2A2SA

Crystal structure of human glutathione transferase in complex with s-nitrosoglutathione in the absence of reducing agent
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Calorimetric and structural studies of the nitric oxide carrier S-nitrosoglutathione bound to human glutathione transferase P1-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2a2sA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2a2sA01
3PH9A 2GSQA 1X5EA 4JU5A 5ECRB 2CVKA 3M9KA 3IAM2 3TJGA 4QL9A 4ZBAA 3QOUA 4ZL8A 1DBYA 4MZBA 2HRAA 3BCKA 3UEMA 2H66A 5CRGA 5IPGA 2MZCA 2PGTA 1PSQA 4IN0A 2LV3A 1AAZA 2F51A 3C1RA 2CVBA 3G7YA 1QK8A 4JZQA 3D22A 2LRTA 5B6NA 1EOGA 5AIVA 3LYKA 1K3OA 1G6YA 3EU3A 1XWBA 4HJ2A 4RQRA 2YP6A 1FHEA 3TUEA 4TR1B 1ERUA 4MPGA 2DIYA 4D73B 3IC4A 4KAEA 2HSMB 2GSTA 5G5EA 2YANA 2KLXA 4EVMA 3ISOA 1FG4A 1THXA 1BX9A 3GKNA 3IXRA 4JE1A 4G0IA 1EGRA 1GTAA 3F4TA 4F0BA 1B9YC 4XS4B 4L5OA 1T7PB 3GIXA 1M9BA 4MABA 3VWWA 1V58A 4WEYA 2ALBA 2E0QA 3LSZA 1Z7PA 1GLQA 3FR9A 4OFMA 3D4TA 4TXOA 1FO5A 4TR0A 1SKSB 3ZIJA 2LSTA 3A5WA 4G19A 1F3BA 2R6KA 3KMNA 3GTUB 3PR8A 4ISDA 1A8YA 1GTIA 5LNKe 4OCEA 5IMCA 5C00A 2XC2A 4PGTA 4ECJA 3ZL5A 2CX4A 4BL7A 2B3SA 3HVXA 1A0FA 3WYWA 3DMLA 3IV4A 2DBCA 2DJJA 3EYTA 2VUPA 3U6VA 2B1KA 1F37A 16GSA 3VWUA 4N10A 1OYJA 2H74A 5IMZA 3D5JA 2B5XA 2VLUA 3IDVA 4J56E 3D4MA 2TRXA 3UVTA 3FEUA 3FR6A 4ILFA 1GRXA 2KP2A 3HVSA 2ON7A 2YCDA 2N5AA 4WBRD 1CQHA 1J9BA 4X0XA 1WOUA 2C8UA 5L71A 5KN1A 2VCQA 3KGKA 2HFDA 1HNBA 5IOWA 2YV7A 2O87A 3PINA 1Z9HA 1TKDB 4ZL7A 2HSYA 3E0UA 3L0HA 2IN3A 4POLA 1S3DA 3DIEA 4YQMA 4L0UA 1N2AA 4IJIA 3VURA 1BG5A 1YEPA 5IO2A 5B6MA 3EMPA 2G2QA 3VPTA 3APSA 2O8VB 1AQXA 3KMOA 1TRUA 4WF5A 1U87A 2MMAA 2AV4A 1O81A 5FT3A 1USBA 4GLTA 5G31A 1X9MB 2R5GA 1A8LA 2B5YA 4BWSA 2F8FA 3E9JB 5HFGA 5D9XA 6GSYA 3J7Yk 3HY2A 1T8EB 1ERTA 2IMEA 1AQVA 4EXJA 4HJMA 1SL0B 3GKKA 3NIVA 3CSIA 2VL3A 2ZCTA 4ML6A 1YDKA 5GAND 3N9JA 2CT6A 2WULA 3IAS2 1MDJA 2YWMA 3LXTA 2HZEA 1OE7A 4HZ4A 4IELA 4ECBA 1V40A 1U3AA 2AAWA 1PMTA 3G7IA 3QDNA 1GSEA 3LG6A 2DJ2A 1GUHA 4AJ8A 4PQHA 1GUMA 1ACVA 1I9DA 4TVEA 4BPYA 2HSHA 2GDRA 3ZMLA 1TU7A 4DSSB 2KOKA 4G0KA 2XBIA 1RK4A 5F8BA 3UAPA 3CTFA 3VI5A 3GSSA 4F0CA 2PN8A 4TRXA 3BD2A 2GLRA 3NOFA 5DDLA 4NHWA 4GWRA 1AC1A 5CRDA 5DJLA 5G5FA 1U6TA 4F2IA 1JZRA 4IQAA 2H0GA 2IMIA 1TRWA 3I43A 4FYCA 2XPDA 2OJLA 2B7JA 12GSA 4KA0A 1TI3A 2JL4A 1QFNA 2C4JA 4HI7A 2CZ2A 2OADA 1M2AA 4NHZA 4YQUA 5J9BA 3HJMA 3ZREA 5ECHB 2P5RA 3GFKA 1XOBA 1VGLA 3TKRA 1BQ7A 1X9SB 5E4WA 1LBKA 3CYNA 3GNJA 5GSTA 1AXDA 2V32A 1EEMA 3V1WA 1FVJA 4RI7A 5B8AA 3FKFA 4MPFA 1UA5A 2LKUA 2PPTA 3W8JA 4NMUA 4AJ6A 2LQQA 4AJ7A 2CAIA 2YJHA 1YY7A 22GSA 5F07A 4YAPA 1TXXA 5IO0A 1GNWA 5EL8A 1PL2A 4K0NA 2VL9A 2YNXA 3SBCA 19GSA 1Y6EA 3QMXA 3GSTA 3ZRDA 4RUVA 3GKXA 3GUSA 4OMVA 5D96A 4KDXA 4O32A 1X5DA 3DGQA 4KDYA 2OE0A 3HHVA 4IP6A 1TRVA 1HNAA 2PBJA 1SL2B 4BVXB 1K0CA 1HYUA 5G30A 2H1DA 4WBJA 1TU8A 4FYBA 4K0GA 1JZDA 4GTUA 4YH2A 8GSSA 3KH7A 3GH6A 4XRDA 1JLWA 4JBBA 1DUGA 5DALA 4LA1A 2OKAA 3FZ4A 2F8AA 1X0RA 4HDEA 3IHQA 1LU4A 4XHMA 4NAXA 1X5CA 2RLIA 2I9HA 3LXZA 2WGRA 3LYPA 1ILOA 2AUVA 3DVXA 4TOPA 4BVYA 1ABAA 2E2MA 4KUNA 2M72A 5F0GA 2IFQA 1MTCA 4OWYA 3C8EA 4I2TA 3TGZA 2LTKA 1WPIA 3F6DA 1T00A 2HI7A 1DE2A 1F6MC 4HEA2 3DWVA 5ECOB 1O73A 4DEJA 1B4PA 2A2RA 1K0BA 4LLRA 2OBKA 1ML6A 2HRKB 2GS3A 4J57E 1O7UA 3W6GA 3QD9A 1WP0A 1XWCA 10GSA 2DJKA 5EY6A 4ZB8A 5HQPA 4EKZA 2C1YA 3CBUA 3WT2A 2B7KA 2TRCP 2VCVA 2EIOA 3K8NA 2GZZA 1KTEA 2QGVA 5FWGA 5DBQA 3ME7A 4O5RA 2H6YA 1ST9A 2GVPA 4EO3A 3TRQA 5JCWA 4K1FA 4TR3A 2B5EA 2YWOA 3RHCA 4ACSA 1GL8A 4XCSA 1XWAA 4PURA 5H5QA 2H71A 4EE0A 3DYRA 1VF3A 4EUYA 4ID0A 3O6TA 4DSRA 3MDKA 1K0NA 5ECQB 4TXVA 3R2QA 5IM9A 2KP1A 2L6DA 4XS1A 4L5LA 1XCCA 5ELGA 2HLSA 4MZCA 3F0IA 3KH9A 3W8SA 2IIYA 2FWEA 3IK7A 5J41A 5ECSA 4MJBA 2YWNA 5H5RA 4OFNA 2HYXA 5AISA 2BMXA 4KB3A 2B1LA 3QFAC 3UJ1A 5ECNB 2FA4A 5CAXA 5A5KA 1V2AA 3VWXA 3RBTA 2GGTA 1JFUA 5KN2A 1Z5YE 2H0HA 4MLYA 3Q18A 1AIUA 2JSYA 2F9SA 4GSSA 1XZOA 1NHOA 1GSQA 4I5QA 3RDWA 17GSA 4L8EA 1SD9A 3GURA 1S3AA 1LJRA 4MF5A 3KJYA 3IBHA 4IJ3A 1GTBA 3CXGA 1JHBA 4EL1A 1R4WA 4LMWA 3ZVJD 3VLNA 1EP8A 5J3RA 4L0WA 1OE8A 3MWHA 2L4QA 4EDZA 2LRNA 3F63A 1GP1A 2CA8A 4MJCA 3Q6OA 4MK3A 4POMA 3L78A 4F9ZA 1WJKA 1VRSD 1ERWA 4IVFA 4POKA 4I2UA 3IPZA 1OAZA 3O3TA 5LD0A 2NPBA 3GA4A 1ZMAA 1G0TA 5D73A 2J23A 4O7HA 4KSOA 2IMFA 3I9V2 5INYA 2LEGA 3UL3A 3VK9A 1Z6MA 4WR4A 9GSSA 1F2EA 3ED3A 4G0LA 4GRFA 3TKSC 2DJ3A 5GSSA 2JADA 1TK8B 5ECIB 1GSSA 3TCOA 1M2BA 3G9BA 3LJRA 1SL1B 5G2ZA 2GT6A 3FR3A 1J0FA 5IMAA 4FH8A 5FHIA 1TRSA 6GSTA 1MDIA 2K8SA 3KTLA 2FWFA 2VIMA 2HSNB 2C3NA 2CVDA 4TXOB 2FD3A 3I6AA 3EU4A 4FO5A 1N8JA 4N30A 1T4ZA 5HR0A 3C7MA 1YF0A 3APOA 4K7NA 1OC9A 3LORA 2N5FA 1IYHA 4TW5A 2K18A 4HOJA 1M9AA 3HCZA 4BL7B 2GQKA 2C0DA 3EE2A 3D6IA 2LNTA 4Q5QA 4IKHA 2YPMA 2LNSA 1AQWA 4KCEA 3ZIVA 4V1Ag 5JWQB 1QQ2A 3LFLA 4O92A 3UARA 1V57A 4WXTA 3WGXA 4X1UA 4IP1A 4HQZA 3IC8A 5IOXA 3CMIA 2JZTA 2OE1A 5DJMA 3H1NA 5A4VA 2DMMA 1K0OA 2OACA 3GV1A 1SYXA 1WWJA 3LGCA 5IMVA 1WRYA 3RAZA 11GSA 4MJEA 3EURA 1BAYA 3HJPA 6GSSA 2FY6A 1U3IA 3FHKA 1BYEA 3GL5A 1XW6A 3ERWA 4Q5NA 1C72A 4V2LA 5J9CA 2CV4A 3EVIA 3FRCA 3C73A 4GSNA 3FZ5A 5IIZA 2LS5A 1Z7RA 5CNWA 1XWGA 2A2SA 3TRXA 1EWXA 5DCHA 2I3YA 3A2XA 4J2FA 3AY8A 3QR6A 2RM6A 1ZCPA 2E7PA 4ZBDA 4OO5A 4EF0A 3KEBA 2QC7A 5HR1A 1KEBA 1SU9A 2TIRA 2HQTA 5DCGA 2YN1A 2FA8A 3DD3A 4ZILA 2WFCA 4ULXA 1FW1A 3ZITA 3TDGA 4KH7A 2MMOA 1GUKA 3DXBA 1B9XC 1OC8A 2H01A 5CRWA 2R3XA 2GSRA 2VL2A 3M3MA 3CRTA 3RPPA 5B8BA 5ECLB 3BCIA 1K0AA 3QCPA 2QKEA 4FIWA 1F9MA 1PX6A 3HZ8A 1PN9A 3QPMA 1ZL9A 2CAQA 2PVQA 3C71A 1TK5B 4BA7A 2H6XA 1WMJA 2H75A 4ZB9A 4PX1A 1GULA 3FYGA 3HZ4A 3HVVA 4KDUA 4I6XA 4E8EA 1O8WA 4QL7A 5G1LA 1Z6NA 2HZEB 2C0GA 3ZVJA 1DE1A 3VFIA 3GN3A 1A2LA 2VM1A 6GSXA 4HZ2A 1FVKA 5G1KA 1M2DA 5HFKA 1TI1A 3P8WA 3DEXA 1H4OA 3TKPA 3F8UA 5ELAA 4HUAA 2YOIA 2JSZA 4YQVA 1XFLA 2IPAA 2C3TA 2DJ0A 2H1BA 4K8MA 2NTOA 1TDIA 4PNFA 5DAKA 3QAWA 2P0GA 1SENA 4ECIA 3TJFA 1YF1A 3CSJA 2PUKC 3ERFA 2JZRA 3KZQA 2VD1A 3F9UA 4ZL9A 5JCUA 2VCWA 2LQOA 2GT5A 2HRFA 6GSVA 2XPEA 4JR6A 2IMDA 2PERA 4OCFA 1TOFA 2C80A 2C0FA 2LJKA 3ZLPA 4MZWA 4LL1B 1Y25A 2WZ9A 2JU5A 1R5PA 5KN0A 5GAPD 2BTOT 1NHYA 3F6FA 4AGSA 5A4WA 1XPVA 4MF7A 1T1VA 2WB9A 4DVCA 2VCTA 2VD0A 1GSDA 5J4UA 4NV5A 3OR5A 3UBKA 1GSYA 1A2JA 4KF9A 1SJ6A 4WKWA 3GL3A 3EC3A 2PMTA 2H72A 2RUEA 3MNGA 2I81A 3H93A 4RQXA 4TR1A 2GZYA 4CDOA 4D73A 3WGDA 2HSMA 2ON5A 2DIZA 13GSA 4F03A 1J08A 6GSUA 1NW2A 1SD8A 3TRPA 5DAKB 2RIIA 2FWHA 3F3RA 2GQLA 2H70A 2L4CA 3EINA 4NPBA 3A2WA 2R37A 4XS4A 1BJXA 2X8HA 1KNGA 1SK1A 5DALB 1O6JA 4XRAA 3TB2A 2E2GA 1EGOA 4N0VA 1HQOA 1R7HA 1A2MA 3FZAA 3E3EA 3KP8A 1EP7A 4AF2A 3HA9A 4KNDA 2D2ZA 2FUG2 3F3QA 4IGJA 2I1UA 1VF4A 1QGVA 3GTUA 4LL4B 2GZPA 4BVYB 1SJZA 3Q19A 1MEKA 2DC5A 2IFQB 4MCUA 5JWRB 4PUAA 5ECMB 1K0DA 5EVOA 3HKRA 1WE0A 1XVWA 3GX0A 4N0ZA 1YJ6A 2X99A 1AW9A 2PU9C 2V41A 4GQFA 3Q74A 4JR4A 5DVBA 3IK9A 2X8CA 5ID2A 2DJ1A 4IQ1A 3ZFLA 1PD21 2LUSA 3LWAA 1G7EA 3KCMA 1PL1A 3R3EA 4POBA 2VLTA 2I4AA 5D9WA 1OKTA 1CQGA 4IHUA 1ERVA 2WCIA 2Z9SA 2R4VA 2RM5A 3TOTA 2ZUPA 1SKRB 1UC7A 2ES7A 2HT9A 3MAKA 3M9JA 4NV2A 2CX3A 4IS0A 1A23A 2K9FA 3DRNA 3JCML 2XBQA 3M8NA 3RHBA 3WGEA 1M0UA 3N5OA 4G10A 3GRXA 4HU9A 2JZSA 3A3TA 4LMVA 3KD0A 5CO3A 3TKSE 3TJJA 2LJRA 3UVHA 4PXOA 3GX8A 1QMVA 3PPUA 2IL3A 1XW5A 1M7TA 1ON4A 1XOAA 1IYIA 2WS2A 5D9TA 1PKZA 3WD6A 3D21A 2FWGA 1TK0B 1JZWA 3C1SA 4MH3A 1VF1A 4ZXGA 5A4UA 3HD5A 3UIWA 5AN1A 2MYGA 1GWCA 1JLVA 4ECCA 4ZIJA 1VF2A 2REMA 3IR4A 4KX4A 3ERGA 2O85A 2OBIA 1W4VA 1GNEA 4IBPA 2OA7A 1FB0A 3P7XA 4G2EA 4WETA 1ZZYA 2HNLA 1SK2A 1UN2A 5EPFA 4PUFC 5LCZA 2NDOA 4ZB6A 20GSA 4TR4A 3CRUA 2CQ9A 3H79A 3UOMA 2H30A 3TJKA 4DSQA 4KW6A 3LEFA 5ID2B 3WT1A 2FHEA 2XHFA 2GQMA 3KTBA 1X9WB 1UVZA 1ZYEA 1Q98A 3S9FA 4GF0A 1TW9A 1ZOFA 4X43A 2L5LA 2KUCA 4EC0A 2WRTA 3GH9A 3SWLA 2VAFA 2JACA 3MSZA 4Z7XA 4K6XA 4MP4A 2YV9A 3FK8A 2HZFA 5IQYA 5DQSA 2QSIA 2NVLA 1O8XA 1E6BA 3U5RE 1MDKA 3ZTLA 3I69A 3ZMKA 4MMMA 1PA3A 4MDCA 4OD7A 1G6WA 2H73A 1GH2A 2VOCA 5ENUA 4G9HA 3CTGA 4WR5A 1F3AA 1TJDA 2H6ZA 4FQUA 3P2AA 2YWIA 1A0RP 1KBNA 1H75A 1W89A 2DMLA 1FOVA 5IPHA 5ECPB 3IRAA 2VCXA 3BJ5A 3DKSA 4KCAA 3VWVA 2H8LA 2HXKA 1PQNA 5F05A 2ZNMA 1B8XA 2AHEA 2GSSA 1FB6A 3CSHA 4OO4A 5KN3A 4DSSA 5COHA 1WIKA 2CZ3A 3IA1A 3QAGA 2FNOA 5IMFA 2VO4A 3GMFA 1GSFA 2J9HA 4GCIA 1HNCA 4QQ7A 1YQ1A 2YJ7A 4MJAA 5D8IA 4FYUA 2V1MA 2BJXA 1NSWA 4K7IA 2K6VA 3D0ZA 1HD2A 1K0MA 3UMAA 2VLVA 3FY7A 2EC4A 5B7CA 2WJUA 2MBTA 3HDCA 1S3CA 3TOUA 3APQA 4PTSA 3VI7A 1TP9A 5JWOB 3F4SA 4GXZA 2M46A 2P5QA 4RI6A 2LRCA 2PWJA 1EZKA 3IOSA 2EIRA 3H4KA 3FZ9A 4E8HA 1AUCA 3F4RA 1OC9B 1O85A 1M99A 1GSUA 3VPQA 7GSSA 1OKDA 4CW9A 3A2VA 4PQIA 4XIHA 2K8VA 2YZHA 1R5AA 5CP1A 3G7JA 3M1GA 5C04A 4N11A 1B4QA 1XW9A 1GLPA 3US3A 1I5GA 2KHPA 4K2DA 4MH2A 1XXUA 4HS1A 3TJBA 2L57A 1XWKA 1QXHA 2MMZA 2B6MA 3L9UA 4ML1A 1Q4JA 3L9SA 2AYTA 4BWQA 4BVXA 2A4VA 2FGXA 2R2JA 4GQCA 3ZFBA 4HU7A 1YKCA 2IJYA 4WF4A 2LJAA 1DSBA 3TKQA 2FLSA 5DQYA 2V2GA 3ZZXA 5H5SA 1MD3A 5IMDA 3P90A 5BMUA 5CREA 5CYYA 4JRRA 1U88A 1V98A 1URMA 4I8BA 5HR2A 2EIQA 4YAVA 2L5OA 1PX7A 2PVOC 5GZZB 2DSAA 3RPNA 1E2YA 4P3YB 4TN8A 2L6CA 2C3QA 1G7OA 1OVNA 2IWTA 4H86A 1ZGNA 4KGIA 2HRNA 2X64A 2MBSA 1BEDA 1RW1A 5D93A 1XBSA 2H76A 4KSMA 1QUWA 4Q5RA 1XVQA 3KP9A 3BBYA 1K3LA 2VM2A 1EV4A 5HR3A 4XS6A 1EV9A 1PGTA 2HE3A 3GHAA 3NZNA 4HQSA 3HJOA 2P31A 2H1GA 2AB6A 4KE3A 3EWLA 5JCGA 1Z3EA 4NWYA 3L4NA 2V6OA 2HRKA 3HXSA 3HYPA 2FCHA 2H19A 3GYKA 1THOA 2DLXA 3KXOA 3J7Yb 2H0IA 1SKWB 4GSTA 3UBLA 3QFBC 5J5NA 2UZ8A 2NBSA 1EEJA 2VCZA 4Q5FA 5ABRA 1T3BA 1SYRA 4USSA 4CHSA 1T4YA 1B48A 1R26A 14GSA 4ZBBA 3O76A 2OE3A 1SK0A 2O89A 1SJIA 3GKMA 5AGYA 3ME8A 3IE3A 1ZYQB 4K7OA 3DVWA 4F82A 1A24A 2N5BA 1K3YA 1YZXA 4IW9A 2F3MA 1MD4A 3EMXA 1EOHA 18GSA 5D9VA 2G0FA 4PNGA 4V2MA 3ZYWA 3PGTA 2YZUA 5HFIA 3TKSA 4OFTA 4NXIA 6GSWA 4JEDA 1PKWA 4I97A 2GTUA 2V6KA 1NM3A 3LQ7A 1GTUA 1RQMA 2O7KA 1YEXA 1V9WA 4EDYA 5E59A 5F06A 1YKAA 1FAAA 3QAVA 3KIJA 4MA9A 2C0EA 5AIXA 3FW2A 4PQ1A 5ECKB 2L59A 3L9VA 3BOAA 3M0FA 2WDUA 4TKYA 5KEJA 3H8QA 4MF6A 4XTSA 2RUFA 2X8GA 4V1Ap 2VL2C 1XIYA 3KM6A 2H1AA 5CRHA 1PRXA 4V2NA 2MMNA 4K9ZA 1OC3A 1TTZA 1JZOA 2IMKA 2M80A 2AJQB
chains in the Genus database with same CATH superfamily
3PH9A 2GSQA 1X5EA 4JU5A 5ECRB 2CVKA 3M9KA 3IAM2 3TJGA 4QL9A 4ZBAA 3QOUA 4ZL8A 1DBYA 2R0CA 4MZBA 2HRAA 3BCKA 3UEMA 2H66A 2O36A 5CRGA 5IPGA 2MZCA 2PGTA 1PSQA 4IN0A 2LV3A 1AAZA 2F51A 3C1RA 2CVBA 3G7YA 1QK8A 4JZQA 3D22A 2LRTA 3MYDA 5B6NA 1EOGA 5AIVA 3LYKA 1K3OA 1G6YA 3EU3A 1XWBA 4HJ2A 4RQRA 2YP6A 1FHEA 3TUEA 4TR1B 1ERUA 4MPGA 2DIYA 4D73B 3IC4A 4KAEA 2HSMB 2GSTA 5G5EA 2YANA 2KLXA 4EVMA 3ISOA 1FG4A 1THXA 1BX9A 3GKNA 3IXRA 4JE1A 4G0IA 1EGRA 1GTAA 3F4TA 4F0BA 1B9YC 4XS4B 4L5OA 1T7PB 3GIXA 1M9BA 4MABA 3VWWA 1V58A 4WEYA 2ALBA 2E0QA 2HSNA 3LSZA 1Z7PA 1GLQA 3FR9A 4OFMA 3D4TA 4TXOA 1FO5A 4TR0A 1SKSB 2DKHA 3ZIJA 2LSTA 3A5WA 4G19A 1F3BA 2R6KA 3KMNA 3GTUB 3PR8A 4ISDA 1A8YA 1GTIA 5LNKe 4OCEA 5IMCA 5C00A 2XC2A 4PGTA 4ECJA 2WW1A 3ZL5A 2CX4A 4BL7A 2B3SA 3HVXA 1A0FA 3WYWA 3DMLA 3IV4A 2DBCA 2DJJA 3EYTA 2VUPA 3U6VA 2B1KA 1F37A 16GSA 3VWUA 4N10A 1OYJA 2H74A 5IMZA 3D5JA 2B5XA 2VLUA 3IDVA 4J56E 3D4MA 2TRXA 3UVTA 3FEUA 3FR6A 4ILFA 1GRXA 2KP2A 1Y1UA 3HVSA 2ON7A 2YCDA 2UV8G 2N5AA 4WBRD 1CQHA 1J9BA 4X0XA 1WOUA 2C8UA 5L71A 5KN1A 2VCQA 3KGKA 2HFDA 1HNBA 5IOWA 2YV7A 2O87A 3PINA 1Z9HA 1TKDB 4ZL7A 2HSYA 2WVZA 3E0UA 3L0HA 2IN3A 4POLA 1S3DA 3DIEA 4YQMA 4L0UA 1N2AA 4IJIA 3VURA 1BG5A 1YEPA 5IO2A 5B6MA 3EMPA 2G2QA 3VPTA 3APSA 2O8VB 1AQXA 3KMOA 1TRUA 4WF5A 1ZYNA 1U87A 2MMAA 2AV4A 1O81A 5FT3A 1USBA 4GLTA 5G31A 1X9MB 4G01A 2R5GA 1A8LA 2B5YA 4BWSA 2F8FA 3E9JB 5HFGA 5D9XA 6GSYA 3J7Yk 3HY2A 1T8EB 1ERTA 2IMEA 1AQVA 4EXJA 4HJMA 1SL0B 3GKKA 3NIVA 4AI6A 3CSIA 2VL3A 2ZCTA 1S4BP 4ML6A 1YDKA 5GAND 3N9JA 2CT6A 2WULA 3IAS2 1MDJA 2YWMA 3LXTA 2HZEA 1OE7A 4HZ4A 1U3AA 4IELA 4ECBA 1V40A 2AAWA 1PMTA 3G7IA 3QDNA 1GSEA 3LG6A 2DJ2A 1GUHA 4AJ8A 4PQHA 1GUMA 1ACVA 1I9DA 4TVEA 4BPYA 2HSHA 2WW0A 2GDRA 3ZMLA 1TU7A 2X49A 4DSSB 2KOKA 4G0KA 2XBIA 1RK4A 5F8BA 3UAPA 3CTFA 3VI5A 1N25A 3GSSA 4F0CA 2PN8A 2WVYA 3HVNA 4TRXA 3BD2A 2GLRA 3NOFA 5DDLA 4NHWA 4GWRA 1AC1A 5CRDA 5DJLA 5G5FA 1U6TA 4F2IA 1JZRA 4IQAA 2H0GA 2IMIA 1TRWA 3I43A 4FYCA 2XPDA 2OJLA 2B7JA 12GSA 4KA0A 1TI3A 2JL4A 1QFNA 2C4JA 4HI7A 2CZ2A 2OADA 1M2AA 4NHZA 4YQUA 5J9BA 3HJMA 3ZREA 5ECHB 2P5RA 3GFKA 1XOBA 1VGLA 3TKRA 1BQ7A 1X9SB 5E4WA 1LBKA 3CYNA 3GNJA 5GSTA 1AXDA 2V32A 1EEMA 3V1WA 1FVJA 4RI7A 5B8AA 3FKFA 4MPFA 1UA5A 4K5RA 4EIPA 2LKUA 2PPTA 3W8JA 4NMUA 4AJ6A 2LQQA 4AJ7A 2CAIA 2YJHA 1YY7A 22GSA 5F07A 4YAPA 5A1NB 1TXXA 5IO0A 1GNWA 5EL8A 4A5PA 1PL2A 4K0NA 2VL9A 1YEWC 2YNXA 5KOWA 3SBCA 4PI2C 19GSA 1Y6EA 3QMXA 3GSTA 3ZRDA 4RUVA 3GKXA 3GUSA 4OMVA 5D96A 4KDXA 4O32A 1X5DA 3DGQA 4KDYA 2OE0A 3HHVA 4IP6A 1TRVA 1HNAA 2PBJA 1SL2B 4PHZC 4BVXB 1K0CA 1HYUA 5G30A 2H1DA 4WBJA 1TU8A 4FYBA 4K0GA 2EFCA 1JZDA 4GTUA 4YH2A 8GSSA 3KH7A 3GH6A 4XRDA 1JLWA 4JBBA 1DUGA 5DALA 4LA1A 2OKAA 3FZ4A 2F8AA 1X0RA 4HDEA 3IHQA 5BMUB 1LU4A 4CY8A 4Z2UA 4XHMA 4NAXA 1X5CA 2RLIA 2I9HA 3LXZA 2WGRA 3LYPA 3TU3B 1ILOA 2AUVA 3DVXA 4TOPA 4BVYA 1ABAA 2E2MA 4KUNA 2M72A 5F0GA 2IFQA 1MTCA 4OWYA 3C8EA 4I2TA 3TGZA 2LTKA 1WPIA 3F6DA 1T00A 2HI7A 1DE2A 1F6MC 2QA1A 4HEA2 3DWVA 5ECOB 1O73A 4DEJA 1B4PA 1TXUA 2A2RA 1K0BA 4LLRA 2OBKA 1ML6A 2HRKB 2GS3A 4J57E 1O7UA 3W6GA 3QD9A 1WP0A 1XWCA 10GSA 2DJKA 5EY6A 4ZB8A 5HQPA 4EKZA 2C1YA 3CBUA 3WT2A 2B7KA 2TRCP 2VCVA 1ZYPA 2EIOA 3K8NA 2GZZA 1KTEA 2QGVA 3MIXA 5FWGA 4X4JA 5DBQA 3ME7A 4O5RA 2H6YA 1ST9A 2GVPA 4EO3A 3TRQA 5JCWA 4K1FA 4TR3A 2B5EA 2YWOA 3RHCA 4ACSA 1GL8A 4XCSA 1XWAA 4PURA 5H5QA 2H71A 4EE0A 3DYRA 1VF3A 4EUYA 1SVLA 4ID0A 3O6TA 4DSRA 3MDKA 1K0NA 5ECQB 4TXVA 3R2QA 5IM9A 4O5UA 2KP1A 2L6DA 4XS1A 4L5LA 1XCCA 5ELGA 2HLSA 4MZCA 3F0IA 3KH9A 3W8SA 2IIYA 2FWEA 3IK7A 5J41A 5ECSA 4MJBA 2YWNA 5H5RA 4OFNA 2HYXA 5AISA 2BMXA 4KB3A 2B1LA 4AKXB 3QFAC 3UJ1A 5ECNB 2FA4A 5CAXA 5A5KA 1V2AA 3VWXA 3RBTA 2GGTA 1JFUA 5KN2A 1Z5YE 2H0HA 4MLYA 3Q18A 4AKIA 1AIUA 2JSYA 2F9SA 4GSSA 1BG1A 1XZOA 1NHOA 1GSQA 4I5QA 3RDWA 17GSA 4L8EA 1SD9A 3GURA 1S3AA 1LJRA 4MF5A 3KJYA 3IBHA 4IJ3A 1GTBA 5A34A 3CXGA 1JHBA 4EL1A 1R4WA 4LMWA 3ZVJD 3VLNA 1EP8A 5J3RA 4L0WA 1OE8A 3MWHA 2L4QA 4EDZA 2LRNA 3F63A 1GP1A 2CA8A 4MJCA 3Q6OA 4MK3A 4EIQA 4POMA 3L78A 4F9ZA 1WJKA 1VRSD 5KOXA 1ERWA 4IVFA 4POKA 4I2UA 3IPZA 1OAZA 3O3TA 2DKIA 5LD0A 2NPBA 3GA4A 1ZMAA 3RGBC 1G0TA 5D73A 2J23A 4O7HA 4KSOA 2IMFA 3I9V2 5INYA 2LEGA 3UL3A 3VK9A 1Z6MA 5A5HA 4WR4A 9GSSA 1F2EA 3ED3A 4G0LA 3LW9A 4GRFA 3TKSC 2DJ3A 5GSSA 2JADA 1TK8B 5ECIB 1GSSA 3TCOA 1M2BA 3G9BA 3LJRA 1SL1B 5G2ZA 2GT6A 3FR3A 1J0FA 5IMAA 4FH8A 5FHIA 1TRSA 6GSTA 1MDIA 2K8SA 3KTLA 2FWFA 2VIMA 2HSNB 2C3NA 5J4YA 2CVDA 4TXOB 2FD3A 3I6AA 3EU4A 4FO5A 1N8JA 4N30A 1T4ZA 1BF5A 5HR0A 3C7MA 1YF0A 3APOA 4K7NA 1OC9A 3LORA 2N5FA 1IYHA 4TW5A 2K18A 4HOJA 1M9AA 3HCZA 4BL7B 2GQKA 2C0DA 3EE2A 3D6IA 2LNTA 4Q5QA 4IKHA 2YPMA 2LNSA 1AQWA 4KCEA 3ZIVA 4V1Ag 5JWQB 1QQ2A 3LFLA 4O92A 3UARA 4W66A 1V57A 4WXTA 3WGXA 4X1UA 4HQZA 4IP1A 3IC8A 5IOXA 3CMIA 2JZTA 2OE1A 5DJMA 3H1NA 5A4VA 2DMMA 1K0OA 2OACA 3GV1A 1SYXA 1WWJA 3LGCA 5IMVA 1WRYA 3RAZA 11GSA 4MJEA 3EURA 1BAYA 3HJPA 6GSSA 2FY6A 1U3IA 3FHKA 1BYEA 3GL5A 1XW6A 3ERWA 4Q5NA 1C72A 4V2LA 5J9CA 2CV4A 3EVIA 3FRCA 3C73A 4GSNA 5J47A 3FZ5A 5IIZA 2LS5A 1Z7RA 5CNWA 1XWGA 2A2SA 3TRXA 1EWXA 5DCHA 2I3YA 1M3JA 3A2XA 4J2FA 3AY8A 3QR6A 2RM6A 1ZCPA 2E7PA 4ZBDA 4OO5A 4EF0A 3KEBA 2QC7A 5HR1A 1KEBA 1SU9A 2TIRA 2HQTA 5DCGA 1I1IP 2YN1A 2FA8A 3DD3A 3CWGA 4ZILA 2WFCA 4ULXA 1FW1A 3ZITA 3TDGA 2WZSA 4KH7A 2MMOA 1GUKA 3DXBA 1B9XC 1OC8A 2H01A 5CRWA 2R3XA 2GSRA 2VL2A 3M3MA 3CRTA 3RPPA 5B8BA 5ECLB 3BCIA 1K0AA 3QCPA 2QKEA 4FIWA 3FMWA 1F9MA 1PX6A 1XG8A 3HZ8A 1PN9A 3QPMA 1ZL9A 2CAQA 2PVQA 3EPTA 3C71A 1TK5B 4BA7A 2H6XA 1WMJA 2H75A 4ZB9A 4PX1A 1GULA 3FYGA 3HZ4A 3HVVA 4KDUA 4I6XA 4E8EA 1O8WA 4QL7A 5G1LA 1Z6NA 2HZEB 2C0GA 3ZVJA 1DE1A 3VFIA 3GN3A 1A2LA 3HMJG 2VM1A 6GSXA 4HZ2A 1FVKA 5G1KA 1M2DA 5HFKA 1TI1A 3P8WA 3DEXA 4HSCX 1H4OA 3TKPA 3F8UA 5ELAA 4HUAA 2YOIA 2JSZA 4YQVA 1XFLA 2IPAA 2C3TA 4AKGA 2DJ0A 2H1BA 4AKHA 4K8MA 2NTOA 1TDIA 4PNFA 5DAKA 3QAWA 5J40A 2P0GA 1SENA 4ECIA 3TJFA 1YF1A 3CSJA 2PUKC 3ERFA 2JZRA 3KZQA 2VD1A 3F9UA 4ZL9A 5JCUA 2VCWA 2LQOA 2GT5A 2HRFA 6GSVA 2XPEA 4JR6A 2IMDA 2PERA 1PN0A 4OCFA 1TOFA 2C80A 2C0FA 2LJKA 3ZLPA 4MZWA 4LL1B 1Y25A 2WZ9A 2JU5A 1R5PA 5KN0A 5GAPD 2BTOT 1NHYA 3F6FA 4AGSA 5A4WA 1XPVA 4MF7A 4ICYA 1T1VA 2WB9A 4DVCA 2VCTA 2VD0A 1GSDA 5J4UA 4NV5A 3OR5A 3UBKA 1GSYA 1A2JA 4KF9A 1SJ6A 4WKWA 3GL3A 3EC3A 2O3EA 2PMTA 2H72A 2RUEA 3MNGA 2I81A 3H93A 4RQXA 4TR1A 2GZYA 4CDOA 4D73A 3WGDA 2HSMA 2ON5A 2DIZA 13GSA 4F03A 1J08A 6GSUA 1NW2A 1SD8A 3TRPA 5DAKB 2RIIA 2FWHA 3F3RA 2GQLA 2H70A 2L4CA 3EINA 4FXYP 4NPBA 3A2WA 2R37A 4XS4A 1BJXA 2X8HA 1KNGA 1SK1A 5DALB 1O6JA 2H1LA 4XRAA 3TB2A 2QA2A 2E2GA 1EGOA 4N0VA 3A5IA 1HQOA 1R7HA 1A2MA 3FZAA 3E3EA 1EP7A 3KP8A 4AF2A 3HA9A 4KNDA 2D2ZA 2FUG2 3F3QA 4IGJA 2I1UA 1VF4A 1QGVA 3GTUA 4LL4B 2GZPA 4BVYB 1SJZA 3Q19A 2WW2A 1MEKA 2DC5A 2IFQB 2EFEA 4MCUA 5JWRB 4PUAA 5ECMB 1K0DA 5EVOA 3HKRA 1WE0A 4Z2TA 1XVWA 3GX0A 4N0ZA 1YJ6A 2X99A 1AW9A 2PU9C 2V41A 4GQFA 2WW3A 3Q74A 4JR4A 5DVBA 3IK9A 2X8CA 5ID2A 2DJ1A 4IQ1A 3ZFLA 1PD21 2LUSA 3LWAA 1G7EA 3KCMA 1PL1A 3R3EA 4POBA 2VLTA 2I4AA 5D9WA 1OKTA 1CQGA 2Z9SA 1ERVA 2WCIA 4IHUA 2R4VA 2RM5A 3TOTA 2ZUPA 1SKRB 1UC7A 2ES7A 2HT9A 3MAKA 3M9JA 4NV2A 2CX3A 4IS0A 1A23A 2K9FA 3DRNA 3JCML 1SVMA 2XBQA 3M8NA 3RHBA 3WGEA 1M0UA 3N5OA 4CY6A 4G10A 3GRXA 4HU9A 2JZSA 3A3TA 4LMVA 3KD0A 5CO3A 3TKSE 3TJJA 2LJRA 3UVHA 4PXOA 3GX8A 1QMVA 3PPUA 2IL3A 1XW5A 1M7TA 1ON4A 1XOAA 1IYIA 2WS2A 5D9TA 1PKZA 3WD6A 3D21A 2FWGA 1TK0B 1JZWA 3C1SA 4MH3A 1VF1A 4ZXGA 5A4UA 3HD5A 3UIWA 5AN1A 2MYGA 1GWCA 1JLVA 4ECCA 2WVXA 4ZIJA 1VF2A 2REMA 3IR4A 4KX4A 3ERGA 2O85A 2OBIA 2EFHA 1W4VA 1GNEA 4IBPA 2OA7A 1FB0A 1PFOA 3P7XA 4G2EA 4WETA 1ZZYA 2HNLA 1SK2A 1UN2A 5EPFA 4PUFC 5LCZA 2NDOA 4ZB6A 20GSA 4TR4A 3CRUA 2CQ9A 3H79A 3UOMA 2H30A 3TJKA 4DSQA 1SVOA 4KW6A 3LEFA 5ID2B 3WT1A 2FHEA 4PI0C 2XHFA 2GQMA 3KTBA 1X9WB 1UVZA 1ZYEA 1Q98A 3S9FA 4GF0A 4YKGA 2R0PA 4K2XA 1TW9A 1ZOFA 4X43A 2L5LA 2KUCA 4EC0A 2WRTA 3GH9A 3SWLA 1YVLA 2VAFA 2JACA 3MSZA 4Z7XA 4K6XA 4MP4A 2YV9A 3FK8A 2HZFA 5IQYA 5DQSA 2QSIA 2NVLA 1O8XA 1E6BA 3U5RE 1MDKA 3ZTLA 5A34B 3I69A 3ZMKA 4MMMA 1PA3A 4MDCA 4OD7A 1G6WA 2H73A 1GH2A 2VOCA 5ENUA 4G9HA 3CTGA 4WR5A 1F3AA 2A4HA 1TJDA 2H6ZA 4FQUA 3P2AA 2YWIA 4QMKA 1A0RP 1KBNA 1H75A 1W89A 2DMLA 1FOVA 5IPHA 2WVXB 5ECPB 3IRAA 2VCXA 3BJ5A 3DKSA 4KCAA 3VWVA 2H8LA 2HXKA 1PQNA 5F05A 2O5VA 2ZNMA 1B8XA 2AHEA 2GSSA 1FB6A 3CSHA 4OO4A 5KN3A 4DSSA 5COHA 1WIKA 5A5HB 2CZ3A 3IA1A 1M3IA 3QAGA 2FNOA 5IMFA 2VO4A 3GMFA 1GSFA 2J9HA 4GCIA 1HNCA 4QQ7A 1YQ1A 2YJ7A 4MJAA 5D8IA 4FYUA 2V1MA 2BJXA 1NSWA 4K7IA 2K6VA 3D0ZA 4YKFA 1HD2A 1K0MA 3UMAA 2VLVA 3FY7A 2EC4A 5B7CA 2WJUA 2MBTA 3HDCA 1S3CA 3TOUA 3APQA 4PTSA 3VI7A 1TP9A 5JWOB 3F4SA 4GXZA 2M46A 2P5QA 4BIKA 4RI6A 2LRCA 2PWJA 1EZKA 3IOSA 2EIRA 3H4KA 3FZ9A 4E8HA 1AUCA 3F4RA 1OC9B 1O85A 1M99A 1GSUA 3VPQA 7GSSA 1OKDA 4CW9A 3A2VA 4PQIA 4XIHA 2K8VA 5A1NA 2YZHA 1R5AA 5CP1A 3G7JA 3M1GA 5C04A 2R0GA 4N11A 1XW9A 1B4QA 1GLPA 3US3A 1I5GA 2KHPA 4K2DA 4MH2A 1XXUA 4O5QA 4HS1A 3TJBA 4K5SA 2L57A 1XWKA 1QXHA 2MMZA 2B6MA 3L9UA 4ML1A 1Q4JA 3L9SA 2AYTA 4ZB7A 4BWQA 4BVXA 2A4VA 2FGXA 2R2JA 4GQCA 3ZFBA 4HU7A 1YKCA 2IJYA 4WF4A 2LJAA 5J4VA 1DSBA 3TKQA 2FLSA 5DQYA 2V2GA 3ZZXA 5H5SA 1MD3A 4N3ZA 5IMDA 3P90A 3RFRC 5BMUA 5CREA 5CYYA 4JRRA 1U88A 1V98A 1URMA 4I8BA 5HR2A 2EIQA 4YAVA 2L5OA 1PX7A 2PVOC 5GZZB 2DSAA 3RPNA 1E2YA 4P3YB 4TN8A 2L6CA 2C3QA 1G7OA 1OVNA 2IWTA 4H86A 1ZGNA 4KGIA 2HRNA 2X64A 2MBSA 1BEDA 1RW1A 5D93A 1XBSA 2H76A 4KSMA 1QUWA 4Q5RA 1XVQA 3KP9A 3BBYA 1K3LA 2VM2A 1EV4A 5HR3A 4XS6A 1EV9A 1PGTA 2HE3A 3GHAA 3NZNA 4HQSA 4MNNA 3HJOA 2P31A 2H1GA 2AB6A 2X4AA 3IHGA 4KE3A 3EWLA 5JCGA 1Z3EA 4NWYA 3L4NA 2V6OA 2HRKA 3HXSA 3HYPA 2FCHA 2H19A 3GYKA 1THOA 2DLXA 3KXOA 3J7Yb 2H0IA 1SKWB 4GSTA 3UBLA 3QFBC 5J5NA 4GDFA 2UZ8A 2NBSA 4Z2RA 1EEJA 2VCZA 4Q5FA 5ABRA 1T3BA 1SYRA 4USSA 4CHSA 1FOHA 1T4YA 1B48A 2A2PA 1R26A 14GSA 4ZBBA 3O76A 2OE3A 1SK0A 2O89A 1SJIA 3GKMA 5AGYA 3ME8A 3IE3A 1ZYQB 4K7OA 3DVWA 4F82A 1A24A 2N5BA 1K3YA 1YZXA 4IW9A 2F3MA 1MD4A 3EMXA 1EOHA 18GSA 1S3RA 5D9VA 2G0FA 4PNGA 4V2MA 3ZYWA 3PGTA 2YZUA 3CQFA 5HFIA 3TKSA 4OFTA 4NXIA 6GSWA 2VKZG 1PKWA 4I97A 4JEDA 2GTUA 2V6KA 1NM3A 3LQ7A 1GTUA 1RQMA 2OT3A 2O7KA 1YEXA 1V9WA 4EDYA 5E59A 5F06A 1YKAA 3CHXC 1FAAA 3QAVA 3KIJA 4MA9A 2C0EA 5AIXA 3FW2A 4PQ1A 5ECKB 2L59A 3L9VA 3BOAA 4E68A 3M0FA 2WDUA 4TKYA 5KEJA 3H8QA 4MF6A 4XTSA 2RUFA 2X8GA 4V1Ap 5BRTA 2VL2C 1XIYA 3KM6A 2H1AA 5CRHA 1PRXA 4V2NA 2MMNA 4K9ZA 1OC3A 1TTZA 1JZOA 2IMKA 2M80A 2AJQB 2EFDA
chains in the Genus database with same CATH topology
3PH9A 2GSQA 1X5EA 4JU5A 5ECRB 2CVKA 3M9KA 3IAM2 3TJGA 4QL9A 4ZBAA 3QOUA 4ZL8A 1DBYA 2R0CA 4MZBA 2HRAA 3BCKA 3UEMA 2H66A 5CRGA 5IPGA 2MZCA 2PGTA 1PSQA 4IN0A 2LV3A 1AAZA 2F51A 3C1RA 2CVBA 3G7YA 1QK8A 4JZQA 3D22A 2LRTA 3MYDA 5B6NA 1EOGA 5AIVA 3LYKA 1K3OA 1G6YA 3EU3A 1XWBA 4HJ2A 4RQRA 2YP6A 1FHEA 3TUEA 4TR1B 1ERUA 4MPGA 2DIYA 4D73B 3IC4A 4KAEA 2HSMB 2GSTA 5G5EA 2YANA 2KLXA 4EVMA 3ISOA 1FG4A 1THXA 1BX9A 3GKNA 3IXRA 4JE1A 4G0IA 1EGRA 1GTAA 3F4TA 4F0BA 1B9YC 4XS4B 4L5OA 1T7PB 3GIXA 1M9BA 4MABA 3VWWA 1V58A 4WEYA 2ALBA 2E0QA 2HSNA 3LSZA 1Z7PA 1GLQA 3FR9A 4OFMA 3D4TA 4TXOA 1FO5A 4TR0A 1SKSB 2DKHA 3ZIJA 2LSTA 3A5WA 4G19A 1F3BA 2R6KA 3KMNA 3GTUB 3PR8A 4ISDA 1A8YA 1GTIA 5LNKe 4OCEA 5IMCA 5C00A 2XC2A 4PGTA 4ECJA 3ZL5A 2CX4A 4BL7A 2B3SA 3HVXA 1A0FA 3WYWA 3DMLA 3IV4A 2DBCA 2DJJA 3EYTA 2VUPA 3U6VA 2B1KA 1F37A 16GSA 3VWUA 4N10A 1OYJA 2H74A 5IMZA 3D5JA 2B5XA 2VLUA 3IDVA 4J56E 3D4MA 2TRXA 3UVTA 3FEUA 3FR6A 4ILFA 1GRXA 2KP2A 1Y1UA 3HVSA 2ON7A 2YCDA 2UV8G 2N5AA 4WBRD 1CQHA 1J9BA 4X0XA 1WOUA 2C8UA 5L71A 5KN1A 2VCQA 3KGKA 2HFDA 1HNBA 5IOWA 2YV7A 2O87A 3PINA 1Z9HA 1TKDB 4ZL7A 2HSYA 3E0UA 3L0HA 2IN3A 4POLA 1S3DA 3DIEA 4YQMA 4L0UA 1N2AA 4IJIA 3VURA 1BG5A 1YEPA 5IO2A 5B6MA 3EMPA 2G2QA 3VPTA 3APSA 2O8VB 1AQXA 3KMOA 1TRUA 4WF5A 1ZYNA 1U87A 2MMAA 2AV4A 1O81A 5FT3A 1USBA 4GLTA 5G31A 1X9MB 4G01A 2R5GA 1A8LA 2B5YA 4BWSA 2F8FA 3E9JB 5HFGA 5D9XA 6GSYA 3J7Yk 3HY2A 1T8EB 1ERTA 2IMEA 1AQVA 4EXJA 4HJMA 1SL0B 3GKKA 3NIVA 4AI6A 3CSIA 2VL3A 2ZCTA 4ML6A 1YDKA 5GAND 3N9JA 2CT6A 2WULA 3IAS2 1MDJA 2YWMA 3LXTA 2HZEA 1OE7A 4HZ4A 1U3AA 4IELA 4ECBA 1V40A 2AAWA 1PMTA 3G7IA 3QDNA 1GSEA 3LG6A 2DJ2A 1GUHA 4AJ8A 4PQHA 1GUMA 1ACVA 1I9DA 4TVEA 4BPYA 2HSHA 2GDRA 3ZMLA 1TU7A 2X49A 4DSSB 2KOKA 4G0KA 2XBIA 1RK4A 5F8BA 3UAPA 3CTFA 3VI5A 1N25A 3GSSA 4F0CA 2PN8A 4TRXA 3BD2A 2GLRA 3NOFA 5DDLA 4NHWA 4GWRA 1AC1A 5CRDA 5DJLA 5G5FA 1U6TA 4F2IA 1JZRA 4IQAA 2H0GA 2IMIA 1TRWA 3I43A 4FYCA 2XPDA 2OJLA 2B7JA 12GSA 4KA0A 1TI3A 2JL4A 1QFNA 2C4JA 4HI7A 2CZ2A 2OADA 1M2AA 4NHZA 4YQUA 5J9BA 3HJMA 3ZREA 5ECHB 2P5RA 3GFKA 1XOBA 1VGLA 3TKRA 1BQ7A 1X9SB 5E4WA 1LBKA 3CYNA 3GNJA 5GSTA 1AXDA 2V32A 1EEMA 3V1WA 1FVJA 4RI7A 5B8AA 3FKFA 4MPFA 1UA5A 4K5RA 4EIPA 2LKUA 2PPTA 3W8JA 4NMUA 4AJ6A 2LQQA 4AJ7A 2CAIA 2YJHA 1YY7A 22GSA 5F07A 4YAPA 5A1NB 1TXXA 5IO0A 1GNWA 5EL8A 4A5PA 1PL2A 4K0NA 2VL9A 2YNXA 5KOWA 3SBCA 19GSA 1Y6EA 3QMXA 3GSTA 3ZRDA 4RUVA 3GKXA 3GUSA 4OMVA 5D96A 4KDXA 4O32A 1X5DA 3DGQA 4KDYA 2OE0A 3HHVA 4IP6A 1TRVA 1HNAA 2PBJA 1SL2B 4BVXB 1K0CA 1HYUA 5G30A 2H1DA 4WBJA 1TU8A 4FYBA 4K0GA 2EFCA 1JZDA 4GTUA 4YH2A 8GSSA 3KH7A 3GH6A 4XRDA 1JLWA 4JBBA 1DUGA 5DALA 4LA1A 2OKAA 3FZ4A 2F8AA 1X0RA 4HDEA 3IHQA 5BMUB 1LU4A 4CY8A 4Z2UA 4XHMA 4NAXA 1X5CA 2RLIA 2I9HA 3LXZA 2WGRA 3LYPA 3TU3B 1ILOA 2AUVA 3DVXA 4TOPA 4BVYA 1ABAA 2E2MA 4KUNA 2M72A 5F0GA 2IFQA 1MTCA 4OWYA 3C8EA 4I2TA 3TGZA 2LTKA 1WPIA 3F6DA 1T00A 2HI7A 1DE2A 1F6MC 2QA1A 4HEA2 3DWVA 5ECOB 1O73A 4DEJA 1B4PA 1TXUA 2A2RA 1K0BA 4LLRA 2OBKA 1ML6A 2HRKB 2GS3A 4J57E 1O7UA 3W6GA 3QD9A 1WP0A 1XWCA 10GSA 2DJKA 5EY6A 4ZB8A 5HQPA 4EKZA 2C1YA 3CBUA 3WT2A 2B7KA 2TRCP 2VCVA 1ZYPA 2EIOA 3K8NA 2GZZA 1KTEA 2QGVA 3MIXA 5FWGA 4X4JA 5DBQA 3ME7A 4O5RA 2H6YA 1ST9A 2GVPA 4EO3A 3TRQA 5JCWA 4K1FA 4TR3A 2B5EA 2YWOA 3RHCA 4ACSA 1GL8A 4XCSA 1XWAA 4PURA 5H5QA 2H71A 4EE0A 3DYRA 1VF3A 4EUYA 1SVLA 4ID0A 3O6TA 4DSRA 3MDKA 1K0NA 5ECQB 4TXVA 3R2QA 5IM9A 4O5UA 2KP1A 2L6DA 4XS1A 4L5LA 1XCCA 5ELGA 2HLSA 4MZCA 3F0IA 3KH9A 3W8SA 2IIYA 2FWEA 3IK7A 5J41A 5ECSA 4MJBA 2YWNA 5H5RA 4OFNA 2HYXA 5AISA 2BMXA 4KB3A 2B1LA 4AKXB 3QFAC 3UJ1A 5ECNB 2FA4A 5CAXA 5A5KA 1V2AA 3VWXA 3RBTA 2GGTA 1JFUA 5KN2A 1Z5YE 2H0HA 4MLYA 3Q18A 4AKIA 1AIUA 2JSYA 2F9SA 4GSSA 1BG1A 1XZOA 1NHOA 1GSQA 4I5QA 3RDWA 17GSA 4L8EA 1SD9A 3GURA 1S3AA 1LJRA 4MF5A 3KJYA 3IBHA 4IJ3A 1GTBA 5A34A 3CXGA 1JHBA 4EL1A 1R4WA 4LMWA 3ZVJD 3VLNA 1EP8A 5J3RA 4L0WA 1OE8A 3MWHA 2L4QA 4EDZA 2LRNA 3F63A 1GP1A 2CA8A 4MJCA 3Q6OA 4MK3A 4EIQA 4POMA 3L78A 4F9ZA 1WJKA 1VRSD 5KOXA 1ERWA 4IVFA 4POKA 4I2UA 3IPZA 1OAZA 3O3TA 2DKIA 5LD0A 2NPBA 3GA4A 1ZMAA 1G0TA 5D73A 2J23A 4O7HA 4KSOA 2IMFA 3I9V2 5INYA 2LEGA 3UL3A 3VK9A 1Z6MA 5A5HA 4WR4A 9GSSA 1F2EA 3ED3A 4G0LA 3LW9A 4GRFA 3TKSC 2DJ3A 5GSSA 2JADA 1TK8B 5ECIB 1GSSA 3TCOA 1M2BA 3G9BA 3LJRA 1SL1B 5G2ZA 2GT6A 3FR3A 1J0FA 5IMAA 4FH8A 5FHIA 1TRSA 6GSTA 1MDIA 2K8SA 3KTLA 2FWFA 2VIMA 2HSNB 2C3NA 5J4YA 2CVDA 4TXOB 2FD3A 3I6AA 3EU4A 4FO5A 1N8JA 4N30A 1T4ZA 1BF5A 5HR0A 3C7MA 1YF0A 3APOA 4K7NA 1OC9A 3LORA 2N5FA 1IYHA 4TW5A 2K18A 4HOJA 1M9AA 3HCZA 4BL7B 2GQKA 2C0DA 3EE2A 3D6IA 2LNTA 4Q5QA 4IKHA 2YPMA 2LNSA 1AQWA 4KCEA 3ZIVA 4V1Ag 5JWQB 1QQ2A 3LFLA 4O92A 3UARA 4W66A 1V57A 4WXTA 3WGXA 4X1UA 4HQZA 4IP1A 3IC8A 5IOXA 3CMIA 2JZTA 2OE1A 5DJMA 3H1NA 5A4VA 2DMMA 1K0OA 2OACA 3GV1A 1SYXA 1WWJA 3LGCA 5IMVA 1WRYA 3RAZA 11GSA 4MJEA 3EURA 1BAYA 3HJPA 6GSSA 2FY6A 1U3IA 3FHKA 1BYEA 3GL5A 1XW6A 3ERWA 4Q5NA 1C72A 4V2LA 5J9CA 2CV4A 3EVIA 3FRCA 3C73A 4GSNA 5J47A 3FZ5A 5IIZA 2LS5A 1Z7RA 5CNWA 1XWGA 2A2SA 3TRXA 1EWXA 5DCHA 2I3YA 3A2XA 4J2FA 3AY8A 3QR6A 2RM6A 1ZCPA 2E7PA 4ZBDA 4OO5A 4EF0A 3KEBA 2QC7A 5HR1A 1KEBA 1SU9A 2TIRA 2HQTA 5DCGA 2YN1A 2FA8A 3DD3A 3CWGA 4ZILA 2WFCA 4ULXA 1FW1A 3ZITA 3TDGA 4KH7A 2MMOA 1GUKA 3DXBA 1B9XC 1OC8A 2H01A 5CRWA 2R3XA 2GSRA 2VL2A 3M3MA 3CRTA 3RPPA 5B8BA 5ECLB 3BCIA 1K0AA 3QCPA 2QKEA 4FIWA 3FMWA 1F9MA 1PX6A 3HZ8A 1PN9A 3QPMA 1ZL9A 2CAQA 2PVQA 3EPTA 3C71A 1TK5B 4BA7A 2H6XA 1WMJA 2H75A 4ZB9A 4PX1A 1GULA 3FYGA 3HZ4A 3HVVA 4KDUA 4I6XA 4E8EA 1O8WA 4QL7A 5G1LA 1Z6NA 2HZEB 2C0GA 3ZVJA 1DE1A 3VFIA 3GN3A 1A2LA 3HMJG 2VM1A 6GSXA 4HZ2A 1FVKA 5G1KA 1M2DA 5HFKA 1TI1A 3P8WA 3DEXA 1H4OA 3TKPA 3F8UA 5ELAA 4HUAA 2YOIA 2JSZA 4YQVA 1XFLA 2IPAA 2C3TA 4AKGA 2DJ0A 2H1BA 4AKHA 4K8MA 2NTOA 1TDIA 4PNFA 5DAKA 3QAWA 5J40A 2P0GA 1SENA 4ECIA 3TJFA 1YF1A 3CSJA 2PUKC 3ERFA 2JZRA 3KZQA 2VD1A 3F9UA 4ZL9A 5JCUA 2VCWA 2LQOA 2GT5A 2HRFA 6GSVA 2XPEA 4JR6A 2IMDA 2PERA 1PN0A 4OCFA 1TOFA 2C80A 2C0FA 2LJKA 3ZLPA 4MZWA 4LL1B 1Y25A 2WZ9A 2JU5A 1R5PA 5KN0A 5GAPD 2BTOT 1NHYA 3F6FA 4AGSA 5A4WA 1XPVA 4MF7A 4ICYA 1T1VA 2WB9A 4DVCA 2VCTA 2VD0A 1GSDA 5J4UA 4NV5A 3OR5A 3UBKA 1GSYA 1A2JA 4KF9A 1SJ6A 4WKWA 3GL3A 3EC3A 2PMTA 2H72A 2RUEA 3MNGA 2I81A 3H93A 4RQXA 4TR1A 2GZYA 4CDOA 4D73A 3WGDA 2HSMA 2ON5A 2DIZA 13GSA 4F03A 1J08A 6GSUA 1NW2A 1SD8A 3TRPA 5DAKB 2RIIA 2FWHA 3F3RA 2GQLA 2H70A 2L4CA 3EINA 4NPBA 3A2WA 2R37A 4XS4A 1BJXA 2X8HA 1KNGA 1SK1A 5DALB 1O6JA 2H1LA 4XRAA 3TB2A 2QA2A 2E2GA 1EGOA 4N0VA 3A5IA 1HQOA 1R7HA 1A2MA 3FZAA 3E3EA 3KP8A 1EP7A 4AF2A 3HA9A 4KNDA 2D2ZA 2FUG2 3F3QA 4IGJA 2I1UA 1VF4A 1QGVA 3GTUA 4LL4B 2GZPA 4BVYB 1SJZA 3Q19A 1MEKA 2DC5A 2IFQB 2EFEA 4MCUA 5JWRB 4PUAA 5ECMB 1K0DA 5EVOA 3HKRA 1WE0A 4Z2TA 1XVWA 3GX0A 4N0ZA 1YJ6A 2X99A 1AW9A 2PU9C 2V41A 4GQFA 3Q74A 4JR4A 5DVBA 3IK9A 2X8CA 5ID2A 2DJ1A 4IQ1A 3ZFLA 1PD21 2LUSA 3LWAA 1G7EA 3KCMA 1PL1A 3R3EA 4POBA 2VLTA 2I4AA 5D9WA 1OKTA 1CQGA 2Z9SA 1ERVA 2WCIA 4IHUA 2R4VA 2RM5A 3TOTA 2ZUPA 1SKRB 1UC7A 2ES7A 2HT9A 3MAKA 3M9JA 4NV2A 2CX3A 4IS0A 1A23A 2K9FA 3DRNA 3JCML 1SVMA 2XBQA 3M8NA 3RHBA 3WGEA 1M0UA 3N5OA 4CY6A 4G10A 3GRXA 4HU9A 2JZSA 3A3TA 4LMVA 3KD0A 5CO3A 3TKSE 3TJJA 2LJRA 3UVHA 4PXOA 3GX8A 1QMVA 3PPUA 2IL3A 1XW5A 1M7TA 1ON4A 1XOAA 1IYIA 2WS2A 5D9TA 1PKZA 3WD6A 3D21A 2FWGA 1TK0B 1JZWA 3C1SA 4MH3A 1VF1A 4ZXGA 5A4UA 3HD5A 3UIWA 5AN1A 2MYGA 1GWCA 1JLVA 4ECCA 4ZIJA 1VF2A 2REMA 3IR4A 4KX4A 3ERGA 2O85A 2OBIA 2EFHA 1W4VA 1GNEA 4IBPA 2OA7A 1FB0A 3P7XA 4G2EA 4WETA 1ZZYA 2HNLA 1SK2A 1UN2A 5EPFA 4PUFC 5LCZA 2NDOA 4ZB6A 20GSA 4TR4A 3CRUA 2CQ9A 3H79A 3UOMA 2H30A 3TJKA 4DSQA 1SVOA 4KW6A 3LEFA 5ID2B 3WT1A 2FHEA 2XHFA 2GQMA 3KTBA 1X9WB 1UVZA 1ZYEA 1Q98A 3S9FA 4GF0A 4YKGA 2R0PA 4K2XA 1TW9A 1ZOFA 4X43A 2L5LA 2KUCA 4EC0A 2WRTA 3GH9A 3SWLA 1YVLA 2VAFA 2JACA 3MSZA 4Z7XA 4K6XA 4MP4A 2YV9A 3FK8A 2HZFA 5IQYA 5DQSA 2QSIA 2NVLA 1O8XA 1E6BA 3U5RE 1MDKA 3ZTLA 5A34B 3I69A 3ZMKA 4MMMA 1PA3A 4MDCA 4OD7A 1G6WA 2H73A 1GH2A 2VOCA 5ENUA 4G9HA 3CTGA 4WR5A 1F3AA 2A4HA 1TJDA 2H6ZA 4FQUA 3P2AA 2YWIA 4QMKA 1A0RP 1KBNA 1H75A 1W89A 2DMLA 1FOVA 5IPHA 5ECPB 3IRAA 2VCXA 3BJ5A 3DKSA 4KCAA 3VWVA 2H8LA 2HXKA 1PQNA 5F05A 2O5VA 2ZNMA 1B8XA 2AHEA 2GSSA 1FB6A 3CSHA 4OO4A 5KN3A 4DSSA 5COHA 1WIKA 5A5HB 2CZ3A 3IA1A 3QAGA 2FNOA 5IMFA 2VO4A 3GMFA 1GSFA 2J9HA 4GCIA 1HNCA 4QQ7A 1YQ1A 2YJ7A 4MJAA 5D8IA 4FYUA 2V1MA 2BJXA 1NSWA 4K7IA 2K6VA 3D0ZA 4YKFA 1HD2A 1K0MA 3UMAA 2VLVA 3FY7A 2EC4A 5B7CA 2WJUA 2MBTA 3HDCA 1S3CA 3TOUA 3APQA 4PTSA 3VI7A 1TP9A 5JWOB 3F4SA 4GXZA 2M46A 2P5QA 4RI6A 2LRCA 2PWJA 1EZKA 3IOSA 2EIRA 3H4KA 3FZ9A 4E8HA 1AUCA 3F4RA 1OC9B 1O85A 1M99A 1GSUA 3VPQA 7GSSA 1OKDA 4CW9A 3A2VA 4PQIA 4XIHA 2K8VA 5A1NA 2YZHA 1R5AA 5CP1A 3G7JA 3M1GA 5C04A 2R0GA 4N11A 1XW9A 1B4QA 1GLPA 3US3A 1I5GA 2KHPA 4K2DA 4MH2A 1XXUA 4O5QA 4HS1A 3TJBA 4K5SA 2L57A 1XWKA 1QXHA 2MMZA 2B6MA 3L9UA 4ML1A 1Q4JA 3L9SA 2AYTA 4ZB7A 4BWQA 4BVXA 2A4VA 2FGXA 2R2JA 4GQCA 3ZFBA 4HU7A 1YKCA 2IJYA 4WF4A 2LJAA 5J4VA 1DSBA 3TKQA 2FLSA 5DQYA 2V2GA 3ZZXA 5H5SA 1MD3A 4N3ZA 5IMDA 3P90A 5BMUA 5CREA 5CYYA 4JRRA 1U88A 1V98A 1URMA 4I8BA 5HR2A 2EIQA 4YAVA 2L5OA 1PX7A 2PVOC 5GZZB 2DSAA 3RPNA 1E2YA 4P3YB 4TN8A 2L6CA 2C3QA 1G7OA 1OVNA 2IWTA 4H86A 1ZGNA 4KGIA 2HRNA 2X64A 2MBSA 1BEDA 1RW1A 5D93A 1XBSA 2H76A 4KSMA 1QUWA 4Q5RA 1XVQA 3KP9A 3BBYA 1K3LA 2VM2A 1EV4A 5HR3A 4XS6A 1EV9A 1PGTA 2HE3A 3GHAA 3NZNA 4HQSA 4MNNA 3HJOA 2P31A 2H1GA 2AB6A 2X4AA 3IHGA 4KE3A 3EWLA 5JCGA 1Z3EA 4NWYA 3L4NA 2V6OA 2HRKA 3HXSA 3HYPA 2FCHA 2H19A 3GYKA 1THOA 2DLXA 3KXOA 3J7Yb 2H0IA 1SKWB 4GSTA 3UBLA 3QFBC 5J5NA 4GDFA 2UZ8A 2NBSA 4Z2RA 1EEJA 2VCZA 4Q5FA 5ABRA 1T3BA 1SYRA 4USSA 4CHSA 1FOHA 1T4YA 1B48A 2A2PA 1R26A 14GSA 4ZBBA 3O76A 2OE3A 1SK0A 2O89A 1SJIA 3GKMA 5AGYA 3ME8A 3IE3A 1ZYQB 4K7OA 3DVWA 4F82A 1A24A 2N5BA 1K3YA 1YZXA 4IW9A 2F3MA 1MD4A 3EMXA 1EOHA 18GSA 5D9VA 2G0FA 4PNGA 4V2MA 3ZYWA 3PGTA 2YZUA 5HFIA 3TKSA 4OFTA 4NXIA 6GSWA 2VKZG 1PKWA 4I97A 4JEDA 2GTUA 2V6KA 1NM3A 3LQ7A 1GTUA 1RQMA 2OT3A 2O7KA 1YEXA 1V9WA 4EDYA 5E59A 5F06A 1YKAA 1FAAA 3QAVA 3KIJA 4MA9A 2C0EA 5AIXA 3FW2A 4PQ1A 5ECKB 2L59A 3L9VA 3BOAA 4E68A 3M0FA 2WDUA 4TKYA 5KEJA 3H8QA 4MF6A 4XTSA 2RUFA 2X8GA 4V1Ap 5BRTA 2VL2C 1XIYA 3KM6A 2H1AA 5CRHA 1PRXA 4V2NA 2MMNA 4K9ZA 1OC3A 1TTZA 1JZOA 2IMKA 2M80A 2AJQB 2EFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PH9 A;  2GSQ A;  1X5E A;  4JU5 A;  5ECR B;  2CVK A;  3M9K A;  3IAM 2;  3TJG A;  4QL9 A;  4ZBA A;  3QOU A;  4ZL8 A;  1DBY A;  4MZB A;  2HRA A;  3BCK A;  3UEM A;  2H66 A;  5CRG A;  5IPG A;  2MZC A;  2PGT A;  1PSQ A;  4IN0 A;  2LV3 A;  1AAZ A;  2F51 A;  3C1R A;  2CVB A;  3G7Y A;  1QK8 A;  4JZQ A;  3D22 A;  2LRT A;  5B6N A;  1EOG A;  5AIV A;  3LYK A;  1K3O A;  1G6Y A;  3EU3 A;  1XWB A;  4HJ2 A;  4RQR A;  2YP6 A;  1FHE A;  3TUE A;  4TR1 B;  1ERU A;  4MPG A;  2DIY A;  4D73 B;  3IC4 A;  4KAE A;  2HSM B;  2GST A;  5G5E A;  2YAN A;  2KLX A;  4EVM A;  3ISO A;  1FG4 A;  1THX A;  1BX9 A;  3GKN A;  3IXR A;  4JE1 A;  4G0I A;  1EGR A;  1GTA A;  3F4T A;  4F0B A;  1B9Y C;  4XS4 B;  4L5O A;  1T7P B;  3GIX A;  1M9B A;  4MAB A;  3VWW A;  1V58 A;  4WEY A;  2ALB A;  2E0Q A;  3LSZ A;  1Z7P A;  1GLQ A;  3FR9 A;  4OFM A;  3D4T A;  4TXO A;  1FO5 A;  4TR0 A;  1SKS B;  3ZIJ A;  2LST A;  3A5W A;  4G19 A;  1F3B A;  2R6K A;  3KMN A;  3GTU B;  3PR8 A;  4ISD A;  1A8Y A;  1GTI A;  5LNK e;  4OCE A;  5IMC A;  5C00 A;  2XC2 A;  4PGT A;  4ECJ A;  3ZL5 A;  2CX4 A;  4BL7 A;  2B3S A;  3HVX A;  1A0F A;  3WYW A;  3DML A;  3IV4 A;  2DBC A;  2DJJ A;  3EYT A;  2VUP A;  3U6V A;  2B1K A;  1F37 A;  16GS A;  3VWU A;  4N10 A;  1OYJ A;  2H74 A;  5IMZ A;  3D5J A;  2B5X A;  2VLU A;  3IDV A;  4J56 E;  3D4M A;  2TRX A;  3UVT A;  3FEU A;  3FR6 A;  4ILF A;  1GRX A;  2KP2 A;  3HVS A;  2ON7 A;  2YCD A;  2N5A A;  4WBR D;  1CQH A;  1J9B A;  4X0X A;  1WOU A;  2C8U A;  5L71 A;  5KN1 A;  2VCQ A;  3KGK A;  2HFD A;  1HNB A;  5IOW A;  2YV7 A;  2O87 A;  3PIN A;  1Z9H A;  1TKD B;  4ZL7 A;  2HSY A;  3E0U A;  3L0H A;  2IN3 A;  4POL A;  1S3D A;  3DIE A;  4YQM A;  4L0U A;  1N2A A;  4IJI A;  3VUR A;  1BG5 A;  1YEP A;  5IO2 A;  5B6M A;  3EMP A;  2G2Q A;  3VPT A;  3APS A;  2O8V B;  1AQX A;  3KMO A;  1TRU A;  4WF5 A;  1U87 A;  2MMA A;  2AV4 A;  1O81 A;  5FT3 A;  1USB A;  4GLT A;  5G31 A;  1X9M B;  2R5G A;  1A8L A;  2B5Y A;  4BWS A;  2F8F A;  3E9J B;  5HFG A;  5D9X A;  6GSY A;  3J7Y k;  3HY2 A;  1T8E B;  1ERT A;  2IME A;  1AQV A;  4EXJ A;  4HJM A;  1SL0 B;  3GKK A;  3NIV A;  3CSI A;  2VL3 A;  2ZCT A;  4ML6 A;  1YDK A;  5GAN D;  3N9J A;  2CT6 A;  2WUL A;  3IAS 2;  1MDJ A;  2YWM A;  3LXT A;  2HZE A;  1OE7 A;  4HZ4 A;  4IEL A;  4ECB A;  1V40 A;  1U3A A;  2AAW A;  1PMT A;  3G7I A;  3QDN A;  1GSE A;  3LG6 A;  2DJ2 A;  1GUH A;  4AJ8 A;  4PQH A;  1GUM A;  1ACV A;  1I9D A;  4TVE A;  4BPY A;  2HSH A;  2GDR A;  3ZML A;  1TU7 A;  4DSS B;  2KOK A;  4G0K A;  2XBI A;  1RK4 A;  5F8B A;  3UAP A;  3CTF A;  3VI5 A;  3GSS A;  4F0C A;  2PN8 A;  4TRX A;  3BD2 A;  2GLR A;  3NOF A;  5DDL A;  4NHW A;  4GWR A;  1AC1 A;  5CRD A;  5DJL A;  5G5F A;  1U6T A;  4F2I A;  1JZR A;  4IQA A;  2H0G A;  2IMI A;  1TRW A;  3I43 A;  4FYC A;  2XPD A;  2OJL A;  2B7J A;  12GS A;  4KA0 A;  1TI3 A;  2JL4 A;  1QFN A;  2C4J A;  4HI7 A;  2CZ2 A;  2OAD A;  1M2A A;  4NHZ A;  4YQU A;  5J9B A;  3HJM A;  3ZRE A;  5ECH B;  2P5R A;  3GFK A;  1XOB A;  1VGL A;  3TKR A;  1BQ7 A;  1X9S B;  5E4W A;  1LBK A;  3CYN A;  3GNJ A;  5GST A;  1AXD A;  2V32 A;  1EEM A;  3V1W A;  1FVJ A;  4RI7 A;  5B8A A;  3FKF A;  4MPF A;  1UA5 A;  2LKU A;  2PPT A;  3W8J A;  4NMU A;  4AJ6 A;  2LQQ A;  4AJ7 A;  2CAI A;  2YJH A;  1YY7 A;  22GS A;  5F07 A;  4YAP A;  1TXX A;  5IO0 A;  1GNW A;  5EL8 A;  1PL2 A;  4K0N A;  2VL9 A;  2YNX A;  3SBC A;  19GS A;  1Y6E A;  3QMX A;  3GST A;  3ZRD A;  4RUV A;  3GKX A;  3GUS A;  4OMV A;  5D96 A;  4KDX A;  4O32 A;  1X5D A;  3DGQ A;  4KDY A;  2OE0 A;  3HHV A;  4IP6 A;  1TRV A;  1HNA A;  2PBJ A;  1SL2 B;  4BVX B;  1K0C A;  1HYU A;  5G30 A;  2H1D A;  4WBJ A;  1TU8 A;  4FYB A;  4K0G A;  1JZD A;  4GTU A;  4YH2 A;  8GSS A;  3KH7 A;  3GH6 A;  4XRD A;  1JLW A;  4JBB A;  1DUG A;  5DAL A;  4LA1 A;  2OKA A;  3FZ4 A;  2F8A A;  1X0R A;  4HDE A;  3IHQ A;  1LU4 A;  4XHM A;  4NAX A;  1X5C A;  2RLI A;  2I9H A;  3LXZ A;  2WGR A;  3LYP A;  1ILO A;  2AUV A;  3DVX A;  4TOP A;  4BVY A;  1ABA A;  2E2M A;  4KUN A;  2M72 A;  5F0G A;  2IFQ A;  1MTC A;  4OWY A;  3C8E A;  4I2T A;  3TGZ A;  2LTK A;  1WPI A;  3F6D A;  1T00 A;  2HI7 A;  1DE2 A;  1F6M C;  4HEA 2;  3DWV A;  5ECO B;  1O73 A;  4DEJ A;  1B4P A;  2A2R A;  1K0B A;  4LLR A;  2OBK A;  1ML6 A;  2HRK B;  2GS3 A;  4J57 E;  1O7U A;  3W6G A;  3QD9 A;  1WP0 A;  1XWC A;  10GS A;  2DJK A;  5EY6 A;  4ZB8 A;  5HQP A;  4EKZ A;  2C1Y A;  3CBU A;  3WT2 A;  2B7K A;  2TRC P;  2VCV A;  2EIO A;  3K8N A;  2GZZ A;  1KTE A;  2QGV A;  5FWG A;  5DBQ A;  3ME7 A;  4O5R A;  2H6Y A;  1ST9 A;  2GVP A;  4EO3 A;  3TRQ A;  5JCW A;  4K1F A;  4TR3 A;  2B5E A;  2YWO A;  3RHC A;  4ACS A;  1GL8 A;  4XCS A;  1XWA A;  4PUR A;  5H5Q A;  2H71 A;  4EE0 A;  3DYR A;  1VF3 A;  4EUY A;  4ID0 A;  3O6T A;  4DSR A;  3MDK A;  1K0N A;  5ECQ B;  4TXV A;  3R2Q A;  5IM9 A;  2KP1 A;  2L6D A;  4XS1 A;  4L5L A;  1XCC A;  5ELG A;  2HLS A;  4MZC A;  3F0I A;  3KH9 A;  3W8S A;  2IIY A;  2FWE A;  3IK7 A;  5J41 A;  5ECS A;  4MJB A;  2YWN A;  5H5R A;  4OFN A;  2HYX A;  5AIS A;  2BMX A;  4KB3 A;  2B1L A;  3QFA C;  3UJ1 A;  5ECN B;  2FA4 A;  5CAX A;  5A5K A;  1V2A A;  3VWX A;  3RBT A;  2GGT A;  1JFU A;  5KN2 A;  1Z5Y E;  2H0H A;  4MLY A;  3Q18 A;  1AIU A;  2JSY A;  2F9S A;  4GSS A;  1XZO A;  1NHO A;  1GSQ A;  4I5Q A;  3RDW A;  17GS A;  4L8E A;  1SD9 A;  3GUR A;  1S3A A;  1LJR A;  4MF5 A;  3KJY A;  3IBH A;  4IJ3 A;  1GTB A;  3CXG A;  1JHB A;  4EL1 A;  1R4W A;  4LMW A;  3ZVJ D;  3VLN A;  1EP8 A;  5J3R A;  4L0W A;  1OE8 A;  3MWH A;  2L4Q A;  4EDZ A;  2LRN A;  3F63 A;  1GP1 A;  2CA8 A;  4MJC A;  3Q6O A;  4MK3 A;  4POM A;  3L78 A;  4F9Z A;  1WJK A;  1VRS D;  1ERW A;  4IVF A;  4POK A;  4I2U A;  3IPZ A;  1OAZ A;  3O3T A;  5LD0 A;  2NPB A;  3GA4 A;  1ZMA A;  1G0T A;  5D73 A;  2J23 A;  4O7H A;  4KSO A;  2IMF A;  3I9V 2;  5INY A;  2LEG A;  3UL3 A;  3VK9 A;  1Z6M A;  4WR4 A;  9GSS A;  1F2E A;  3ED3 A;  4G0L A;  4GRF A;  3TKS C;  2DJ3 A;  5GSS A;  2JAD A;  1TK8 B;  5ECI B;  1GSS A;  3TCO A;  1M2B A;  3G9B A;  3LJR A;  1SL1 B;  5G2Z A;  2GT6 A;  3FR3 A;  1J0F A;  5IMA A;  4FH8 A;  5FHI A;  1TRS A;  6GST A;  1MDI A;  2K8S A;  3KTL A;  2FWF A;  2VIM A;  2HSN B;  2C3N A;  2CVD A;  4TXO B;  2FD3 A;  3I6A A;  3EU4 A;  4FO5 A;  1N8J A;  4N30 A;  1T4Z A;  5HR0 A;  3C7M A;  1YF0 A;  3APO A;  4K7N A;  1OC9 A;  3LOR A;  2N5F A;  1IYH A;  4TW5 A;  2K18 A;  4HOJ A;  1M9A A;  3HCZ A;  4BL7 B;  2GQK A;  2C0D A;  3EE2 A;  3D6I A;  2LNT A;  4Q5Q A;  4IKH A;  2YPM A;  2LNS A;  1AQW A;  4KCE A;  3ZIV A;  4V1A g;  5JWQ B;  1QQ2 A;  3LFL A;  4O92 A;  3UAR A;  1V57 A;  4WXT A;  3WGX A;  4X1U A;  4IP1 A;  4HQZ A;  3IC8 A;  5IOX A;  3CMI A;  2JZT A;  2OE1 A;  5DJM A;  3H1N A;  5A4V A;  2DMM A;  1K0O A;  2OAC A;  3GV1 A;  1SYX A;  1WWJ A;  3LGC A;  5IMV A;  1WRY A;  3RAZ A;  11GS A;  4MJE A;  3EUR A;  1BAY A;  3HJP A;  6GSS A;  2FY6 A;  1U3I A;  3FHK A;  1BYE A;  3GL5 A;  1XW6 A;  3ERW A;  4Q5N A;  1C72 A;  4V2L A;  5J9C A;  2CV4 A;  3EVI A;  3FRC A;  3C73 A;  4GSN A;  3FZ5 A;  5IIZ A;  2LS5 A;  1Z7R A;  5CNW A;  1XWG A;  2A2S A;  3TRX A;  1EWX A;  5DCH A;  2I3Y A;  3A2X A;  4J2F A;  3AY8 A;  3QR6 A;  2RM6 A;  1ZCP A;  2E7P A;  4ZBD A;  4OO5 A;  4EF0 A;  3KEB A;  2QC7 A;  5HR1 A;  1KEB A;  1SU9 A;  2TIR A;  2HQT A;  5DCG A;  2YN1 A;  2FA8 A;  3DD3 A;  4ZIL A;  2WFC A;  4ULX A;  1FW1 A;  3ZIT A;  3TDG A;  4KH7 A;  2MMO A;  1GUK A;  3DXB A;  1B9X C;  1OC8 A;  2H01 A;  5CRW A;  2R3X A;  2GSR A;  2VL2 A;  3M3M A;  3CRT A;  3RPP A;  5B8B A;  5ECL B;  3BCI A;  1K0A A;  3QCP A;  2QKE A;  4FIW A;  1F9M A;  1PX6 A;  3HZ8 A;  1PN9 A;  3QPM A;  1ZL9 A;  2CAQ A;  2PVQ A;  3C71 A;  1TK5 B;  4BA7 A;  2H6X A;  1WMJ A;  2H75 A;  4ZB9 A;  4PX1 A;  1GUL A;  3FYG A;  3HZ4 A;  3HVV A;  4KDU A;  4I6X A;  4E8E A;  1O8W A;  4QL7 A;  5G1L A;  1Z6N A;  2HZE B;  2C0G A;  3ZVJ A;  1DE1 A;  3VFI A;  3GN3 A;  1A2L A;  2VM1 A;  6GSX A;  4HZ2 A;  1FVK A;  5G1K A;  1M2D A;  5HFK A;  1TI1 A;  3P8W A;  3DEX A;  1H4O A;  3TKP A;  3F8U A;  5ELA A;  4HUA A;  2YOI A;  2JSZ A;  4YQV A;  1XFL A;  2IPA A;  2C3T A;  2DJ0 A;  2H1B A;  4K8M A;  2NTO A;  1TDI A;  4PNF A;  5DAK A;  3QAW A;  2P0G A;  1SEN A;  4ECI A;  3TJF A;  1YF1 A;  3CSJ A;  2PUK C;  3ERF A;  2JZR A;  3KZQ A;  2VD1 A;  3F9U A;  4ZL9 A;  5JCU A;  2VCW A;  2LQO A;  2GT5 A;  2HRF A;  6GSV A;  2XPE A;  4JR6 A;  2IMD A;  2PER A;  4OCF A;  1TOF A;  2C80 A;  2C0F A;  2LJK A;  3ZLP A;  4MZW A;  4LL1 B;  1Y25 A;  2WZ9 A;  2JU5 A;  1R5P A;  5KN0 A;  5GAP D;  2BTO T;  1NHY A;  3F6F A;  4AGS A;  5A4W A;  1XPV A;  4MF7 A;  1T1V A;  2WB9 A;  4DVC A;  2VCT A;  2VD0 A;  1GSD A;  5J4U A;  4NV5 A;  3OR5 A;  3UBK A;  1GSY A;  1A2J A;  4KF9 A;  1SJ6 A;  4WKW A;  3GL3 A;  3EC3 A;  2PMT A;  2H72 A;  2RUE A;  3MNG A;  2I81 A;  3H93 A;  4RQX A;  4TR1 A;  2GZY A;  4CDO A;  4D73 A;  3WGD A;  2HSM A;  2ON5 A;  2DIZ A;  13GS A;  4F03 A;  1J08 A;  6GSU A;  1NW2 A;  1SD8 A;  3TRP A;  5DAK B;  2RII A;  2FWH A;  3F3R A;  2GQL A;  2H70 A;  2L4C A;  3EIN A;  4NPB A;  3A2W A;  2R37 A;  4XS4 A;  1BJX A;  2X8H A;  1KNG A;  1SK1 A;  5DAL B;  1O6J A;  4XRA A;  3TB2 A;  2E2G A;  1EGO A;  4N0V A;  1HQO A;  1R7H A;  1A2M A;  3FZA A;  3E3E A;  3KP8 A;  1EP7 A;  4AF2 A;  3HA9 A;  4KND A;  2D2Z A;  2FUG 2;  3F3Q A;  4IGJ A;  2I1U A;  1VF4 A;  1QGV A;  3GTU A;  4LL4 B;  2GZP A;  4BVY B;  1SJZ A;  3Q19 A;  1MEK A;  2DC5 A;  2IFQ B;  4MCU A;  5JWR B;  4PUA A;  5ECM B;  1K0D A;  5EVO A;  3HKR A;  1WE0 A;  1XVW A;  3GX0 A;  4N0Z A;  1YJ6 A;  2X99 A;  1AW9 A;  2PU9 C;  2V41 A;  4GQF A;  3Q74 A;  4JR4 A;  5DVB A;  3IK9 A;  2X8C A;  5ID2 A;  2DJ1 A;  4IQ1 A;  3ZFL A;  1PD2 1;  2LUS A;  3LWA A;  1G7E A;  3KCM A;  1PL1 A;  3R3E A;  4POB A;  2VLT A;  2I4A A;  5D9W A;  1OKT A;  1CQG A;  4IHU A;  1ERV A;  2WCI A;  2Z9S A;  2R4V A;  2RM5 A;  3TOT A;  2ZUP A;  1SKR B;  1UC7 A;  2ES7 A;  2HT9 A;  3MAK A;  3M9J A;  4NV2 A;  2CX3 A;  4IS0 A;  1A23 A;  2K9F A;  3DRN A;  3JCM L;  2XBQ A;  3M8N A;  3RHB A;  3WGE A;  1M0U A;  3N5O A;  4G10 A;  3GRX A;  4HU9 A;  2JZS A;  3A3T A;  4LMV A;  3KD0 A;  5CO3 A;  3TKS E;  3TJJ A;  2LJR A;  3UVH A;  4PXO A;  3GX8 A;  1QMV A;  3PPU A;  2IL3 A;  1XW5 A;  1M7T A;  1ON4 A;  1XOA A;  1IYI A;  2WS2 A;  5D9T A;  1PKZ A;  3WD6 A;  3D21 A;  2FWG A;  1TK0 B;  1JZW A;  3C1S A;  4MH3 A;  1VF1 A;  4ZXG A;  5A4U A;  3HD5 A;  3UIW A;  5AN1 A;  2MYG A;  1GWC A;  1JLV A;  4ECC A;  4ZIJ A;  1VF2 A;  2REM A;  3IR4 A;  4KX4 A;  3ERG A;  2O85 A;  2OBI A;  1W4V A;  1GNE A;  4IBP A;  2OA7 A;  1FB0 A;  3P7X A;  4G2E A;  4WET A;  1ZZY A;  2HNL A;  1SK2 A;  1UN2 A;  5EPF A;  4PUF C;  5LCZ A;  2NDO A;  4ZB6 A;  20GS A;  4TR4 A;  3CRU A;  2CQ9 A;  3H79 A;  3UOM A;  2H30 A;  3TJK A;  4DSQ A;  4KW6 A;  3LEF A;  5ID2 B;  3WT1 A;  2FHE A;  2XHF A;  2GQM A;  3KTB A;  1X9W B;  1UVZ A;  1ZYE A;  1Q98 A;  3S9F A;  4GF0 A;  1TW9 A;  1ZOF A;  4X43 A;  2L5L A;  2KUC A;  4EC0 A;  2WRT A;  3GH9 A;  3SWL A;  2VAF A;  2JAC A;  3MSZ A;  4Z7X A;  4K6X A;  4MP4 A;  2YV9 A;  3FK8 A;  2HZF A;  5IQY A;  5DQS A;  2QSI A;  2NVL A;  1O8X A;  1E6B A;  3U5R E;  1MDK A;  3ZTL A;  3I69 A;  3ZMK A;  4MMM A;  1PA3 A;  4MDC A;  4OD7 A;  1G6W A;  2H73 A;  1GH2 A;  2VOC A;  5ENU A;  4G9H A;  3CTG A;  4WR5 A;  1F3A A;  1TJD A;  2H6Z A;  4FQU A;  3P2A A;  2YWI A;  1A0R P;  1KBN A;  1H75 A;  1W89 A;  2DML A;  1FOV A;  5IPH A;  5ECP B;  3IRA A;  2VCX A;  3BJ5 A;  3DKS A;  4KCA A;  3VWV A;  2H8L A;  2HXK A;  1PQN A;  5F05 A;  2ZNM A;  1B8X A;  2AHE A;  2GSS A;  1FB6 A;  3CSH A;  4OO4 A;  5KN3 A;  4DSS A;  5COH A;  1WIK A;  2CZ3 A;  3IA1 A;  3QAG A;  2FNO A;  5IMF A;  2VO4 A;  3GMF A;  1GSF A;  2J9H A;  4GCI A;  1HNC A;  4QQ7 A;  1YQ1 A;  2YJ7 A;  4MJA A;  5D8I A;  4FYU A;  2V1M A;  2BJX A;  1NSW A;  4K7I A;  2K6V A;  3D0Z A;  1HD2 A;  1K0M A;  3UMA A;  2VLV A;  3FY7 A;  2EC4 A;  5B7C A;  2WJU A;  2MBT A;  3HDC A;  1S3C A;  3TOU A;  3APQ A;  4PTS A;  3VI7 A;  1TP9 A;  5JWO B;  3F4S A;  4GXZ A;  2M46 A;  2P5Q A;  4RI6 A;  2LRC A;  2PWJ A;  1EZK A;  3IOS A;  2EIR A;  3H4K A;  3FZ9 A;  4E8H A;  1AUC A;  3F4R A;  1OC9 B;  1O85 A;  1M99 A;  1GSU A;  3VPQ A;  7GSS A;  1OKD A;  4CW9 A;  3A2V A;  4PQI A;  4XIH A;  2K8V A;  2YZH A;  1R5A A;  5CP1 A;  3G7J A;  3M1G A;  5C04 A;  4N11 A;  1B4Q A;  1XW9 A;  1GLP A;  3US3 A;  1I5G A;  2KHP A;  4K2D A;  4MH2 A;  1XXU A;  4HS1 A;  3TJB A;  2L57 A;  1XWK A;  1QXH A;  2MMZ A;  2B6M A;  3L9U A;  4ML1 A;  1Q4J A;  3L9S A;  2AYT A;  4BWQ A;  4BVX A;  2A4V A;  2FGX A;  2R2J A;  4GQC A;  3ZFB A;  4HU7 A;  1YKC A;  2IJY A;  4WF4 A;  2LJA A;  1DSB A;  3TKQ A;  2FLS A;  5DQY A;  2V2G A;  3ZZX A;  5H5S A;  1MD3 A;  5IMD A;  3P90 A;  5BMU A;  5CRE A;  5CYY A;  4JRR A;  1U88 A;  1V98 A;  1URM A;  4I8B A;  5HR2 A;  2EIQ A;  4YAV A;  2L5O A;  1PX7 A;  2PVO C;  5GZZ B;  2DSA A;  3RPN A;  1E2Y A;  4P3Y B;  4TN8 A;  2L6C A;  2C3Q A;  1G7O A;  1OVN A;  2IWT A;  4H86 A;  1ZGN A;  4KGI A;  2HRN A;  2X64 A;  2MBS A;  1BED A;  1RW1 A;  5D93 A;  1XBS A;  2H76 A;  4KSM A;  1QUW A;  4Q5R A;  1XVQ A;  3KP9 A;  3BBY A;  1K3L A;  2VM2 A;  1EV4 A;  5HR3 A;  4XS6 A;  1EV9 A;  1PGT A;  2HE3 A;  3GHA A;  3NZN A;  4HQS A;  3HJO A;  2P31 A;  2H1G A;  2AB6 A;  4KE3 A;  3EWL A;  5JCG A;  1Z3E A;  4NWY A;  3L4N A;  2V6O A;  2HRK A;  3HXS A;  3HYP A;  2FCH A;  2H19 A;  3GYK A;  1THO A;  2DLX A;  3KXO A;  3J7Y b;  2H0I A;  1SKW B;  4GST A;  3UBL A;  3QFB C;  5J5N A;  2UZ8 A;  2NBS A;  1EEJ A;  2VCZ A;  4Q5F A;  5ABR A;  1T3B A;  1SYR A;  4USS A;  4CHS A;  1T4Y A;  1B48 A;  1R26 A;  14GS A;  4ZBB A;  3O76 A;  2OE3 A;  1SK0 A;  2O89 A;  1SJI A;  3GKM A;  5AGY A;  3ME8 A;  3IE3 A;  1ZYQ B;  4K7O A;  3DVW A;  4F82 A;  1A24 A;  2N5B A;  1K3Y A;  1YZX A;  4IW9 A;  2F3M A;  1MD4 A;  3EMX A;  1EOH A;  18GS A;  5D9V A;  2G0F A;  4PNG A;  4V2M A;  3ZYW A;  3PGT A;  2YZU A;  5HFI A;  3TKS A;  4OFT A;  4NXI A;  6GSW A;  4JED A;  1PKW A;  4I97 A;  2GTU A;  2V6K A;  1NM3 A;  3LQ7 A;  1GTU A;  1RQM A;  2O7K A;  1YEX A;  1V9W A;  4EDY A;  5E59 A;  5F06 A;  1YKA A;  1FAA A;  3QAV A;  3KIJ A;  4MA9 A;  2C0E A;  5AIX A;  3FW2 A;  4PQ1 A;  5ECK B;  2L59 A;  3L9V A;  3BOA A;  3M0F A;  2WDU A;  4TKY A;  5KEJ A;  3H8Q A;  4MF6 A;  4XTS A;  2RUF A;  2X8G A;  4V1A p;  2VL2 C;  1XIY A;  3KM6 A;  2H1A A;  5CRH A;  1PRX A;  4V2N A;  2MMN A;  4K9Z A;  1OC3 A;  1TTZ A;  1JZO A;  2IMK A;  2M80 A;  2AJQ B; 
#chains in the Genus database with same CATH topology
 3PH9 A;  2GSQ A;  1X5E A;  4JU5 A;  5ECR B;  2CVK A;  3M9K A;  3IAM 2;  3TJG A;  4QL9 A;  4ZBA A;  3QOU A;  4ZL8 A;  1DBY A;  2R0C A;  4MZB A;  2HRA A;  3BCK A;  3UEM A;  2H66 A;  2O36 A;  5CRG A;  5IPG A;  2MZC A;  2PGT A;  1PSQ A;  4IN0 A;  2LV3 A;  1AAZ A;  2F51 A;  3C1R A;  2CVB A;  3G7Y A;  1QK8 A;  4JZQ A;  3D22 A;  2LRT A;  3MYD A;  5B6N A;  1EOG A;  5AIV A;  3LYK A;  1K3O A;  1G6Y A;  3EU3 A;  1XWB A;  4HJ2 A;  4RQR A;  2YP6 A;  1FHE A;  3TUE A;  4TR1 B;  1ERU A;  4MPG A;  2DIY A;  4D73 B;  3IC4 A;  4KAE A;  2HSM B;  2GST A;  5G5E A;  2YAN A;  2KLX A;  4EVM A;  3ISO A;  1FG4 A;  1THX A;  1BX9 A;  3GKN A;  3IXR A;  4JE1 A;  4G0I A;  1EGR A;  1GTA A;  3F4T A;  4F0B A;  1B9Y C;  4XS4 B;  4L5O A;  1T7P B;  3GIX A;  1M9B A;  4MAB A;  3VWW A;  1V58 A;  4WEY A;  2ALB A;  2E0Q A;  2HSN A;  3LSZ A;  1Z7P A;  1GLQ A;  3FR9 A;  4OFM A;  3D4T A;  4TXO A;  1FO5 A;  4TR0 A;  1SKS B;  2DKH A;  3ZIJ A;  2LST A;  3A5W A;  4G19 A;  1F3B A;  2R6K A;  3KMN A;  3GTU B;  3PR8 A;  4ISD A;  1A8Y A;  1GTI A;  5LNK e;  4OCE A;  5IMC A;  5C00 A;  2XC2 A;  4PGT A;  4ECJ A;  2WW1 A;  3ZL5 A;  2CX4 A;  4BL7 A;  2B3S A;  3HVX A;  1A0F A;  3WYW A;  3DML A;  3IV4 A;  2DBC A;  2DJJ A;  3EYT A;  2VUP A;  3U6V A;  2B1K A;  1F37 A;  16GS A;  3VWU A;  4N10 A;  1OYJ A;  2H74 A;  5IMZ A;  3D5J A;  2B5X A;  2VLU A;  3IDV A;  4J56 E;  3D4M A;  2TRX A;  3UVT A;  3FEU A;  3FR6 A;  4ILF A;  1GRX A;  2KP2 A;  1Y1U A;  3HVS A;  2ON7 A;  2YCD A;  2UV8 G;  2N5A A;  4WBR D;  1CQH A;  1J9B A;  4X0X A;  1WOU A;  2C8U A;  5L71 A;  5KN1 A;  2VCQ A;  3KGK A;  2HFD A;  1HNB A;  5IOW A;  2YV7 A;  2O87 A;  3PIN A;  1Z9H A;  1TKD B;  4ZL7 A;  2HSY A;  2WVZ A;  3E0U A;  3L0H A;  2IN3 A;  4POL A;  1S3D A;  3DIE A;  4YQM A;  4L0U A;  1N2A A;  4IJI A;  3VUR A;  1BG5 A;  1YEP A;  5IO2 A;  5B6M A;  3EMP A;  2G2Q A;  3VPT A;  3APS A;  2O8V B;  1AQX A;  3KMO A;  1TRU A;  4WF5 A;  1ZYN A;  1U87 A;  2MMA A;  2AV4 A;  1O81 A;  5FT3 A;  1USB A;  4GLT A;  5G31 A;  1X9M B;  4G01 A;  2R5G A;  1A8L A;  2B5Y A;  4BWS A;  2F8F A;  3E9J B;  5HFG A;  5D9X A;  6GSY A;  3J7Y k;  3HY2 A;  1T8E B;  1ERT A;  2IME A;  1AQV A;  4EXJ A;  4HJM A;  1SL0 B;  3GKK A;  3NIV A;  4AI6 A;  3CSI A;  2VL3 A;  2ZCT A;  1S4B P;  4ML6 A;  1YDK A;  5GAN D;  3N9J A;  2CT6 A;  2WUL A;  3IAS 2;  1MDJ A;  2YWM A;  3LXT A;  2HZE A;  1OE7 A;  4HZ4 A;  1U3A A;  4IEL A;  4ECB A;  1V40 A;  2AAW A;  1PMT A;  3G7I A;  3QDN A;  1GSE A;  3LG6 A;  2DJ2 A;  1GUH A;  4AJ8 A;  4PQH A;  1GUM A;  1ACV A;  1I9D A;  4TVE A;  4BPY A;  2HSH A;  2WW0 A;  2GDR A;  3ZML A;  1TU7 A;  2X49 A;  4DSS B;  2KOK A;  4G0K A;  2XBI A;  1RK4 A;  5F8B A;  3UAP A;  3CTF A;  3VI5 A;  1N25 A;  3GSS A;  4F0C A;  2PN8 A;  2WVY A;  3HVN A;  4TRX A;  3BD2 A;  2GLR A;  3NOF A;  5DDL A;  4NHW A;  4GWR A;  1AC1 A;  5CRD A;  5DJL A;  5G5F A;  1U6T A;  4F2I A;  1JZR A;  4IQA A;  2H0G A;  2IMI A;  1TRW A;  3I43 A;  4FYC A;  2XPD A;  2OJL A;  2B7J A;  12GS A;  4KA0 A;  1TI3 A;  2JL4 A;  1QFN A;  2C4J A;  4HI7 A;  2CZ2 A;  2OAD A;  1M2A A;  4NHZ A;  4YQU A;  5J9B A;  3HJM A;  3ZRE A;  5ECH B;  2P5R A;  3GFK A;  1XOB A;  1VGL A;  3TKR A;  1BQ7 A;  1X9S B;  5E4W A;  1LBK A;  3CYN A;  3GNJ A;  5GST A;  1AXD A;  2V32 A;  1EEM A;  3V1W A;  1FVJ A;  4RI7 A;  5B8A A;  3FKF A;  4MPF A;  1UA5 A;  4K5R A;  4EIP A;  2LKU A;  2PPT A;  3W8J A;  4NMU A;  4AJ6 A;  2LQQ A;  4AJ7 A;  2CAI A;  2YJH A;  1YY7 A;  22GS A;  5F07 A;  4YAP A;  5A1N B;  1TXX A;  5IO0 A;  1GNW A;  5EL8 A;  4A5P A;  1PL2 A;  4K0N A;  2VL9 A;  1YEW C;  2YNX A;  5KOW A;  3SBC A;  4PI2 C;  19GS A;  1Y6E A;  3QMX A;  3GST A;  3ZRD A;  4RUV A;  3GKX A;  3GUS A;  4OMV A;  5D96 A;  4KDX A;  4O32 A;  1X5D A;  3DGQ A;  4KDY A;  2OE0 A;  3HHV A;  4IP6 A;  1TRV A;  1HNA A;  2PBJ A;  1SL2 B;  4PHZ C;  4BVX B;  1K0C A;  1HYU A;  5G30 A;  2H1D A;  4WBJ A;  1TU8 A;  4FYB A;  4K0G A;  2EFC A;  1JZD A;  4GTU A;  4YH2 A;  8GSS A;  3KH7 A;  3GH6 A;  4XRD A;  1JLW A;  4JBB A;  1DUG A;  5DAL A;  4LA1 A;  2OKA A;  3FZ4 A;  2F8A A;  1X0R A;  4HDE A;  3IHQ A;  5BMU B;  1LU4 A;  4CY8 A;  4Z2U A;  4XHM A;  4NAX A;  1X5C A;  2RLI A;  2I9H A;  3LXZ A;  2WGR A;  3LYP A;  3TU3 B;  1ILO A;  2AUV A;  3DVX A;  4TOP A;  4BVY A;  1ABA A;  2E2M A;  4KUN A;  2M72 A;  5F0G A;  2IFQ A;  1MTC A;  4OWY A;  3C8E A;  4I2T A;  3TGZ A;  2LTK A;  1WPI A;  3F6D A;  1T00 A;  2HI7 A;  1DE2 A;  1F6M C;  2QA1 A;  4HEA 2;  3DWV A;  5ECO B;  1O73 A;  4DEJ A;  1B4P A;  1TXU A;  2A2R A;  1K0B A;  4LLR A;  2OBK A;  1ML6 A;  2HRK B;  2GS3 A;  4J57 E;  1O7U A;  3W6G A;  3QD9 A;  1WP0 A;  1XWC A;  10GS A;  2DJK A;  5EY6 A;  4ZB8 A;  5HQP A;  4EKZ A;  2C1Y A;  3CBU A;  3WT2 A;  2B7K A;  2TRC P;  2VCV A;  1ZYP A;  2EIO A;  3K8N A;  2GZZ A;  1KTE A;  2QGV A;  3MIX A;  5FWG A;  4X4J A;  5DBQ A;  3ME7 A;  4O5R A;  2H6Y A;  1ST9 A;  2GVP A;  4EO3 A;  3TRQ A;  5JCW A;  4K1F A;  4TR3 A;  2B5E A;  2YWO A;  3RHC A;  4ACS A;  1GL8 A;  4XCS A;  1XWA A;  4PUR A;  5H5Q A;  2H71 A;  4EE0 A;  3DYR A;  1VF3 A;  4EUY A;  1SVL A;  4ID0 A;  3O6T A;  4DSR A;  3MDK A;  1K0N A;  5ECQ B;  4TXV A;  3R2Q A;  5IM9 A;  4O5U A;  2KP1 A;  2L6D A;  4XS1 A;  4L5L A;  1XCC A;  5ELG A;  2HLS A;  4MZC A;  3F0I A;  3KH9 A;  3W8S A;  2IIY A;  2FWE A;  3IK7 A;  5J41 A;  5ECS A;  4MJB A;  2YWN A;  5H5R A;  4OFN A;  2HYX A;  5AIS A;  2BMX A;  4KB3 A;  2B1L A;  4AKX B;  3QFA C;  3UJ1 A;  5ECN B;  2FA4 A;  5CAX A;  5A5K A;  1V2A A;  3VWX A;  3RBT A;  2GGT A;  1JFU A;  5KN2 A;  1Z5Y E;  2H0H A;  4MLY A;  3Q18 A;  4AKI A;  1AIU A;  2JSY A;  2F9S A;  4GSS A;  1BG1 A;  1XZO A;  1NHO A;  1GSQ A;  4I5Q A;  3RDW A;  17GS A;  4L8E A;  1SD9 A;  3GUR A;  1S3A A;  1LJR A;  4MF5 A;  3KJY A;  3IBH A;  4IJ3 A;  1GTB A;  5A34 A;  3CXG A;  1JHB A;  4EL1 A;  1R4W A;  4LMW A;  3ZVJ D;  3VLN A;  1EP8 A;  5J3R A;  4L0W A;  1OE8 A;  3MWH A;  2L4Q A;  4EDZ A;  2LRN A;  3F63 A;  1GP1 A;  2CA8 A;  4MJC A;  3Q6O A;  4MK3 A;  4EIQ A;  4POM A;  3L78 A;  4F9Z A;  1WJK A;  1VRS D;  5KOX A;  1ERW A;  4IVF A;  4POK A;  4I2U A;  3IPZ A;  1OAZ A;  3O3T A;  2DKI A;  5LD0 A;  2NPB A;  3GA4 A;  1ZMA A;  3RGB C;  1G0T A;  5D73 A;  2J23 A;  4O7H A;  4KSO A;  2IMF A;  3I9V 2;  5INY A;  2LEG A;  3UL3 A;  3VK9 A;  1Z6M A;  5A5H A;  4WR4 A;  9GSS A;  1F2E A;  3ED3 A;  4G0L A;  3LW9 A;  4GRF A;  3TKS C;  2DJ3 A;  5GSS A;  2JAD A;  1TK8 B;  5ECI B;  1GSS A;  3TCO A;  1M2B A;  3G9B A;  3LJR A;  1SL1 B;  5G2Z A;  2GT6 A;  3FR3 A;  1J0F A;  5IMA A;  4FH8 A;  5FHI A;  1TRS A;  6GST A;  1MDI A;  2K8S A;  3KTL A;  2FWF A;  2VIM A;  2HSN B;  2C3N A;  5J4Y A;  2CVD A;  4TXO B;  2FD3 A;  3I6A A;  3EU4 A;  4FO5 A;  1N8J A;  4N30 A;  1T4Z A;  1BF5 A;  5HR0 A;  3C7M A;  1YF0 A;  3APO A;  4K7N A;  1OC9 A;  3LOR A;  2N5F A;  1IYH A;  4TW5 A;  2K18 A;  4HOJ A;  1M9A A;  3HCZ A;  4BL7 B;  2GQK A;  2C0D A;  3EE2 A;  3D6I A;  2LNT A;  4Q5Q A;  4IKH A;  2YPM A;  2LNS A;  1AQW A;  4KCE A;  3ZIV A;  4V1A g;  5JWQ B;  1QQ2 A;  3LFL A;  4O92 A;  3UAR A;  4W66 A;  1V57 A;  4WXT A;  3WGX A;  4X1U A;  4HQZ A;  4IP1 A;  3IC8 A;  5IOX A;  3CMI A;  2JZT A;  2OE1 A;  5DJM A;  3H1N A;  5A4V A;  2DMM A;  1K0O A;  2OAC A;  3GV1 A;  1SYX A;  1WWJ A;  3LGC A;  5IMV A;  1WRY A;  3RAZ A;  11GS A;  4MJE A;  3EUR A;  1BAY A;  3HJP A;  6GSS A;  2FY6 A;  1U3I A;  3FHK A;  1BYE A;  3GL5 A;  1XW6 A;  3ERW A;  4Q5N A;  1C72 A;  4V2L A;  5J9C A;  2CV4 A;  3EVI A;  3FRC A;  3C73 A;  4GSN A;  5J47 A;  3FZ5 A;  5IIZ A;  2LS5 A;  1Z7R A;  5CNW A;  1XWG A;  2A2S A;  3TRX A;  1EWX A;  5DCH A;  2I3Y A;  1M3J A;  3A2X A;  4J2F A;  3AY8 A;  3QR6 A;  2RM6 A;  1ZCP A;  2E7P A;  4ZBD A;  4OO5 A;  4EF0 A;  3KEB A;  2QC7 A;  5HR1 A;  1KEB A;  1SU9 A;  2TIR A;  2HQT A;  5DCG A;  1I1I P;  2YN1 A;  2FA8 A;  3DD3 A;  3CWG A;  4ZIL A;  2WFC A;  4ULX A;  1FW1 A;  3ZIT A;  3TDG A;  2WZS A;  4KH7 A;  2MMO A;  1GUK A;  3DXB A;  1B9X C;  1OC8 A;  2H01 A;  5CRW A;  2R3X A;  2GSR A;  2VL2 A;  3M3M A;  3CRT A;  3RPP A;  5B8B A;  5ECL B;  3BCI A;  1K0A A;  3QCP A;  2QKE A;  4FIW A;  3FMW A;  1F9M A;  1PX6 A;  1XG8 A;  3HZ8 A;  1PN9 A;  3QPM A;  1ZL9 A;  2CAQ A;  2PVQ A;  3EPT A;  3C71 A;  1TK5 B;  4BA7 A;  2H6X A;  1WMJ A;  2H75 A;  4ZB9 A;  4PX1 A;  1GUL A;  3FYG A;  3HZ4 A;  3HVV A;  4KDU A;  4I6X A;  4E8E A;  1O8W A;  4QL7 A;  5G1L A;  1Z6N A;  2HZE B;  2C0G A;  3ZVJ A;  1DE1 A;  3VFI A;  3GN3 A;  1A2L A;  3HMJ G;  2VM1 A;  6GSX A;  4HZ2 A;  1FVK A;  5G1K A;  1M2D A;  5HFK A;  1TI1 A;  3P8W A;  3DEX A;  4HSC X;  1H4O A;  3TKP A;  3F8U A;  5ELA A;  4HUA A;  2YOI A;  2JSZ A;  4YQV A;  1XFL A;  2IPA A;  2C3T A;  4AKG A;  2DJ0 A;  2H1B A;  4AKH A;  4K8M A;  2NTO A;  1TDI A;  4PNF A;  5DAK A;  3QAW A;  5J40 A;  2P0G A;  1SEN A;  4ECI A;  3TJF A;  1YF1 A;  3CSJ A;  2PUK C;  3ERF A;  2JZR A;  3KZQ A;  2VD1 A;  3F9U A;  4ZL9 A;  5JCU A;  2VCW A;  2LQO A;  2GT5 A;  2HRF A;  6GSV A;  2XPE A;  4JR6 A;  2IMD A;  2PER A;  1PN0 A;  4OCF A;  1TOF A;  2C80 A;  2C0F A;  2LJK A;  3ZLP A;  4MZW A;  4LL1 B;  1Y25 A;  2WZ9 A;  2JU5 A;  1R5P A;  5KN0 A;  5GAP D;  2BTO T;  1NHY A;  3F6F A;  4AGS A;  5A4W A;  1XPV A;  4MF7 A;  4ICY A;  1T1V A;  2WB9 A;  4DVC A;  2VCT A;  2VD0 A;  1GSD A;  5J4U A;  4NV5 A;  3OR5 A;  3UBK A;  1GSY A;  1A2J A;  4KF9 A;  1SJ6 A;  4WKW A;  3GL3 A;  3EC3 A;  2O3E A;  2PMT A;  2H72 A;  2RUE A;  3MNG A;  2I81 A;  3H93 A;  4RQX A;  4TR1 A;  2GZY A;  4CDO A;  4D73 A;  3WGD A;  2HSM A;  2ON5 A;  2DIZ A;  13GS A;  4F03 A;  1J08 A;  6GSU A;  1NW2 A;  1SD8 A;  3TRP A;  5DAK B;  2RII A;  2FWH A;  3F3R A;  2GQL A;  2H70 A;  2L4C A;  3EIN A;  4FXY P;  4NPB A;  3A2W A;  2R37 A;  4XS4 A;  1BJX A;  2X8H A;  1KNG A;  1SK1 A;  5DAL B;  1O6J A;  2H1L A;  4XRA A;  3TB2 A;  2QA2 A;  2E2G A;  1EGO A;  4N0V A;  3A5I A;  1HQO A;  1R7H A;  1A2M A;  3FZA A;  3E3E A;  1EP7 A;  3KP8 A;  4AF2 A;  3HA9 A;  4KND A;  2D2Z A;  2FUG 2;  3F3Q A;  4IGJ A;  2I1U A;  1VF4 A;  1QGV A;  3GTU A;  4LL4 B;  2GZP A;  4BVY B;  1SJZ A;  3Q19 A;  2WW2 A;  1MEK A;  2DC5 A;  2IFQ B;  2EFE A;  4MCU A;  5JWR B;  4PUA A;  5ECM B;  1K0D A;  5EVO A;  3HKR A;  1WE0 A;  4Z2T A;  1XVW A;  3GX0 A;  4N0Z A;  1YJ6 A;  2X99 A;  1AW9 A;  2PU9 C;  2V41 A;  4GQF A;  2WW3 A;  3Q74 A;  4JR4 A;  5DVB A;  3IK9 A;  2X8C A;  5ID2 A;  2DJ1 A;  4IQ1 A;  3ZFL A;  1PD2 1;  2LUS A;  3LWA A;  1G7E A;  3KCM A;  1PL1 A;  3R3E A;  4POB A;  2VLT A;  2I4A A;  5D9W A;  1OKT A;  1CQG A;  2Z9S A;  1ERV A;  2WCI A;  4IHU A;  2R4V A;  2RM5 A;  3TOT A;  2ZUP A;  1SKR B;  1UC7 A;  2ES7 A;  2HT9 A;  3MAK A;  3M9J A;  4NV2 A;  2CX3 A;  4IS0 A;  1A23 A;  2K9F A;  3DRN A;  3JCM L;  1SVM A;  2XBQ A;  3M8N A;  3RHB A;  3WGE A;  1M0U A;  3N5O A;  4CY6 A;  4G10 A;  3GRX A;  4HU9 A;  2JZS A;  3A3T A;  4LMV A;  3KD0 A;  5CO3 A;  3TKS E;  3TJJ A;  2LJR A;  3UVH A;  4PXO A;  3GX8 A;  1QMV A;  3PPU A;  2IL3 A;  1XW5 A;  1M7T A;  1ON4 A;  1XOA A;  1IYI A;  2WS2 A;  5D9T A;  1PKZ A;  3WD6 A;  3D21 A;  2FWG A;  1TK0 B;  1JZW A;  3C1S A;  4MH3 A;  1VF1 A;  4ZXG A;  5A4U A;  3HD5 A;  3UIW A;  5AN1 A;  2MYG A;  1GWC A;  1JLV A;  4ECC A;  2WVX A;  4ZIJ A;  1VF2 A;  2REM A;  3IR4 A;  4KX4 A;  3ERG A;  2O85 A;  2OBI A;  2EFH A;  1W4V A;  1GNE A;  4IBP A;  2OA7 A;  1FB0 A;  1PFO A;  3P7X A;  4G2E A;  4WET A;  1ZZY A;  2HNL A;  1SK2 A;  1UN2 A;  5EPF A;  4PUF C;  5LCZ A;  2NDO A;  4ZB6 A;  20GS A;  4TR4 A;  3CRU A;  2CQ9 A;  3H79 A;  3UOM A;  2H30 A;  3TJK A;  4DSQ A;  1SVO A;  4KW6 A;  3LEF A;  5ID2 B;  3WT1 A;  2FHE A;  4PI0 C;  2XHF A;  2GQM A;  3KTB A;  1X9W B;  1UVZ A;  1ZYE A;  1Q98 A;  3S9F A;  4GF0 A;  4YKG A;  2R0P A;  4K2X A;  1TW9 A;  1ZOF A;  4X43 A;  2L5L A;  2KUC A;  4EC0 A;  2WRT A;  3GH9 A;  3SWL A;  1YVL A;  2VAF A;  2JAC A;  3MSZ A;  4Z7X A;  4K6X A;  4MP4 A;  2YV9 A;  3FK8 A;  2HZF A;  5IQY A;  5DQS A;  2QSI A;  2NVL A;  1O8X A;  1E6B A;  3U5R E;  1MDK A;  3ZTL A;  5A34 B;  3I69 A;  3ZMK A;  4MMM A;  1PA3 A;  4MDC A;  4OD7 A;  1G6W A;  2H73 A;  1GH2 A;  2VOC A;  5ENU A;  4G9H A;  3CTG A;  4WR5 A;  1F3A A;  2A4H A;  1TJD A;  2H6Z A;  4FQU A;  3P2A A;  2YWI A;  4QMK A;  1A0R P;  1KBN A;  1H75 A;  1W89 A;  2DML A;  1FOV A;  5IPH A;  2WVX B;  5ECP B;  3IRA A;  2VCX A;  3BJ5 A;  3DKS A;  4KCA A;  3VWV A;  2H8L A;  2HXK A;  1PQN A;  5F05 A;  2O5V A;  2ZNM A;  1B8X A;  2AHE A;  2GSS A;  1FB6 A;  3CSH A;  4OO4 A;  5KN3 A;  4DSS A;  5COH A;  1WIK A;  5A5H B;  2CZ3 A;  3IA1 A;  1M3I A;  3QAG A;  2FNO A;  5IMF A;  2VO4 A;  3GMF A;  1GSF A;  2J9H A;  4GCI A;  1HNC A;  4QQ7 A;  1YQ1 A;  2YJ7 A;  4MJA A;  5D8I A;  4FYU A;  2V1M A;  2BJX A;  1NSW A;  4K7I A;  2K6V A;  3D0Z A;  4YKF A;  1HD2 A;  1K0M A;  3UMA A;  2VLV A;  3FY7 A;  2EC4 A;  5B7C A;  2WJU A;  2MBT A;  3HDC A;  1S3C A;  3TOU A;  3APQ A;  4PTS A;  3VI7 A;  1TP9 A;  5JWO B;  3F4S A;  4GXZ A;  2M46 A;  2P5Q A;  4BIK A;  4RI6 A;  2LRC A;  2PWJ A;  1EZK A;  3IOS A;  2EIR A;  3H4K A;  3FZ9 A;  4E8H A;  1AUC A;  3F4R A;  1OC9 B;  1O85 A;  1M99 A;  1GSU A;  3VPQ A;  7GSS A;  1OKD A;  4CW9 A;  3A2V A;  4PQI A;  4XIH A;  2K8V A;  5A1N A;  2YZH A;  1R5A A;  5CP1 A;  3G7J A;  3M1G A;  5C04 A;  2R0G A;  4N11 A;  1XW9 A;  1B4Q A;  1GLP A;  3US3 A;  1I5G A;  2KHP A;  4K2D A;  4MH2 A;  1XXU A;  4O5Q A;  4HS1 A;  3TJB A;  4K5S A;  2L57 A;  1XWK A;  1QXH A;  2MMZ A;  2B6M A;  3L9U A;  4ML1 A;  1Q4J A;  3L9S A;  2AYT A;  4ZB7 A;  4BWQ A;  4BVX A;  2A4V A;  2FGX A;  2R2J A;  4GQC A;  3ZFB A;  4HU7 A;  1YKC A;  2IJY A;  4WF4 A;  2LJA A;  5J4V A;  1DSB A;  3TKQ A;  2FLS A;  5DQY A;  2V2G A;  3ZZX A;  5H5S A;  1MD3 A;  4N3Z A;  5IMD A;  3P90 A;  3RFR C;  5BMU A;  5CRE A;  5CYY A;  4JRR A;  1U88 A;  1V98 A;  1URM A;  4I8B A;  5HR2 A;  2EIQ A;  4YAV A;  2L5O A;  1PX7 A;  2PVO C;  5GZZ B;  2DSA A;  3RPN A;  1E2Y A;  4P3Y B;  4TN8 A;  2L6C A;  2C3Q A;  1G7O A;  1OVN A;  2IWT A;  4H86 A;  1ZGN A;  4KGI A;  2HRN A;  2X64 A;  2MBS A;  1BED A;  1RW1 A;  5D93 A;  1XBS A;  2H76 A;  4KSM A;  1QUW A;  4Q5R A;  1XVQ A;  3KP9 A;  3BBY A;  1K3L A;  2VM2 A;  1EV4 A;  5HR3 A;  4XS6 A;  1EV9 A;  1PGT A;  2HE3 A;  3GHA A;  3NZN A;  4HQS A;  4MNN A;  3HJO A;  2P31 A;  2H1G A;  2AB6 A;  2X4A A;  3IHG A;  4KE3 A;  3EWL A;  5JCG A;  1Z3E A;  4NWY A;  3L4N A;  2V6O A;  2HRK A;  3HXS A;  3HYP A;  2FCH A;  2H19 A;  3GYK A;  1THO A;  2DLX A;  3KXO A;  3J7Y b;  2H0I A;  1SKW B;  4GST A;  3UBL A;  3QFB C;  5J5N A;  4GDF A;  2UZ8 A;  2NBS A;  4Z2R A;  1EEJ A;  2VCZ A;  4Q5F A;  5ABR A;  1T3B A;  1SYR A;  4USS A;  4CHS A;  1FOH A;  1T4Y A;  1B48 A;  2A2P A;  1R26 A;  14GS A;  4ZBB A;  3O76 A;  2OE3 A;  1SK0 A;  2O89 A;  1SJI A;  3GKM A;  5AGY A;  3ME8 A;  3IE3 A;  1ZYQ B;  4K7O A;  3DVW A;  4F82 A;  1A24 A;  2N5B A;  1K3Y A;  1YZX A;  4IW9 A;  2F3M A;  1MD4 A;  3EMX A;  1EOH A;  18GS A;  1S3R A;  5D9V A;  2G0F A;  4PNG A;  4V2M A;  3ZYW A;  3PGT A;  2YZU A;  3CQF A;  5HFI A;  3TKS A;  4OFT A;  4NXI A;  6GSW A;  2VKZ G;  1PKW A;  4I97 A;  4JED A;  2GTU A;  2V6K A;  1NM3 A;  3LQ7 A;  1GTU A;  1RQM A;  2OT3 A;  2O7K A;  1YEX A;  1V9W A;  4EDY A;  5E59 A;  5F06 A;  1YKA A;  3CHX C;  1FAA A;  3QAV A;  3KIJ A;  4MA9 A;  2C0E A;  5AIX A;  3FW2 A;  4PQ1 A;  5ECK B;  2L59 A;  3L9V A;  3BOA A;  4E68 A;  3M0F A;  2WDU A;  4TKY A;  5KEJ A;  3H8Q A;  4MF6 A;  4XTS A;  2RUF A;  2X8G A;  4V1A p;  5BRT A;  2VL2 C;  1XIY A;  3KM6 A;  2H1A A;  5CRH A;  1PRX A;  4V2N A;  2MMN A;  4K9Z A;  1OC3 A;  1TTZ A;  1JZO A;  2IMK A;  2M80 A;  2AJQ B;  2EFD A; 
#chains in the Genus database with same CATH homology
 3PH9 A;  2GSQ A;  1X5E A;  4JU5 A;  5ECR B;  2CVK A;  3M9K A;  3IAM 2;  3TJG A;  4QL9 A;  4ZBA A;  3QOU A;  4ZL8 A;  1DBY A;  2R0C A;  4MZB A;  2HRA A;  3BCK A;  3UEM A;  2H66 A;  5CRG A;  5IPG A;  2MZC A;  2PGT A;  1PSQ A;  4IN0 A;  2LV3 A;  1AAZ A;  2F51 A;  3C1R A;  2CVB A;  3G7Y A;  1QK8 A;  4JZQ A;  3D22 A;  2LRT A;  3MYD A;  5B6N A;  1EOG A;  5AIV A;  3LYK A;  1K3O A;  1G6Y A;  3EU3 A;  1XWB A;  4HJ2 A;  4RQR A;  2YP6 A;  1FHE A;  3TUE A;  4TR1 B;  1ERU A;  4MPG A;  2DIY A;  4D73 B;  3IC4 A;  4KAE A;  2HSM B;  2GST A;  5G5E A;  2YAN A;  2KLX A;  4EVM A;  3ISO A;  1FG4 A;  1THX A;  1BX9 A;  3GKN A;  3IXR A;  4JE1 A;  4G0I A;  1EGR A;  1GTA A;  3F4T A;  4F0B A;  1B9Y C;  4XS4 B;  4L5O A;  1T7P B;  3GIX A;  1M9B A;  4MAB A;  3VWW A;  1V58 A;  4WEY A;  2ALB A;  2E0Q A;  2HSN A;  3LSZ A;  1Z7P A;  1GLQ A;  3FR9 A;  4OFM A;  3D4T A;  4TXO A;  1FO5 A;  4TR0 A;  1SKS B;  2DKH A;  3ZIJ A;  2LST A;  3A5W A;  4G19 A;  1F3B A;  2R6K A;  3KMN A;  3GTU B;  3PR8 A;  4ISD A;  1A8Y A;  1GTI A;  5LNK e;  4OCE A;  5IMC A;  5C00 A;  2XC2 A;  4PGT A;  4ECJ A;  3ZL5 A;  2CX4 A;  4BL7 A;  2B3S A;  3HVX A;  1A0F A;  3WYW A;  3DML A;  3IV4 A;  2DBC A;  2DJJ A;  3EYT A;  2VUP A;  3U6V A;  2B1K A;  1F37 A;  16GS A;  3VWU A;  4N10 A;  1OYJ A;  2H74 A;  5IMZ A;  3D5J A;  2B5X A;  2VLU A;  3IDV A;  4J56 E;  3D4M A;  2TRX A;  3UVT A;  3FEU A;  3FR6 A;  4ILF A;  1GRX A;  2KP2 A;  1Y1U A;  3HVS A;  2ON7 A;  2YCD A;  2UV8 G;  2N5A A;  4WBR D;  1CQH A;  1J9B A;  4X0X A;  1WOU A;  2C8U A;  5L71 A;  5KN1 A;  2VCQ A;  3KGK A;  2HFD A;  1HNB A;  5IOW A;  2YV7 A;  2O87 A;  3PIN A;  1Z9H A;  1TKD B;  4ZL7 A;  2HSY A;  3E0U A;  3L0H A;  2IN3 A;  4POL A;  1S3D A;  3DIE A;  4YQM A;  4L0U A;  1N2A A;  4IJI A;  3VUR A;  1BG5 A;  1YEP A;  5IO2 A;  5B6M A;  3EMP A;  2G2Q A;  3VPT A;  3APS A;  2O8V B;  1AQX A;  3KMO A;  1TRU A;  4WF5 A;  1ZYN A;  1U87 A;  2MMA A;  2AV4 A;  1O81 A;  5FT3 A;  1USB A;  4GLT A;  5G31 A;  1X9M B;  4G01 A;  2R5G A;  1A8L A;  2B5Y A;  4BWS A;  2F8F A;  3E9J B;  5HFG A;  5D9X A;  6GSY A;  3J7Y k;  3HY2 A;  1T8E B;  1ERT A;  2IME A;  1AQV A;  4EXJ A;  4HJM A;  1SL0 B;  3GKK A;  3NIV A;  4AI6 A;  3CSI A;  2VL3 A;  2ZCT A;  4ML6 A;  1YDK A;  5GAN D;  3N9J A;  2CT6 A;  2WUL A;  3IAS 2;  1MDJ A;  2YWM A;  3LXT A;  2HZE A;  1OE7 A;  4HZ4 A;  1U3A A;  4IEL A;  4ECB A;  1V40 A;  2AAW A;  1PMT A;  3G7I A;  3QDN A;  1GSE A;  3LG6 A;  2DJ2 A;  1GUH A;  4AJ8 A;  4PQH A;  1GUM A;  1ACV A;  1I9D A;  4TVE A;  4BPY A;  2HSH A;  2GDR A;  3ZML A;  1TU7 A;  2X49 A;  4DSS B;  2KOK A;  4G0K A;  2XBI A;  1RK4 A;  5F8B A;  3UAP A;  3CTF A;  3VI5 A;  1N25 A;  3GSS A;  4F0C A;  2PN8 A;  4TRX A;  3BD2 A;  2GLR A;  3NOF A;  5DDL A;  4NHW A;  4GWR A;  1AC1 A;  5CRD A;  5DJL A;  5G5F A;  1U6T A;  4F2I A;  1JZR A;  4IQA A;  2H0G A;  2IMI A;  1TRW A;  3I43 A;  4FYC A;  2XPD A;  2OJL A;  2B7J A;  12GS A;  4KA0 A;  1TI3 A;  2JL4 A;  1QFN A;  2C4J A;  4HI7 A;  2CZ2 A;  2OAD A;  1M2A A;  4NHZ A;  4YQU A;  5J9B A;  3HJM A;  3ZRE A;  5ECH B;  2P5R A;  3GFK A;  1XOB A;  1VGL A;  3TKR A;  1BQ7 A;  1X9S B;  5E4W A;  1LBK A;  3CYN A;  3GNJ A;  5GST A;  1AXD A;  2V32 A;  1EEM A;  3V1W A;  1FVJ A;  4RI7 A;  5B8A A;  3FKF A;  4MPF A;  1UA5 A;  4K5R A;  4EIP A;  2LKU A;  2PPT A;  3W8J A;  4NMU A;  4AJ6 A;  2LQQ A;  4AJ7 A;  2CAI A;  2YJH A;  1YY7 A;  22GS A;  5F07 A;  4YAP A;  5A1N B;  1TXX A;  5IO0 A;  1GNW A;  5EL8 A;  4A5P A;  1PL2 A;  4K0N A;  2VL9 A;  2YNX A;  5KOW A;  3SBC A;  19GS A;  1Y6E A;  3QMX A;  3GST A;  3ZRD A;  4RUV A;  3GKX A;  3GUS A;  4OMV A;  5D96 A;  4KDX A;  4O32 A;  1X5D A;  3DGQ A;  4KDY A;  2OE0 A;  3HHV A;  4IP6 A;  1TRV A;  1HNA A;  2PBJ A;  1SL2 B;  4BVX B;  1K0C A;  1HYU A;  5G30 A;  2H1D A;  4WBJ A;  1TU8 A;  4FYB A;  4K0G A;  2EFC A;  1JZD A;  4GTU A;  4YH2 A;  8GSS A;  3KH7 A;  3GH6 A;  4XRD A;  1JLW A;  4JBB A;  1DUG A;  5DAL A;  4LA1 A;  2OKA A;  3FZ4 A;  2F8A A;  1X0R A;  4HDE A;  3IHQ A;  5BMU B;  1LU4 A;  4CY8 A;  4Z2U A;  4XHM A;  4NAX A;  1X5C A;  2RLI A;  2I9H A;  3LXZ A;  2WGR A;  3LYP A;  3TU3 B;  1ILO A;  2AUV A;  3DVX A;  4TOP A;  4BVY A;  1ABA A;  2E2M A;  4KUN A;  2M72 A;  5F0G A;  2IFQ A;  1MTC A;  4OWY A;  3C8E A;  4I2T A;  3TGZ A;  2LTK A;  1WPI A;  3F6D A;  1T00 A;  2HI7 A;  1DE2 A;  1F6M C;  2QA1 A;  4HEA 2;  3DWV A;  5ECO B;  1O73 A;  4DEJ A;  1B4P A;  1TXU A;  2A2R A;  1K0B A;  4LLR A;  2OBK A;  1ML6 A;  2HRK B;  2GS3 A;  4J57 E;  1O7U A;  3W6G A;  3QD9 A;  1WP0 A;  1XWC A;  10GS A;  2DJK A;  5EY6 A;  4ZB8 A;  5HQP A;  4EKZ A;  2C1Y A;  3CBU A;  3WT2 A;  2B7K A;  2TRC P;  2VCV A;  1ZYP A;  2EIO A;  3K8N A;  2GZZ A;  1KTE A;  2QGV A;  3MIX A;  5FWG A;  4X4J A;  5DBQ A;  3ME7 A;  4O5R A;  2H6Y A;  1ST9 A;  2GVP A;  4EO3 A;  3TRQ A;  5JCW A;  4K1F A;  4TR3 A;  2B5E A;  2YWO A;  3RHC A;  4ACS A;  1GL8 A;  4XCS A;  1XWA A;  4PUR A;  5H5Q A;  2H71 A;  4EE0 A;  3DYR A;  1VF3 A;  4EUY A;  1SVL A;  4ID0 A;  3O6T A;  4DSR A;  3MDK A;  1K0N A;  5ECQ B;  4TXV A;  3R2Q A;  5IM9 A;  4O5U A;  2KP1 A;  2L6D A;  4XS1 A;  4L5L A;  1XCC A;  5ELG A;  2HLS A;  4MZC A;  3F0I A;  3KH9 A;  3W8S A;  2IIY A;  2FWE A;  3IK7 A;  5J41 A;  5ECS A;  4MJB A;  2YWN A;  5H5R A;  4OFN A;  2HYX A;  5AIS A;  2BMX A;  4KB3 A;  2B1L A;  4AKX B;  3QFA C;  3UJ1 A;  5ECN B;  2FA4 A;  5CAX A;  5A5K A;  1V2A A;  3VWX A;  3RBT A;  2GGT A;  1JFU A;  5KN2 A;  1Z5Y E;  2H0H A;  4MLY A;  3Q18 A;  4AKI A;  1AIU A;  2JSY A;  2F9S A;  4GSS A;  1BG1 A;  1XZO A;  1NHO A;  1GSQ A;  4I5Q A;  3RDW A;  17GS A;  4L8E A;  1SD9 A;  3GUR A;  1S3A A;  1LJR A;  4MF5 A;  3KJY A;  3IBH A;  4IJ3 A;  1GTB A;  5A34 A;  3CXG A;  1JHB A;  4EL1 A;  1R4W A;  4LMW A;  3ZVJ D;  3VLN A;  1EP8 A;  5J3R A;  4L0W A;  1OE8 A;  3MWH A;  2L4Q A;  4EDZ A;  2LRN A;  3F63 A;  1GP1 A;  2CA8 A;  4MJC A;  3Q6O A;  4MK3 A;  4EIQ A;  4POM A;  3L78 A;  4F9Z A;  1WJK A;  1VRS D;  5KOX A;  1ERW A;  4IVF A;  4POK A;  4I2U A;  3IPZ A;  1OAZ A;  3O3T A;  2DKI A;  5LD0 A;  2NPB A;  3GA4 A;  1ZMA A;  1G0T A;  5D73 A;  2J23 A;  4O7H A;  4KSO A;  2IMF A;  3I9V 2;  5INY A;  2LEG A;  3UL3 A;  3VK9 A;  1Z6M A;  5A5H A;  4WR4 A;  9GSS A;  1F2E A;  3ED3 A;  4G0L A;  3LW9 A;  4GRF A;  3TKS C;  2DJ3 A;  5GSS A;  2JAD A;  1TK8 B;  5ECI B;  1GSS A;  3TCO A;  1M2B A;  3G9B A;  3LJR A;  1SL1 B;  5G2Z A;  2GT6 A;  3FR3 A;  1J0F A;  5IMA A;  4FH8 A;  5FHI A;  1TRS A;  6GST A;  1MDI A;  2K8S A;  3KTL A;  2FWF A;  2VIM A;  2HSN B;  2C3N A;  5J4Y A;  2CVD A;  4TXO B;  2FD3 A;  3I6A A;  3EU4 A;  4FO5 A;  1N8J A;  4N30 A;  1T4Z A;  1BF5 A;  5HR0 A;  3C7M A;  1YF0 A;  3APO A;  4K7N A;  1OC9 A;  3LOR A;  2N5F A;  1IYH A;  4TW5 A;  2K18 A;  4HOJ A;  1M9A A;  3HCZ A;  4BL7 B;  2GQK A;  2C0D A;  3EE2 A;  3D6I A;  2LNT A;  4Q5Q A;  4IKH A;  2YPM A;  2LNS A;  1AQW A;  4KCE A;  3ZIV A;  4V1A g;  5JWQ B;  1QQ2 A;  3LFL A;  4O92 A;  3UAR A;  4W66 A;  1V57 A;  4WXT A;  3WGX A;  4X1U A;  4HQZ A;  4IP1 A;  3IC8 A;  5IOX A;  3CMI A;  2JZT A;  2OE1 A;  5DJM A;  3H1N A;  5A4V A;  2DMM A;  1K0O A;  2OAC A;  3GV1 A;  1SYX A;  1WWJ A;  3LGC A;  5IMV A;  1WRY A;  3RAZ A;  11GS A;  4MJE A;  3EUR A;  1BAY A;  3HJP A;  6GSS A;  2FY6 A;  1U3I A;  3FHK A;  1BYE A;  3GL5 A;  1XW6 A;  3ERW A;  4Q5N A;  1C72 A;  4V2L A;  5J9C A;  2CV4 A;  3EVI A;  3FRC A;  3C73 A;  4GSN A;  5J47 A;  3FZ5 A;  5IIZ A;  2LS5 A;  1Z7R A;  5CNW A;  1XWG A;  2A2S A;  3TRX A;  1EWX A;  5DCH A;  2I3Y A;  3A2X A;  4J2F A;  3AY8 A;  3QR6 A;  2RM6 A;  1ZCP A;  2E7P A;  4ZBD A;  4OO5 A;  4EF0 A;  3KEB A;  2QC7 A;  5HR1 A;  1KEB A;  1SU9 A;  2TIR A;  2HQT A;  5DCG A;  2YN1 A;  2FA8 A;  3DD3 A;  3CWG A;  4ZIL A;  2WFC A;  4ULX A;  1FW1 A;  3ZIT A;  3TDG A;  4KH7 A;  2MMO A;  1GUK A;  3DXB A;  1B9X C;  1OC8 A;  2H01 A;  5CRW A;  2R3X A;  2GSR A;  2VL2 A;  3M3M A;  3CRT A;  3RPP A;  5B8B A;  5ECL B;  3BCI A;  1K0A A;  3QCP A;  2QKE A;  4FIW A;  3FMW A;  1F9M A;  1PX6 A;  3HZ8 A;  1PN9 A;  3QPM A;  1ZL9 A;  2CAQ A;  2PVQ A;  3EPT A;  3C71 A;  1TK5 B;  4BA7 A;  2H6X A;  1WMJ A;  2H75 A;  4ZB9 A;  4PX1 A;  1GUL A;  3FYG A;  3HZ4 A;  3HVV A;  4KDU A;  4I6X A;  4E8E A;  1O8W A;  4QL7 A;  5G1L A;  1Z6N A;  2HZE B;  2C0G A;  3ZVJ A;  1DE1 A;  3VFI A;  3GN3 A;  1A2L A;  3HMJ G;  2VM1 A;  6GSX A;  4HZ2 A;  1FVK A;  5G1K A;  1M2D A;  5HFK A;  1TI1 A;  3P8W A;  3DEX A;  1H4O A;  3TKP A;  3F8U A;  5ELA A;  4HUA A;  2YOI A;  2JSZ A;  4YQV A;  1XFL A;  2IPA A;  2C3T A;  4AKG A;  2DJ0 A;  2H1B A;  4AKH A;  4K8M A;  2NTO A;  1TDI A;  4PNF A;  5DAK A;  3QAW A;  5J40 A;  2P0G A;  1SEN A;  4ECI A;  3TJF A;  1YF1 A;  3CSJ A;  2PUK C;  3ERF A;  2JZR A;  3KZQ A;  2VD1 A;  3F9U A;  4ZL9 A;  5JCU A;  2VCW A;  2LQO A;  2GT5 A;  2HRF A;  6GSV A;  2XPE A;  4JR6 A;  2IMD A;  2PER A;  1PN0 A;  4OCF A;  1TOF A;  2C80 A;  2C0F A;  2LJK A;  3ZLP A;  4MZW A;  4LL1 B;  1Y25 A;  2WZ9 A;  2JU5 A;  1R5P A;  5KN0 A;  5GAP D;  2BTO T;  1NHY A;  3F6F A;  4AGS A;  5A4W A;  1XPV A;  4MF7 A;  4ICY A;  1T1V A;  2WB9 A;  4DVC A;  2VCT A;  2VD0 A;  1GSD A;  5J4U A;  4NV5 A;  3OR5 A;  3UBK A;  1GSY A;  1A2J A;  4KF9 A;  1SJ6 A;  4WKW A;  3GL3 A;  3EC3 A;  2PMT A;  2H72 A;  2RUE A;  3MNG A;  2I81 A;  3H93 A;  4RQX A;  4TR1 A;  2GZY A;  4CDO A;  4D73 A;  3WGD A;  2HSM A;  2ON5 A;  2DIZ A;  13GS A;  4F03 A;  1J08 A;  6GSU A;  1NW2 A;  1SD8 A;  3TRP A;  5DAK B;  2RII A;  2FWH A;  3F3R A;  2GQL A;  2H70 A;  2L4C A;  3EIN A;  4NPB A;  3A2W A;  2R37 A;  4XS4 A;  1BJX A;  2X8H A;  1KNG A;  1SK1 A;  5DAL B;  1O6J A;  2H1L A;  4XRA A;  3TB2 A;  2QA2 A;  2E2G A;  1EGO A;  4N0V A;  3A5I A;  1HQO A;  1R7H A;  1A2M A;  3FZA A;  3E3E A;  3KP8 A;  1EP7 A;  4AF2 A;  3HA9 A;  4KND A;  2D2Z A;  2FUG 2;  3F3Q A;  4IGJ A;  2I1U A;  1VF4 A;  1QGV A;  3GTU A;  4LL4 B;  2GZP A;  4BVY B;  1SJZ A;  3Q19 A;  1MEK A;  2DC5 A;  2IFQ B;  2EFE A;  4MCU A;  5JWR B;  4PUA A;  5ECM B;  1K0D A;  5EVO A;  3HKR A;  1WE0 A;  4Z2T A;  1XVW A;  3GX0 A;  4N0Z A;  1YJ6 A;  2X99 A;  1AW9 A;  2PU9 C;  2V41 A;  4GQF A;  3Q74 A;  4JR4 A;  5DVB A;  3IK9 A;  2X8C A;  5ID2 A;  2DJ1 A;  4IQ1 A;  3ZFL A;  1PD2 1;  2LUS A;  3LWA A;  1G7E A;  3KCM A;  1PL1 A;  3R3E A;  4POB A;  2VLT A;  2I4A A;  5D9W A;  1OKT A;  1CQG A;  2Z9S A;  1ERV A;  2WCI A;  4IHU A;  2R4V A;  2RM5 A;  3TOT A;  2ZUP A;  1SKR B;  1UC7 A;  2ES7 A;  2HT9 A;  3MAK A;  3M9J A;  4NV2 A;  2CX3 A;  4IS0 A;  1A23 A;  2K9F A;  3DRN A;  3JCM L;  1SVM A;  2XBQ A;  3M8N A;  3RHB A;  3WGE A;  1M0U A;  3N5O A;  4CY6 A;  4G10 A;  3GRX A;  4HU9 A;  2JZS A;  3A3T A;  4LMV A;  3KD0 A;  5CO3 A;  3TKS E;  3TJJ A;  2LJR A;  3UVH A;  4PXO A;  3GX8 A;  1QMV A;  3PPU A;  2IL3 A;  1XW5 A;  1M7T A;  1ON4 A;  1XOA A;  1IYI A;  2WS2 A;  5D9T A;  1PKZ A;  3WD6 A;  3D21 A;  2FWG A;  1TK0 B;  1JZW A;  3C1S A;  4MH3 A;  1VF1 A;  4ZXG A;  5A4U A;  3HD5 A;  3UIW A;  5AN1 A;  2MYG A;  1GWC A;  1JLV A;  4ECC A;  4ZIJ A;  1VF2 A;  2REM A;  3IR4 A;  4KX4 A;  3ERG A;  2O85 A;  2OBI A;  2EFH A;  1W4V A;  1GNE A;  4IBP A;  2OA7 A;  1FB0 A;  3P7X A;  4G2E A;  4WET A;  1ZZY A;  2HNL A;  1SK2 A;  1UN2 A;  5EPF A;  4PUF C;  5LCZ A;  2NDO A;  4ZB6 A;  20GS A;  4TR4 A;  3CRU A;  2CQ9 A;  3H79 A;  3UOM A;  2H30 A;  3TJK A;  4DSQ A;  1SVO A;  4KW6 A;  3LEF A;  5ID2 B;  3WT1 A;  2FHE A;  2XHF A;  2GQM A;  3KTB A;  1X9W B;  1UVZ A;  1ZYE A;  1Q98 A;  3S9F A;  4GF0 A;  4YKG A;  2R0P A;  4K2X A;  1TW9 A;  1ZOF A;  4X43 A;  2L5L A;  2KUC A;  4EC0 A;  2WRT A;  3GH9 A;  3SWL A;  1YVL A;  2VAF A;  2JAC A;  3MSZ A;  4Z7X A;  4K6X A;  4MP4 A;  2YV9 A;  3FK8 A;  2HZF A;  5IQY A;  5DQS A;  2QSI A;  2NVL A;  1O8X A;  1E6B A;  3U5R E;  1MDK A;  3ZTL A;  5A34 B;  3I69 A;  3ZMK A;  4MMM A;  1PA3 A;  4MDC A;  4OD7 A;  1G6W A;  2H73 A;  1GH2 A;  2VOC A;  5ENU A;  4G9H A;  3CTG A;  4WR5 A;  1F3A A;  2A4H A;  1TJD A;  2H6Z A;  4FQU A;  3P2A A;  2YWI A;  4QMK A;  1A0R P;  1KBN A;  1H75 A;  1W89 A;  2DML A;  1FOV A;  5IPH A;  5ECP B;  3IRA A;  2VCX A;  3BJ5 A;  3DKS A;  4KCA A;  3VWV A;  2H8L A;  2HXK A;  1PQN A;  5F05 A;  2O5V A;  2ZNM A;  1B8X A;  2AHE A;  2GSS A;  1FB6 A;  3CSH A;  4OO4 A;  5KN3 A;  4DSS A;  5COH A;  1WIK A;  5A5H B;  2CZ3 A;  3IA1 A;  3QAG A;  2FNO A;  5IMF A;  2VO4 A;  3GMF A;  1GSF A;  2J9H A;  4GCI A;  1HNC A;  4QQ7 A;  1YQ1 A;  2YJ7 A;  4MJA A;  5D8I A;  4FYU A;  2V1M A;  2BJX A;  1NSW A;  4K7I A;  2K6V A;  3D0Z A;  4YKF A;  1HD2 A;  1K0M A;  3UMA A;  2VLV A;  3FY7 A;  2EC4 A;  5B7C A;  2WJU A;  2MBT A;  3HDC A;  1S3C A;  3TOU A;  3APQ A;  4PTS A;  3VI7 A;  1TP9 A;  5JWO B;  3F4S A;  4GXZ A;  2M46 A;  2P5Q A;  4RI6 A;  2LRC A;  2PWJ A;  1EZK A;  3IOS A;  2EIR A;  3H4K A;  3FZ9 A;  4E8H A;  1AUC A;  3F4R A;  1OC9 B;  1O85 A;  1M99 A;  1GSU A;  3VPQ A;  7GSS A;  1OKD A;  4CW9 A;  3A2V A;  4PQI A;  4XIH A;  2K8V A;  5A1N A;  2YZH A;  1R5A A;  5CP1 A;  3G7J A;  3M1G A;  5C04 A;  2R0G A;  4N11 A;  1XW9 A;  1B4Q A;  1GLP A;  3US3 A;  1I5G A;  2KHP A;  4K2D A;  4MH2 A;  1XXU A;  4O5Q A;  4HS1 A;  3TJB A;  4K5S A;  2L57 A;  1XWK A;  1QXH A;  2MMZ A;  2B6M A;  3L9U A;  4ML1 A;  1Q4J A;  3L9S A;  2AYT A;  4ZB7 A;  4BWQ A;  4BVX A;  2A4V A;  2FGX A;  2R2J A;  4GQC A;  3ZFB A;  4HU7 A;  1YKC A;  2IJY A;  4WF4 A;  2LJA A;  5J4V A;  1DSB A;  3TKQ A;  2FLS A;  5DQY A;  2V2G A;  3ZZX A;  5H5S A;  1MD3 A;  4N3Z A;  5IMD A;  3P90 A;  5BMU A;  5CRE A;  5CYY A;  4JRR A;  1U88 A;  1V98 A;  1URM A;  4I8B A;  5HR2 A;  2EIQ A;  4YAV A;  2L5O A;  1PX7 A;  2PVO C;  5GZZ B;  2DSA A;  3RPN A;  1E2Y A;  4P3Y B;  4TN8 A;  2L6C A;  2C3Q A;  1G7O A;  1OVN A;  2IWT A;  4H86 A;  1ZGN A;  4KGI A;  2HRN A;  2X64 A;  2MBS A;  1BED A;  1RW1 A;  5D93 A;  1XBS A;  2H76 A;  4KSM A;  1QUW A;  4Q5R A;  1XVQ A;  3KP9 A;  3BBY A;  1K3L A;  2VM2 A;  1EV4 A;  5HR3 A;  4XS6 A;  1EV9 A;  1PGT A;  2HE3 A;  3GHA A;  3NZN A;  4HQS A;  4MNN A;  3HJO A;  2P31 A;  2H1G A;  2AB6 A;  2X4A A;  3IHG A;  4KE3 A;  3EWL A;  5JCG A;  1Z3E A;  4NWY A;  3L4N A;  2V6O A;  2HRK A;  3HXS A;  3HYP A;  2FCH A;  2H19 A;  3GYK A;  1THO A;  2DLX A;  3KXO A;  3J7Y b;  2H0I A;  1SKW B;  4GST A;  3UBL A;  3QFB C;  5J5N A;  4GDF A;  2UZ8 A;  2NBS A;  4Z2R A;  1EEJ A;  2VCZ A;  4Q5F A;  5ABR A;  1T3B A;  1SYR A;  4USS A;  4CHS A;  1FOH A;  1T4Y A;  1B48 A;  2A2P A;  1R26 A;  14GS A;  4ZBB A;  3O76 A;  2OE3 A;  1SK0 A;  2O89 A;  1SJI A;  3GKM A;  5AGY A;  3ME8 A;  3IE3 A;  1ZYQ B;  4K7O A;  3DVW A;  4F82 A;  1A24 A;  2N5B A;  1K3Y A;  1YZX A;  4IW9 A;  2F3M A;  1MD4 A;  3EMX A;  1EOH A;  18GS A;  5D9V A;  2G0F A;  4PNG A;  4V2M A;  3ZYW A;  3PGT A;  2YZU A;  5HFI A;  3TKS A;  4OFT A;  4NXI A;  6GSW A;  2VKZ G;  1PKW A;  4I97 A;  4JED A;  2GTU A;  2V6K A;  1NM3 A;  3LQ7 A;  1GTU A;  1RQM A;  2OT3 A;  2O7K A;  1YEX A;  1V9W A;  4EDY A;  5E59 A;  5F06 A;  1YKA A;  1FAA A;  3QAV A;  3KIJ A;  4MA9 A;  2C0E A;  5AIX A;  3FW2 A;  4PQ1 A;  5ECK B;  2L59 A;  3L9V A;  3BOA A;  4E68 A;  3M0F A;  2WDU A;  4TKY A;  5KEJ A;  3H8Q A;  4MF6 A;  4XTS A;  2RUF A;  2X8G A;  4V1A p;  5BRT A;  2VL2 C;  1XIY A;  3KM6 A;  2H1A A;  5CRH A;  1PRX A;  4V2N A;  2MMN A;  4K9Z A;  1OC3 A;  1TTZ A;  1JZO A;  2IMK A;  2M80 A;  2AJQ B;  2EFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...