A;  4KBM B;  3ZEH A;  3PNW C;  2KRN A;  1H92 A;  2J7I A;  5KCO A;  3I56 Q;  3OS5 A;  5FU6 B;  3CCM T;  2DF6 A;  1R8O B;  2E5Q A;  3MEV A;  1M90 R;  1YJ9 Q;  5FRN A;  3U23 A;  1JEG A;  2RB6 A;  3MEA A;  3CPW A;  2CKK A;  3SFM A;  1NM7 A;  4QQG A;  2ED1 A;  3JV3 A;  3CC2 Q;  4C8Q A;  2FZC B;  3OYL A;  1BK2 A;  2X51 A;  2MI6 A;  4J7I A;  4M7A F;  1V76 A;  1JJ2 A;  2RJF A;  1D3B A;  2DER A;  1QP2 A;  3OYC A;  4PJN A;  1YJN T;  4PJO A;  4C92 A;  2RH2 A;  4M7A D;  3OYD A;  3LX7 A;  3OQ5 A;  3QDF A;  2OTL A;  1KC8 R;  1OU9 A;  4XU1 A;  3SHW A;  1KJW A;  1WI7 A;  2XID A;  3E19 A;  5A0G A;  3P8H A;  3M54 A;  4PK4 A;  3L2V A;  2HZY A;  1M2V A;  3EHQ A;  2RJC A;  1X75 C;  2VGM A;  3SB2 A;  2CP7 A;  4IUT A;  1QVF P;  2LJ0 A;  3RIR A;  1R77 A;  5KYN A;  3H41 A;  3NTK A;  2HKQ B;  2DJQ A;  2PZ1 A;  1K73 C;  1C0M A;  4AFU C;  3OW2 A;  3QZ9 B;  1C1A A;  1M3B A;  4IUQ A;  3LWI A;  1PC0 A;  4RG8 A;  1W1F A;  2H3J A;  1QVG P;  2A08 A;  2NUT A;  5IHK A;  1U8R A;  1X2Q A;  3EG2 A;  4Z8A A;  1KQ2 A;  1UGP B;  4XU0 A;  2PVO B;  2G6F X;  2LT4 A;  1I0C A;  5GAN 5;  2QQS A;  4XTU A;  5CQY A;  1YJN A;  5LJ5 d;  4GLM A;  1UGQ B;  2K2V A;  3CCJ T;  2DLP A;  1ZQ1 A;  1HJD A;  2QGF B;  2ECZ A;  1KIK A;  2O2O A;  3L2W A;  3QWY A;  2A3L A;  1VQ5 Q;  2PNI A;  1A0N B;  4MDW A;  1VUB A;  3LYI A;  1IRE B;  1OOT A;  3M0R A;  3J80 E;  4IKF A;  3MKD A;  3G71 T;  1M30 A;  2I0N A;  5LJ3 j;  1WHL A;  3LGF A;  2JJ9 A;  4LDY A;  1Y0M A;  3R6N A;  8ATC B;  3CCL T;  1UGV A;  2O9S A;  4C0D C;  4Q5W A;  2PUK B;  3JCM g;  4C8Q G;  2E3H A;  1BIA A;  1X27 A;  3LWH A;  2GCX A;  1H8K A;  3HHT B;  1JBM A;  4E7Z A;  5D6X A;  4RTY A;  2X4J A;  2HSP A;  2G3R A;  3C4S A;  2DBM A;  3R6O A;  1DJ7 B;  5KYU B;  4RKU E;  4II1 A;  3JCM h;  1BKB A;  2RPN A;  5A0L A;  4UC4 A;  1Q7Y R;  4C92 G;  4JUV A;  3P8B B;  4F04 B;  3VRY A;  1QLY A;  1UFF A;  1ZX6 A;  1GFD A;  4M75 G;  3CCJ A;  1ZUY A;  3DLM A;  3EG0 A;  1N9S A;  1ABQ A;  5D6Y A;  3JB9 F;  2E6N A;  4FIB A;  4HA8 A;  5GAN e;  2DEQ A;  3G6E T;  3Q1J A;  4BE1 A;  2RJE A;  2D9T A;  3PE0 A;  1W2B S;  3EGU A;  5LJ5 f;  1YI2 T;  4X9D A;  3EG3 A;  1RAF B;  2YT6 A;  2E6Z A;  3G71 A;  3OYK A;  3JB9 D;  2R5A A;  4IUP A;  1TWB A;  3LLR A;  1UTI A;  4OP0 A;  3D7S B;  4X9C A;  2K3B A;  1M1K U;  2QYZ A;  3RMS A;  1WFW A;  3CCL A;  4XTV A;  5FW9 A;  2KVQ G;  4BB7 A;  1BIB A;  5GAM j;  1GCQ C;  4M7D A;  1RUW A;  2RA2 A;  4J9G A;  4LNP A;  2F2X A;  3CXC P;  1D09 B;  3VV0 A;  2QEX A;  2XK0 A;  5I2S A;  3CC7 T;  2DKG A;  2LC4 A;  1EX4 A;  1NYF A;  2Y90 A;  1JRI A;  1Y07 A;  1Q86 U;  1I07 A;  1K8A R;  2DL3 A;  1T3L A;  2JS2 A;  2RQU A;  1KK7 A;  4PNO A;  4ZN3 A;  2QQR A;  2HDA A;  4A54 A;  3GPL A;  4EMK C;  3VYG A;  2KXD A;  1K9M U;  4ATO A;  1U1S A;  2OTL Q;  4M77 G;  1NE8 A;  2E64 A;  3VS3 A;  5HK0 A;  3G6E A;  1LNX A;  1OYX A;  2KRM A;  2DTO A;  2F5K A;  3H0H A;  1QCO A;  4D8K A;  1PHT A;  5IHI A;  1YI2 A;  1WXT A;  3HL8 A;  2ZAE A;  1MMG A;  5CQX A;  1X6O A;  3HRT A;  1KQS P;  1N5Z A;  4ELY C;  4OMM A;  3EHR A;  1VYT A;  1NJI U;  1N8R R;  2LCL A;  2A7Y A;  3OYE A;  1BI1 A;  2E10 A;  2LVM A;  4F7U B;  1B07 A;  2VXE A;  3P8D A;  1OEB A;  1XNI A;  2ATC B;  2K3X A;  3SWN B;  3PVL A;  2FO0 A;  4C0D B;  3CC7 A;  1BBZ A;  2KR3 A;  1NZ9 A;  2P0P A;  2LX9 A;  1YWO A;  4JDS A;  2P0Q A;  4QQ6 A;  2GNC A;  1JJ2 S;  2GFU A;  2YUP A;  3CCV A;  2ABL A;  2NUP B;  1XOV A;  4FYX B;  5GAM f;  5LL6 S;  1YJN Q;  5L23 A;  4D6W A;  2CZ7 B;  2DD4 A;  1SKU B;  1SF9 A;  9ATC B;  1IRX A;  2NUZ A;  2YUQ A;  2PVD B;  1MGQ A;  2CZ0 B;  2MCN A;  4N4G A;  3JCM X;  3DLL A;  2XU8 A;  4NS5 A;  2L5Q A;  2NLU A;  3M57 A;  4CC4 B;  4BI3 A;  4PJO B;  3NTI A;  5GAN 7;  4BI8 B;  3JCM P;  2IVW A;  4JJC A;  3M5A A;  3M9Q A;  2J6O A;  4M78 G;  3OYY A;  4M7A C;  1VOM A;  4C0Z A;  1E7O A;  4M7D G;  2K2M A;  2DBK A;  2KK4 A;  2DM1 A;  3I5R A;  3OYF A;  2VYT A;  2CP2 A;  5IXF A;  2M0Y A;  2YRC A;  4HVU A;  4ZGE B;  2L2P A;  1PD0 A;  2A36 A;  1G83 A;  1I81 A;  3I9Q A;  2DIL A;  2EQM A;  1G5V A;  2K5L A;  4BE2 A;  1ZA1 B;  1HXD A;  1WDX A;  2FPD A;  3MP6 A;  3M53 A;  1Y96 B;  5CO7 A;  3CCU T;  2WSF E;  5KH6 A;  1M3A A;  2DA9 A;  2MWO A;  2XI9 A;  2CRE A;  3QII A;  2GQI A;  2HCK A;  4A4E A;  5A2Q E;  3CCJ Q;  1KD1 U;  2LP5 A;  2C0O A;  3VS5 A;  1J3T A;  1WHG A;  4L5G A;  3JCM e;  3PT9 A;  2EQI A;  1TTH B;  2KGT A;  2Y4Y A;  4XQ3 A;  5J39 A;  4FT4 A;  5KYX A;  2P4R A;  1GCP A;  3A8G B;  3L2R A;  2LT1 A;  3TVT A;  1EFN A;  3G71 Q;  2PUO B;  4E6R A;  1LCK A;  2E12 A;  4M78 E;  5CKD A;  3WXM B;  1D0Y A;  1PSF A;  1G3T A;  2J06 A;  2COY A;  5KYU A;  1VQ6 T;  3CCL Q;  2RQV A;  4ZTF A;  2JUF A;  3GBQ A;  4L59 A;  3V7S A;  4DBH A;  3S3N A;  1PD1 A;  4J9I A;  3C0C A;  2DIG A;  3QJY A;  2XG8 D;  2QEX Q;  3S6W A;  1UUE A;  1T0H A;  1M3C A;  4FYV B;  1MNE A;  2MF2 A;  1QVF A;  1QWF A;  4XAX B;  3CCU A;  2KT8 A;  2LDM A;  4M75 F;  4AFS C;  1X69 A;  1M1K C;  3M59 A;  2AT1 B;  3URG A;  1E6H A;  4RG2 A;  4RCB A;  1RAD B;  4ZTJ A;  4M75 D;  1QVG A;  3OSS C;  2KSS A;  1UHC A;  3V7R A;  3G6E Q;  1M90 U;  3QZ5 B;  1Q86 C;  2EVR A;  1Q81 R;  2KE9 A;  4QKU A;  3WVE B;  1YI2 Q;  1XQH A;  1PRM C;  2QAS A;  3VS1 A;  1NG2 A;  2JXB A;  2YRD A;  1UJ0 A;  2DL7 A;  3M0U A;  1TXQ A;  4F14 A;  2VV5 A;  2J05 A;  5C0M A;  4KUD K;  5GAO n;  3V7C A;  2X3X D;  1K9M C;  1K0S A;  3CD6 T;  1VQ6 A;  2L3P A;  4M7A B;  4R56 A;  1QKW A;  2CH4 A;  4BY6 C;  1K73 R;  1R0C B;  4M4Z A;  4Z02 A;  3CC7 Q;  1JU5 C;  1KC8 U;  3SEM A;  2DL8 A;  5GMK h;  2KT1 A;  2DEU A;  5FRM A;  1I5O B;  4KGX B;  2VAS A;  1M1G A;  1UGR B;  2COZ A;  3CCV Q;  1NJI C;  3OSV A;  2RNA A;  4DEX A;  2QXF A;  5LJ5 g;  1YJW T;  3OB9 A;  1VQ4 T;  1MV3 A;  1RL2 A;  3HKS A;  2KI7 A;  1QCF A;  1QW1 A;  3THK A;  1W70 A;  2QTX A;  2D8J A;  2AK5 A;  1H3Z A;  3NTH A;  4JS4 A;  3TU4 K;  2DTH A;  3VRZ A;  4RCC A;  1VQP Q;  2AZV A;  4F7U A;  2HNI A;  4QVD A;  2VUB A;  1RAG B;  5J3B A;  1HYO A;  5LJ5 h;  1C6V X;  5GJW B;  1Q82 R;  2XDB A;  1H3H A;  2VB6 A;  2O01 E;  2K3Y A;  4IIM A;  1WXU A;  1NEG A;  2K7A A;  4IIO A;  3OYI A;  1U5S A;  1WGS A;  2YWW A;  2RD1 A;  3EH2 A;  2P4T A;  2RF0 A;  3X24 B;  2MMP A;  1ABO A;  2KY9 A;  3BY7 A;  2NUP A;  3CD6 A;  1TUG B;  1UE9 A;  3OBW A;  2KYB A;  2RHU A;  4BUG A;  4C5E A;  5FWC A;  1RAB B;  2CH4 W;  4OMN A;  4A53 A;  3M4G A;  1VQO T;  5GJV B;  1G2B A;  4TVR A;  3CCS T;  4JRQ A;  2JMC A;  2BTT A;  3G4S T;  2CZ1 B;  2DXB A;  5KYY B;  2EGC A;  4E7L A;  2YUN A;  2L3S A;  3QHS A;  4MMK A;  1RLP C;  2GF7 A;  1P92 A;  1YJW A;  2KAF A;  3S3O A;  1VQ4 A;  1AOJ A;  3C12 A;  3OYB A;  2H3E B;  4OMO A;  2D0Q B;  4A4F A;  1IHW A;  3NGP A;  3CXC A;  3M0P A;  4BE0 A;  4KH0 B;  1GXI E;  2QI2 A;  2BE9 B;  1G3Y A;  5IXB A;  1W4S A;  1AVZ C;  2KMT A;  3JB9 J;  1VQ7 T;  1RAI B;  5IAY A;  2FB7 A;  3RKX A;  1GCQ A;  3J81 E;  3EG9 B;  4M78 F;  2JTM A;  4LN2 A;  1QQJ A;  3CCM A;  1WZO A;  1Y96 A;  3V8K A;  5KCH A;  2EPD A;  2V8J A;  1KD1 C;  3MHX A;  1K1Z A;  4M78 D;  1WYX A;  1Q7Y U;  4HT8 A;  5HCK A;  2EFI A;  1VQO A;  2FEI A;  2V8K A;  2CUB A;  3CCS A;  2X3W D;  3FEO A;  2LNH B;  2MK5 A;  4BY6 B;  3G4S A;  5GAN j;  2EW3 A;  4EMK A;  2E70 A;  3EFO A;  4JPB W;  2HL3 A;  4J9H A;  3CCU Q;  2JVV A;  1N6A A;  1MV0 B;  2RHX A;  4P5N A;  2BIV A;  2CT4 A;  2EYQ A;  1OU8 A;  3UDC A;  4IUV A;  1W2B P;  2K5I A;  4MDX A;  4F7U G;  3C94 A;  1GBR A;  1X2K A;  2HQE A;  1VQ7 A;  2QAZ A;  3OS1 A;  2K6D A;  3OYH A;  4PFO A;  2YSQ A;  1VIE A;  1VQ9 T;  3PMT A;  4X1V A;  4KUI A;  5LJ3 d;  2F1L A;  5GMK m;  2OI3 A;  1YIT T;  3EGD B;  1IHV A;  2EYX A;  1TOV A;  4A4G A;  2M1H A;  1U3O A;  1K8A U;  4J83 A;  2VC8 A;  5KYX B;  1OI1 A;  2LQK A;  3CBM A;  4DBQ A;  2JN0 A;  2BE7 D;  1M90 C;  2M9U A;  4C5I A;  2MAM A;  4RTX A;  3I55 Q;  2EGE A;  3DB4 A;  5FU7 C;  3O8V A;  4L6V 5;  3CCR T;  2O31 A;  5GAN 8;  1V1C A;  5CKB A;  3H0F A;  2ZZD A;  3NFC A;  1AWJ A;  2L8D A;  4PJO G;  2P0K A;  1SG5 A;  3OA6 A;  3VUB A;  1ARK A;  5KE2 A;  1I4K 1;  2AKK A;  3JCM V;  1IO6 A;  3GNG A;  4N4I A;  5GMK e;  3UPU A;  2GBQ A;  4OGE A;  3M0S A;  2CDT A;  2QGG A;  5GAN f;  2DK3 A;  2EWN A;  2OAU A;  1N8R U;  3GLX A;  1YCY A;  4M7A A;  1KC8 C;  2MWP A;  4B6M A;  2L89 A;  4A4K A;  1MMN A;  4J6X A;  4CI0 C;  5CR2 A;  1VYU A;  1VQ9 A;  2DXC A;  4JZ3 A;  3NMZ C;  1KQ1 A;  3NPF A;  2A37 A;  2QDL A;  1BYM A;  2LMJ A;  1U06 A;  2DVE A;  1GL5 A;  1ZLM A;  1M4Z A;  4C8Q E;  1AHJ B;  3ME9 A;  2DXT A;  1PNJ A;  5LJ5 e;  1TUC A;  3CD6 Q;  4M75 C;  4ME7 A;  3OYM A;  5GAM d;  3QDR B;  1S72 T;  1FYN A;  1JJ2 P;  2EQU A;  3KFV A;  2HSE B;  2AIR B;  4BD3 A;  5LJ3 f;  1TU0 B;  3CCR A;  3JCM W;  4C92 E;  3UWN A;  2E5K A;  4J9D A;  4M75 E;  3V8L A;  5I2M A;  5GAN 2;  3CCE T;  4LDV A;  1AWO A;  4XTX A;  1YJW Q;  1UG1 A;  4C5G A;  1VQ4 Q;  4F16 A;  4PFZ A;  3PIO A;  2DTI A;  1WNL A;  4IUU A;  4B9W A;  2KRO A;  2QG9 B;  2BZX A;  4RTT A;  1T3S A;  2XHC A;  4HCK A;  1BI3 A;  2L3R A;  4OB1 B;  4J9F A;  2HAX A;  4DOW A;  2KEA A;  3QUI A;  1M5Q 1;  4MZT A;  1Z9Z A;  5KYY A;  2CZ6 B;  3FB9 A;  2HBP A;  4XU3 A;  2V1R A;  3JCM c;  4R55 A;  2J6K A;  5GAN 6;  2RQT A;  3OYA A;  3CCM Q;  3E2U A;  1SEM A;  2YUO A;  3CPW S;  3EFS A;  2QDY B;  2PVG B;  4J9E A;  4OF1 A;  4AG2 C;  5GMK l;  4ZNX A;  1ZSZ C;  1S72 A;  2P84 A;  4M77 C;  2GQV A;  4V2S A;  1AWX A;  1VQO Q;  4OVA A;  2XD0 A;  3CCS Q;  3HFN A;  3H6Z A;  1O9S A;  3REB B;  3G4S Q;  1YIJ T;  5M9O A;  1VQM T;  1PKT A;  2V1Q A;  3MP1 A;  2ZPG B;  3CCE A;  3UA7 A;  1YWP A;  3EG9 A;  4XU2 A;  3QBY A;  4M77 E;  5I21 A;  2MOX A;  3S3M A;  2HBW A;  2RI2 A;  1Q7Y C;  2LNV A;  2FRY A;  4F17 A;  4M7A G;  2X9H A;  4EMH A;  1ZBX A;  2E41 A;  2IG0 A;  2XKO C;  4EDU A;  4J8O A;  1VQK T;  1NLO C;  1LPL A;  1VQ7 Q;  1QMC A;  3OYG A;  4KT0 E;  4KH1 B;  1ACM B;  4OMQ A;  1D1B A;  5CAI A;  1AWW A;  2XDP A;  2ZPI B;  3M56 A;  4JRK A; 
#chains in the Genus database with same CATH homology
 4K11 A;  1FMK A;  4RTW A;  4F14 A;  2LJ0 A;  2J05 A;  1TG0 A;  4LE9 A;  1K76 A;  2X3X D;  4GBQ A;  1K0S A;  1X43 A;  3H41 A;  1SHF A;  2L3P A;  2DJQ A;  2D0N A;  2PZ1 A;  2D8H A;  2DL4 A;  1QKW A;  4AFU C;  2CH4 A;  1M3B A;  3RBB B;  4M4Z A;  3M0Q A;  2DRM A;  1W1F A;  3VS4 A;  2A28 A;  1JU5 C;  2OJ2 A;  2A08 A;  3SEM A;  1RI9 A;  2DL8 A;  2KT1 A;  5IHK A;  1X2Q A;  3EG2 A;  4Z8A A;  1WIE A;  1AD5 A;  2LX7 A;  1UJY A;  2FPF A;  2G6F X;  1I0C A;  2RNA A;  4DEX A;  1OPK A;  3VS7 A;  2FPE A;  1KSW A;  1MV3 A;  1YCS B;  1CKB A;  1WLP B;  4GLM A;  1X6B A;  1QCF A;  3THK A;  1W70 A;  2DLP A;  1YN8 A;  2LCS A;  1HJD A;  2D8J A;  2AK5 A;  2DL5 A;  3QWX X;  2ECZ A;  1KIK A;  1AZG B;  3VRZ A;  3TSZ A;  2O2O A;  2XMF A;  1QKX A;  3QWY A;  2AZV A;  2NWM A;  2PNI A;  4Y92 A;  1A0N B;  5GJW B;  1H3H A;  2JM9 A;  4Z88 A;  4IIM A;  1WXU A;  1K9A A;  1NEG A;  1OOT A;  3M0R A;  3ULR B;  2K7A A;  4IIO A;  4R0K A;  1U5S A;  1M30 A;  1YNZ A;  2I0N A;  1M8M A;  5ECA A;  2RF0 A;  3PVQ A;  1ABO A;  1QWE A;  1UE9 A;  2YDL A;  2KYB A;  1Y0M A;  3R6N A;  1CKA A;  1JXM A;  4KRT A;  1UGV A;  1YP5 A;  2O9S A;  5FWC A;  2CH4 W;  4OMN A;  1UDL A;  1AEY A;  2RMO A;  5GJV B;  2EYY A;  1G2B A;  1X27 A;  2JMC A;  1H8K A;  2BTT A;  2AKL A;  2K9G A;  2EGC A;  2CT3 A;  1X6G A;  2YUN A;  4RTY A;  2L3S A;  1RLP C;  2HSP A;  2OAW A;  4OML A;  2DBM A;  2KBT A;  1M27 C;  2L0A A;  2RPN A;  1OPL A;  1AOJ A;  1ZUK A;  4JJD A;  3VRY A;  1K0X A;  1QLY A;  1UFF A;  1ZSG A;  1ZX6 A;  4OMO A;  1GFD A;  4RTZ A;  4HVV A;  1ZUY A;  1JQQ A;  4OMP A;  3NGP A;  3EG0 A;  1ABQ A;  3M0P A;  2VVK A;  3ZL7 C;  2RN8 A;  3M0T A;  2ED0 A;  1GRI A;  3IQL A;  5IXB A;  5EC7 A;  1AVZ C;  2KYM A;  3PE0 A;  2MIO A;  3EGU A;  1GCQ A;  2BZY A;  3EG3 A;  2YT6 A;  2DX1 A;  2JMA A;  4LN2 A;  1UTI A;  2K3B A;  1WXB A;  4A63 B;  2EPD A;  4HVW A;  1K1Z A;  1WFW A;  2B86 A;  2JT4 A;  2ROT A;  5FW9 A;  1WYX A;  1MUZ A;  1GCQ C;  1RUW A;  5HCK A;  4J9G A;  2PTK A;  4LNP A;  3UF4 A;  1WX6 A;  2F2X A;  2FEI A;  2CUB A;  2EBP A;  2F2W A;  2X3W D;  2LNH B;  1NLP C;  2EW3 A;  3VS2 A;  1Y57 A;  4AFQ C;  1NYF A;  4JPB W;  5FWB A;  1I07 A;  2DL3 A;  1NEB A;  4J9H A;  1SSH A;  3I5S A;  1T3L A;  2JS2 A;  2RQU A;  1MV0 B;  2GTO A;  2LJ1 A;  4JJB A;  2CT4 A;  2HDA A;  2KXD A;  1Z9Q A;  2EGA A;  3RNJ A;  4LUD A;  1GBR A;  2RQW A;  1HD3 A;  2C0I A;  3VS3 A;  1X2K A;  2FG0 A;  2KRM A;  2IIM A;  2RQR A;  3H0H A;  4RTU A;  1UEC A;  2CSQ A;  2K6D A;  2JM8 A;  4D8K A;  1BU1 A;  1PHT A;  3FJ5 A;  5IHI A;  2KNB B;  1WXT A;  2YSQ A;  4DEY A;  4X1V A;  5I22 A;  1N5Z A;  1S1N A;  2OI3 A;  1W6X A;  2EYX A;  2M51 A;  1UHF A;  4OMM A;  3EHR A;  1SRL A;  1VYT A;  1U3O A;  2SRC A;  2EYW A;  1B07 A;  1OEB A;  3PVL A;  2FO0 A;  3TSW A;  4RTX A;  1NYG A;  1WA7 A;  1BBZ A;  2EGE A;  3I35 A;  2KR3 A;  2HEQ A;  2EKH A;  2O31 A;  1V1C A;  3H0F A;  1AWJ A;  1E6G A;  1YWO A;  4EIK A;  2GNC A;  2FRW A;  2BZ8 A;  2YUP A;  2LZ6 B;  2W0Z A;  4LUE A;  2ABL A;  1XOV A;  1ARK A;  3H0I A;  2AKK A;  2D1X A;  4WCI A;  5L23 A;  1IO6 A;  2GBQ A;  2DE0 X;  1KFZ A;  3M0S A;  2CDT A;  1GBQ A;  5I11 A;  1HSQ A;  4RUG A;  1K4U S;  2YUQ A;  2NUZ A;  2L3Q A;  1SHG A;  4AFZ C;  1VYV A;  2MCN A;  3UAT A;  4CC3 A;  2KXC A;  3EG1 A;  1VYU A;  4CC4 B;  4ESR A;  4JZ3 A;  3NMZ C;  3NPF A;  2A37 A;  2JTE A;  2QDL A;  4CC2 A;  2LMJ A;  1OV3 A;  2VWF A;  1U06 A;  3NHN A;  4JJC A;  1GL5 A;  2AZS A;  2LQW A;  1ZLM A;  2J6O A;  1PNJ A;  1VA7 A;  1E7O A;  1BB9 A;  1TUC A;  2K2M A;  2DBK A;  2LJ3 A;  2DM1 A;  3A98 A;  3I5R A;  1GFC A;  2DYB A;  1FYN A;  4RTV A;  5IXF A;  2M0Y A;  3KFV A;  4HVU A;  4JZ4 A;  2L2P A;  3UA6 A;  2O88 A;  2A36 A;  2LQN A;  2J6F A;  1G83 A;  1CSK A;  3CQT A;  1JXO A;  3I9Q A;  2DIL A;  4Z89 A;  2E5K A;  2K79 A;  4J9D A;  1WDX A;  2FPD A;  5IH2 A;  2KRS A;  1AWO A;  2CUD A;  1M3A A;  1ZUU A;  1I1J A;  2DA9 A;  1UG1 A;  4F16 A;  1B3Q A;  2CRE A;  2GQI A;  2HCK A;  1SRM A;  2KRO A;  4ORZ A;  4D8D A;  3LH5 A;  2SEM A;  2ESW A;  2H8H A;  2BZX A;  2LP5 A;  2ROL A;  2JS0 A;  2C0O A;  3VS5 A;  1J3T A;  4RTT A;  1RLQ C;  1T3S A;  1AZE A;  2W10 A;  4HCK A;  2EQI A;  2KGT A;  4AG1 C;  2EYZ A;  2P4R A;  1GCP A;  4J9F A;  4QT7 A;  3TVT A;  2KEA A;  3VS6 A;  2O9V A;  3VS0 A;  1Z9Z A;  2JW4 A;  1EFN A;  1PWT A;  4E6R A;  1LCK A;  2DVJ A;  2V1R A;  1SPK A;  2J6K A;  2RQT A;  1SEM A;  2YUO A;  2KRN A;  2J06 A;  1H92 A;  4J9E A;  2J7I A;  4AG2 C;  2DNU A;  2RQV A;  2DF6 A;  4ZNX A;  1T0J A;  1JEG A;  3U23 A;  1ZBJ A;  1AWX A;  3GBQ A;  1JO8 A;  1NM7 A;  4J9I A;  2ED1 A;  3JV3 A;  3C0C A;  2GGR A;  3REB B;  1PRL C;  4HXJ A;  1BK2 A;  1UUE A;  2F2V A;  1T0H A;  1M3C A;  2ENM A;  1PKT A;  3O5Z A;  2V1Q A;  1QWF A;  1PKS A;  2KT8 A;  1TUD A;  3UA7 A;  2GTJ A;  1YWP A;  4J9B A;  4AFS C;  1X69 A;  2CSI A;  2MOX A;  4CC7 A;  2HBW A;  1E6H A;  2DMO A;  2VKN A;  2FRY A;  4F17 A;  2DRK A;  3SHW A;  1UHC A;  1KJW A;  3REA B;  1WI7 A;  4FSS A;  1NLO C;  2C0T A;  2EVR A;  2KE9 A;  1PRM C;  3EHQ A;  5IHN A;  3VS1 A;  1NG2 A;  2JXB A;  4OMQ A;  1AWW A;  1UJ0 A;  2DL7 A;  4J9C A;  3M0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...