2A2UA

The crystal structures of a2u-globulin and its complex with a hyaline droplet inducer.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
b'EEASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVFMQHIDVLENSLGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFHLINFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALPHA-2U-GLOBULIN)
publication title The structures of alpha 2u-globulin and its complex with a hyaline droplet inducer.
pubmed doi rcsb
molecule tags Lipid binding protein
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2a2uA00
4ZHFA 5BVTA 1DC9A 4AZPA 3VG7A 3PEDA 3BX7A 3NX1A 4YFPA 2JU3A 5H9LA 3FR2A 4YCEA 1GX8A 4PSQA 1DZPA 4YKMA 4A1HA 4QGVA 1BSOA 4ES7A 4XMEA 5HCCC 4TKBA 3EYCA 4AW8A 3CWKA 3DTQA 5HZ6A 5HZ9A 2RD7C 3TGAA 2A2UA 1GKAA 3KFHA 1ZNKA 1YP7A 1BBPA 1KQXA 1KOIA 5JR8A 1X71A 1X8UA 1FELA 3FW5A 1X8QA 1YWCA 2LBAA 1MDCA 1KT3A 3PECA 1BRQA 3Q6LA 4IB7A 1VPRA 1DZMA 4DQ4A 1GGLA 4ZJ0A 2O62A 1P6PA 5CE4A 3NP1A 5H8TA 4OS0A 2WQ9A 3FA8A 3KFIA 2HYSA 1U18A 1VYFA 4OS3A 1QFVA 5HCDC 1QY2A 2CZUA 1SY3A 4Y0RA 2XSTA 1E00A 1YP6A 2L68A 1AB0A 5HTDA 3P6EA 4NNTA 3I17A 1DFVA 2XKLA 3BLGA 1AQBA 3BSZE 1JV4A 4RUNA 3NADA 2R74A 3FR4A 5D48A 2ALLX 4ZHGA 3CBSA 1YIVA 1DZJA 1LKEA 1Z24A 2ACPX 3UEUA 5LJGA 5HA1A 1I06A 3O22A 4LZVA 3FA9A 3HWGA 5FAZA 4ZH6A 3C77X 3L4RA 1OEJA 3BY0A 2W2AA 4QGWA 3ZUIA 1ADLA 4ZHDA 3CQRA 2WQAE 1KT4A 1L6MA 1ZNEA 2KT4B 4O9SA 3PP6A 3TZSA 1DZKA 4IB8A 4UU3A 2QO5A 4LZUA 4IAWA 4ZHCA 1SY2A 1MX8A 1GT3A 4ZFXA 1CBRA 1OEKA 3S26A 1ACDA 1G74A 4A8ZA 4TLJA 3BRNA 3EMMA 4TQ2A 4ORUA 4I3BA 1BWYA 5HTEA 1AVGI 1QY0A 3BU9A 3FIQA 4IBAA 4D6BA 4EEJA 3EM0A 4ODDA 5LJBA 3WJBA 4YBPA 2NNDA 1LIBA 1LFOA 4IB9A 4I9SA 3FMZA 2L5PA 2L9CA 1FENA 1IKJA 1QABE 5L8OA 3FA7A 1SXXA 2QM9A 2NP1A 1BLRA 2JU8A 1EIOA 5F1EA 4IB6A 4BQUA 5EPQA 3TF6A 2OVAA 4XMFA 3P6CA 1EXSA 1JYJA 5K06A 3OJYC 1EPAA 1FEMA 1BEBA 2Q39A 3U0DA 1OEEA 4XMHA 5C0NA 1KT5A 3FEPA 1JZUA 4IMOA 3RSWA 1AELA 5L8IA 3UEXA 3D95A 2RA6A 1SY1A 3WJFA 4ZHHA 4A60A 4WBKA 4QZTA 1KXOA 3AKMA 3VG3A 1CJ5A 2WSJA 3B2IA 4CK4A 3FLLA 1A18A 4N7CA 4Y0SA 1KZXA 1IKEA 3DSZA 2W2FA 2LB6A 3UEVA 1UZ2X 2FRSA 2GTFX 2A2GA 2RQ0A 2BLGA 1HMTA 3AKNA 4HPAA 1T8VA 1B4MA 2JU7A 2MJIA 1KT7A 1S7DA 4HFOA 1GT1A 3TGBA 3ZQ3A 1ALBA 1G5WA 1YWBA 2NNQA 2WR6A 1T0VA 3WJGA 4ZGUA 1MVGA 1MX7A 2K23A 2POAA 1I05A 2CBSA 3NQ3A 3D96A 2OVDA 5B29A 5EEDA 3TGCA 2JN3A 1IIUA 4WFUA 1ICNA 1QFTA 2WUTA 5LJEA 1G85A 5F6ZA 2GC9A 5KHPA 3VG5A 1IFCA 3F8AA 3JS1A 4GETA 1QWDA 2Q9SA 2AL0X 4A1YA 4BOEA 2E4JA 1PBOA 1ZNDA 4YGHA 5D8JA 5F6BA 2AT6X 5LJCA 4HPBA 1IW2A 4YDAA 3HK1A 2CZTA 2AMMX 4AZMA 2FR3A 3VG6A 5KIDA 2LBVA 1SXUA 4ZH9A 2JOZA 4Y0QA 2QOSC 1SA8A 1SY0A 1FDQA 4TJZA 2OZQA 5DG4A 2AKQA 2OFMX 5LJDA 1BJ7A 1JJXA 2LFOA 2DM5A 4ORYA 5H9KA 2A13A 3FELA 2RCTA 1ZNHA 3WJCA 2MM3A 2HLVA 1GT4A 5LJHA 2WWPA 5IO6A 5D4AA 1HN2A 3MVFA 3GAQA 3QKGA 4QGXA 5BVQA 3O19A 1GX9A 1LICA 2OVEA 5L8NA 3WJDA 5DPQA 1LPJA 1HBPA 3ELXA 1HMRA 3CQNA 4MVIA 4XMDA 2QO6A 1SXYA 2R56A 3NX2A 1B0OA 1NP4A 4GNWA 1OBQA 1S44A 1U17A 3CR6A 4YFRA 1BRPA 3APWA 2AT3X 2X45A 1UREA 4TKJA 3SAOA 1B56A 1R0UA 3STMX 2ASNX 1TOWA 3BX8A 4EXZA 3VG2A 1GXAA 1D3SA 1EQDA 3JSQA 5EDBA 4K19A 3B2JA 1VYGA 3WBGA 5HAEA 1ICMA 1G7NA 2ACOA 3P6GA 3FA6A 4GKCA 4YH0A 1CRBA 2N93A 2G79A 4ORXA 5D45A 1LIDA 4D6AA 5HZ5A 4QYNA 5HCEC 2Q4NA 1DV9A 2NNEA 3C76X 1CBQA 1LF7A 4NYQA 3F9DA 3B2HA 3NR3A 4ORWA 3D97A 1XCAA 2K62A 4MVLA 1EW3A 2FLJA 1X8OA 5IO5A 5HZ8A 4AZRA 1ZNGA 1QQSA 3BS2A 1E5PA 2AT0X 3I0AA 4ZCBA 3B2LA 1HMSA 1I04A 1O1UA 3PH6A 2WEWA 2CM4A 3EBWA 1E06A 5HZQA 1LIFA 4QAEA 5IO7A 4YGGA 2FS6A 1LIEA 2G78A 1TW4A 1KQWA 4NYRA 4OMXA 3P6DA 2AT8X 3ELZA 2FWVA 1T68X 4XMCA 2X46A 3U9PC 1CBSA 1TOUA 1BSQA 1GKAB 1O8VA 3STKA 1OPAA 3WVMA 3NPOA 1B8EA 3PH5A 5H9AA 3EBKA 4QYPA 2PY1A 2IFBA 4N7DA 4GH7A 1TXLA 1H91A 1ERXA 5LKEA 1X8NA 1EUOA 1FTPA 2ANSA 2RCQA 5B27A 1E02A 1ERBA 2CBRA 4I3DA 2FTBA 1EALA 3BU1A 2A0AA 3UEWA 2R73A 4YGZA 3MBTA 4M7MA 4NP1A 1JJJA 1FE3A 4TKHA 2F73A 1KT6A 3KFFA 3HWDA 5EZ2A 3C78X 3KFGA 3CBCA 3VG4A 4OMWA 3KQ0A 2W2BA 3FR5A 1NGLA 1QY1A 4HPCA 3ZUOA 2HMBA 4UU2A 1PMPA 1EPBA 5F58A 1BSYA 1YWDA 4NLIA 5LJKA 2P8GA 1S2PA 4DQ3A 1OBPA 4I3CA 3WJEA 1KZWA 5D47A 1X8PA 2G7BA 1JBHA 5AQ6A 4YMYA 2FT9A 5FFHA 1N0SA 4M6SA 4WFVA 1PEEA 2L67A 2Q2MA 3HWEA 1MUPA 1NP1A 4YKOA 4OS8A 4ALBA 5FENA 2AH7X 1O1VA 2WEXA 4ARHA 4EDEA 1LNMA 3RZYA 1HBQA 2KTDA 2AT5X 3APVA 2YG2A 3FEKA 4GRJA 4AYHA 4EFGA 1SXWA 5HWZA 1DF3A 1XKIA 4KIIA 1TVQA 4AZQA 4ORSA 1A2DA 1HQPA 1OBUA 2CM9A 4NLJA 2A3FX 2HNXA 3T1DA 1RBPA 1GT5A 1OPBA 3NQ9A 3IFBA 4RUUA 3K3LA 2OFRX 1A3YA 1JYDA 5HA0A 1KGLA 3BDRA 2FS7A 3HWFA 3IA8A 4YFQA 2LKKA 4QZUA 4AZOA 3B2KA 2Q2PA 1ZNLA 4ALOA 5F7GA 5KICA 2GJ5A 4ORRA 3APUA 3STNA 1D2UA 5H9NA 1U0XA 4XMGA 4R0BA 1ZRYA 5BVSA 5HBSA 1A57A 4IAXA 4YDBA 3APXA 3FENA 4NNSA 5LKFA 2FR2A 4BVMA 1PM1X 4LKPA 4TNNA 4YBUA 3CMPA 4HPDA 4Y0PA 5EEEA 4YCHA 1IFBA 3G7XA 4LKTA 3U03A 1QG5A 1RLBE 1GM6A 3PPTA 1YWAA 4I9RA 4MVKA 2QO4A 4IMNA 2HZRA 4AZNA 3FW4A 1CBIA 3P6FA 4GNYA 1BM5A 2HZQA 4ZR2A 1I4UA 4GE1A 2EU7X 5EDCA 3O2YA 3WXQA 3KZAA 1YUPA 2MO5A 1ML7A 1X89A 3P6HA 1EIIA
chains in the Genus database with same CATH superfamily
3AUMO 4WHIA 4ZHFA 5BVTA 1SWOA 1VWDB 1DC9A 4AZPA 3VG7A 1VWGB 3NQKA 2QOMA 2RN4A 3PEDA 1VWKB 3BX7A 3HPEA 2RTBB 3NX1A 4YFPA 2JU3A 5H9LA 1MOYA 1SWEA 3OBLA 4CPHA 3FR2A 1SREA 4YCEA 1GX8A 4PSQA 1DZPA 4YKMA 1MEPA 2JGSA 4A1HA 4QGVA 1BSOA 1SWUA 2IZKA 4BX6A 4DNEA 4GDZA 4XMEA 4ES7A 5HCCC 4TKBA 3EYCA 4AW8A 4Y5DA 4QNIA 3CWKA 2KTSA 4CPFA 3DTQA 4O4UA 1Y9LA 2AVIA 5HZ6A 2RD7C 5HZ9A 3TGAA 2A2UA 1GKAA 3P24A 3V8UA 1I78A 5FQ6E 4L3RA 3KFHA 3PDFA 1ZNKA 1YP7A 5K67A 1BBPA 1KQXA 1VWLB 1KOIA 5JR8A 1X71A 1X8UA 1FELA 3X00A 3FW5A 1X8QA 1YWCA 2LBAA 2JMBA 1MDCA 1KT3A 3PECA 1BRQA 3Q6LA 4IB7A 1VPRA 1DZMA 4DQ4A 1GGLA 4ZJ0A 2O62A 1P6PA 5CE4A 3NP1A 5H8TA 2YMSA 4OS0A 1JQPA 1N4JA 2WQ9A 3RE6A 3FA8A 1WUBA 2FKGA 3KFIA 2HYSA 3VHIA 1U18A 3WVMA 1VYFA 4OS3A 1KL3A 1FJ1E 2OF9A 1SRIA 1QFVA 2KD2A 1QY2A 2CZUA 4FBVA 5HCDC 1SY3A 4Y0RA 4MISA 2XSTA 1E00A 1Y9TA 1YP6A 1AB0A 2L68A 4NW4A 5HTDA 2GTLN 3FIDA 3P6EA 1SLEB 1DFVA 3I17A 4NNTA 1LDQA 3EW1A 2XKLA 3BLGA 1AQBA 3BSZE 1JV4A 4RUNA 2OY5O 2Y3FA 2R74A 3FR4A 3NADA 2ALLX 5CHKA 4O4SA 5D48A 4ZHGA 2X32A 1OSPO 1SWFA 3CBSA 1YIVA 1DZJA 1LKEA 1Z24A 1HQQA 2ACPX 3EC5A 3WZQA 4NV8A 3UEUA 4CDEA 2GTLM 5LJGA 1HXZA 1I06A 5HA1A 3O22A 1SLDB 4LZVA 3FA9A 3HWGA 4MEEA 4FGIB 4LQZA 5FAZA 4ZH6A 3C77X 2IZDB 1JJUA 1OEJA 3BY0A 2W2AA 3L4RA 4QGWA 2X34A 3ZUIA 1ADLA 4BGFA 4ZHDA 3CQRA 2WQAE 1KT4A 3WOVA 2OL7A 1L6MA 1ZNEA 2KT4B 2RTQB 4I95A 1LCVA 3PP6A 4O3XB 4O9SA 3TZSA 1DZKA 4IB8A 4UU3A 2QO5A 1E2TA 4LZUA 4IAWA 2M4LA 4ZHCA 4B55A 1SWNA 1SY2A 1MX8A 1GT3A 4YVBA 5IRAA 3WZOA 3RWXA 4ZFXA 1CBRA 1OEKA 2PI3O 3S26A 1ACDA 3H3IA 1LCZA 2VFBA 1G74A 4O3WA 4Z2OA 4A8ZA 4TLJA 1I9HA 1VWOB 2RTDB 2RTOB 3BRNA 3EMMA 4TQ2A 4ORUA 1NBXA 2RTHB 4I3BA 1BWYA 5HTEA 1AVGI 2JW1A 1QY0A 3BU9A 3FIQA 2DJFA 4IBAA 4JO6A 3WZPA 4GDAA 1VWRB 3EM0A 2Y32A 4BCSA 3PQSA 4D6BA 4EEJA 2A5CA 4ODDA 2IZJA 5LJBA 3WJBA 1SWAA 1JIWI 4CDDA 2NNDA 4ON1A 1LIBA 4CPIA 4YBPA 4JNJA 1LFOA 3PK2A 4IB9A 2X8SA 3WYPA 3AEHA 4I9SA 3FMZA 2L5PA 2L9CA 1FENA 1IKJA 1QABE 3RDMA 5L8OA 2X56A 3FA7A 1SXXA 2QM9A 2NP1A 4U8UO 1BLRA 2JU8A 4O3ZA 1EIOA 4GJVA 1SWPA 5F1EA 5B2AO 4IB6A 4BQUA 5EPQA 2RTLA 3SLOA 2F09A 2RTGB 3TF6A 1STRB 2C1QA 2OVAA 2FHNX 4XMFA 3P6CA 1EXSA 1JYJA 5K06A 3OJYC 1VWAB 2MHDA 1EPAA 1FEMA 4I60A 1BEBA 2Q39A 4EQAC 4U8UN 1OEEA 4XMHA 3U0DA 5C0NA 1KT5A 3FEPA 3VHMA 1JZUA 4IMOA 3RSWA 1DF8A 1GX3A 3D4RA 3LV4A 5L8IA 1PTSA 3UEXA 1MK5A 1AELA 3D95A 2RA6A 1SY1A 1IJ8A 2OYBO 3SOTA 3WJFA 5LJCA 2RTFB 4ZHHA 4A60A 4WBKA 4I6SA 1SWKA 3T6LA 4QZTA 1KXOA 1K24A 3AKMA 3VG3A 1CJ5A 5IXGA 3MG5A 1VYOA 2WSJA 3B2IA 3FLLA 4U8UM 4CK4A 1A18A 2BC3A 4N7CA 4Y0SA 3SLTA 1IKEA 3DSZA 1EI5A 2W2FA 1KZXA 2LB6A 3UEVA 2F01A 1UZ2X 2FRSA 2GTFX 4U9CA 4CSBA 2A2GA 2RQ0A 2BLGA 1HMTA 1STSB 3AKNA 4HPAA 1T8VA 3RDOA 1B4MA 2JU7A 2MJIA 1KT7A 1S7DA 4HFOA 1GT1A 3TGBA 3ZQ3A 1ALBA 1G5WA 1HY2A 1YWBA 1UYOX 2NNQA 2WR6A 3VGWA 1SWTA 1VWNB 1T0VA 4Z2VA 3WJGA 4ZGUA 3LTWA 1STPA 1MVGA 3SZIA 1MX7A 2K23A 2Y3EA 4QQ1A 2POAA 1I05A 2CBSA 1RSUB 3NQ3A 5BYPA 3D96A 2OVDA 5B29A 1NQMA 4GD9A 2X4MA 2BT9A 5EEDA 4GUZA 2JN3A 3TGCA 1IIUA 4WFUA 3S5XA 1ICNA 1QFTA 1VWBB 2WUTA 5LJEA 1SWQA 1G85A 1VWMB 5F6ZA 4JHQA 2GC9A 2FGSA 4GGTA 3VG5A 5KHPA 2GTLO 1IFCA 2G8CO 2BSZA 3F8AA 3FYFA 3JS1A 4GETA 4BJ8A 1QWDA 2Z4HA 2Q9SA 5F2BA 2AL0X 4A1YA 4BOEA 1W6FA 2ZAIA 3P02A 2E4JA 1PBOA 1ZNDA 2X8FA 4YGHA 2A5BA 2AT6X 2IZEB 5D8JA 5F6BA 5CSEA 1SWRA 4HPBA 1IW2A 4O49A 4Z2PA 1KL5A 4YDAA 4CV7A 3HK1A 1SWJA 1SMPI 2CZTA 2AMMX 4AZMA 2FR3A 3VG6A 3EW2A 5KIDA 2LBVA 1SXUA 4ZH9A 2JOZA 4Y0QA 2QOSC 1SA8A 1SY0A 1FDQA 4TJZA 3RDSA 2OZQA 5DG4A 2AKQA 2OFMX 1W5RA 1BJ7A 5LJDA 5IRWA 1JJXA 2LFOA 2DM5A 4ORYA 3ZW2A 5H9KA 2A13A 3SZHA 3FELA 2RCTA 5K68A 1ZNHA 3WJCA 2HLVA 2MM3A 1LCWA 3RBYA 3T2WA 1GT4A 5LJHA 2WWPA 2BHVA 2A8GA 5IO6A 5D4AA 1HN2A 3MVFA 3GAQA 1N9YA 3SLJA 3QKGA 4QGXA 5BVQA 2IZBA 3O19A 3HOLA 3ZI8A 3LHNA 1GX9A 4U3QA 1LICA 3F6ZB 2OVEA 2OL8O 3WJDA 5L8NA 2OY8A 5DPQA 1LPJA 1HBPA 3ELXA 2OY7A 1SWHA 1HMRA 3CQNA 4MVIA 4XMDA 2QO6A 4JGLA 1SXYA 2RTKA 2R56A 4BX5B 1VWIB 3NX2A 1B0OA 3RDUA 1NP4A 2RTEB 4GNWA 3JQOA 1OBQA 1RAVA 1S44A 2RTNB 1U17A 3VHHA 2ZSCA 1KL4A 1N7YA 3CR6A 1BRPA 3APWA 4YFRA 2AT3X 2X45A 1UREA 4TKJA 2KW1A 2UYWA 3SAOA 1VWPB 4HWMA 1B56A 4BBOA 1R0UA 3STMX 4ZGFA 2ASNX 3OD9A 1SWDA 2CAMA 3CKGA 1TOWA 3BX8A 4EXZA 4Z6JA 2BS6A 2IZFB 3VG2A 1GXAA 2I5ZO 1D3SA 1EQDA 3JSQA 1SLFB 5EDBA 3SZJA 4FBRA 4K19A 1Y55X 3B2JA 1VYGA 1RXKA 3WBGA 5HAEA 1ICMA 4GGRA 3VPJE 4Z27A 1G7NA 3N91A 2ACOA 3P6GA 3FA6A 4GKCA 2I5VO 2UZ2A 4IRWA 4YH0A 1RSTB 1CRBA 2N93A 2G79A 4ORXA 5D45A 1LIDA 2OVSA 4D6AA 5HZ5A 4QYNA 5HCEC 2OFBA 2Q4NA 1DV9A 2NNEA 3C76X 1CBQA 1LF7A 2RTIB 4FBOA 4NYQA 3F9DA 2QCBA 5B5FA 1AVEA 3B2HA 3NR3A 4GK9A 4MIRA 2IZCB 3D97A 1XCAA 4ORWA 2K62A 4CPEA 4MVLA 1EW3A 2FLJA 1X8OA 1KFFA 3PQUA 5IO5A 5HZ8A 3T2XA 4AZRA 1SWGA 1RXJA 1ZNGA 1SRGA 1QQSA 3HTYA 3BS2A 2X55A 1E5PA 2AT0X 1Y52X 2DJGA 3I0AA 4ZCBA 3B2LA 1HMSA 1I04A 1O1UA 3PH6A 2IZIA 3NBXX 2WEWA 2CM4A 1SWLA 3EBWA 4ID2A 1E06A 5HZQA 2Z4IA 1LIFA 2OFAA 4GZVA 2QMIA 4QAEA 4QRLA 5IO7A 4GGZA 4PJ2A 4YGGA 5B11O 3UAQA 2FS6A 2RTPB 3RE5A 1LIEA 4FQBB 2G78A 4O4OA 3Q34A 1NQNA 1TW4A 1KQWA 4NYRA 4OMXA 3ZWEA 3P6DA 2AT8X 3ELZA 2FWVA 1T68X 4XMCA 3RDXA 2X46A 3U9PC 4U46A 1CBSA 1SRHA 4INNA 1TOUA 1BSQA 1GKAB 1O8VA 2RTCB 1OPAA 4NV7A 3RY2A 3STKA 2C1SA 3NPOA 1B8EA 3PH5A 5H9AA 2AF5A 3EBKA 2PY1A 4KH8A 2IFBA 4QYPA 4N7DA 4GH7A 1TXLA 1H91A 2MWHA 1ERXA 5LKEA 1X8NA 1EUOA 1WBIA 1FTPA 2ANSA 2OY1O 2RCQA 3CKFA 5B27A 1E02A 1Y0GA 2VFCA 5B10O 1ERBA 2CBRA 4I3DA 2FTBA 2OL6O 3BU1A 2IZAA 1EALA 2A0AA 3UEWA 2GH7A 1SWCA 2R73A 4IABA 4YGZA 5CYBA 3MBTA 4M7MA 4NP1A 1RXHA 3S60A 1JJJA 1FE3A 4TKHA 2RTRB 1KT6A 1VWHB 2C4IA 2F73A 3HWDA 3KFFA 3C78X 3KFGA 3CBCA 5EZ2A 3VE2A 4OMWA 3VG4A 2ZAGA 3KQ0A 4BX7B 3T6FA 1VWEB 2W2BA 1VWQB 2RTAA 1Y53X 3FR5A 5L3YA 1NGLA 1QY1A 4HPCA 1LDOA 2HMBA 3ZUOA 4UU2A 1PMPA 1EPBA 5F58A 5AJCA 1BSYA 1YWDA 3QQ2A 4NLIA 5LJKA 5AJBA 2P8GA 1S2PA 4DQ3A 1OBPA 4I3CA 3WJEA 1KZWA 5D47A 4OKAA 2IZHB 1X8PA 2G7BA 1JBHA 5AQ6A 3RKGA 4YMYA 4KC8A 2FT9A 3ZW1B 5FFHA 1N0SA 4M6SA 3VE1A 1SLGB 4WFVA 1N43A 2L67A 2Q2MA 3HWEA 1PEEA 1MUPA 4BX7A 1NP1A 4OEMA 2RTMA 4YKOA 5JD2A 4OS8A 2IZLB 1LUQA 1VWFB 4ALBA 5FENA 2AH7X 1O1VA 2WEXA 1K3BA 4ARHA 4EDEA 3E3CA 1LNMA 3RZYA 3S5VA 4KT5A 1HBQA 2KTDA 2RTJA 2AT5X 3APVA 2YG2A 3FEKA 4GRJA 4AYHA 4KCAA 4EFGA 1SXWA 2VDFA 5HWZA 3OE3A 1DF3A 4CDFA 1XKIA 4KIIA 3ZW1A 1TVQA 4AZQA 4ORSA 2OF8A 4Z28A 1A2DA 1HQPA 1OBUA 2CM9A 4NLJA 4EKVA 2A3FX 5FQ7E 3WZNA 2HNXA 3T1DA 4C5PA 1RBPA 1GT5A 1OPBA 2X8TA 3IFBA 2IZGB 3MM0A 3NQ9A 4RUUA 3K3LA 3RY1A 4CDCA 2BS5A 2OFRX 1A3YA 1JYDA 3ZW0B 5HA0A 1SRFA 3BDRA 5IRUA 2FS7A 3HWFA 3IA8A 1KGLA 4YFQA 2LKKA 1NDJA 4QZUA 4AZOA 3B2KA 2FHLA 1ZNLA 2Q2PA 1HXLA 3RDQA 4ALOA 5F7GA 3VU1A 5KICA 2GJ5A 1PBYA 4ORRA 1N9MA 1JMXA 1JMZA 3APUA 4OELA 3STNA 1VWCB 1W4TA 4O3YA 1D2UA 1SRJA 5H9NA 1U0XA 4XMGA 4BX5A 4R0BA 1ZRYA 4ML7B 3FDCA 5FQ8E 5BVSA 5HBSA 1A57A 1MM9A 4IAXA 4YDBA 1VWJB 3APXA 3FENA 4NNSA 5LKFA 5B5GA 1SWSA 4O4XA 2MF6A 2FR2A 4BVMA 1PM1X 4LKPA 4MVEA 3ZW0A 4TNNA 3MX7A 4YBUA 3ZZVA 3D9WA 3CMPA 2LA7A 1UYNX 4L1NA 4HPDA 4Y0PA 5EEEA 4YCHA 1IFBA 3G7XA 4LKTA 3U03A 5B3MO 4DCBA 2WPUA 4KC7A 1QG5A 2FKJA 3HOEA 1RLBE 2HKDA 1GM6A 3PPTA 1SWBA 1YWAA 4I9RA 4MVKA 2QO4A 4IMNA 2HZRA 4GJSA 4AZNA 3FW4A 1CBIA 4CPHB 3GE2A 1LELA 3P6FA 4GNYA 1AVDA 2HZQA 1NC9A 4Y59A 4ZR2A 1I4UA 4GE1A 2EU7X 5EDCA 1BM5A 3O2YA 2G5LA 3WXQA 3KZAA 4BX6B 3WYQA 1YUPA 2MO5A 1ML7A 1X89A 3P6HA 5AEOA 1EIIA 4COTA 3KVNA 4GU8A
chains in the Genus database with same CATH topology
4WHIA 4ZHFA 5BVTA 1DC9A 4AZPA 3VG7A 3NQKA 2RN4A 3PEDA 3BX7A 3NX1A 4YFPA 2JU3A 5H9LA 3OBLA 3FR2A 4YCEA 1GX8A 4PSQA 1DZPA 4YKMA 4A1HA 4QGVA 1BSOA 4ES7A 4GDZA 4XMEA 5HCCC 4TKBA 3EYCA 4AW8A 4QNIA 3CWKA 2KTSA 3DTQA 4O4UA 1Y9LA 5HZ6A 5HZ9A 2RD7C 3TGAA 2A2UA 1GKAA 3P24A 3V8UA 5FQ6E 4L3RA 3KFHA 1ZNKA 1YP7A 1BBPA 1KQXA 1KOIA 5JR8A 1X71A 1X8UA 1FELA 3FW5A 1X8QA 1YWCA 2LBAA 2JMBA 1MDCA 1KT3A 3PECA 1BRQA 3Q6LA 4IB7A 1VPRA 1DZMA 4DQ4A 1GGLA 4ZJ0A 2O62A 1P6PA 5CE4A 3NP1A 5H8TA 2YMSA 4OS0A 2WQ9A 3FA8A 3KFIA 2HYSA 1U18A 1VYFA 4OS3A 1QFVA 2KD2A 1QY2A 2CZUA 4FBVA 5HCDC 1SY3A 4Y0RA 4MISA 2XSTA 1E00A 1Y9TA 1YP6A 1AB0A 2L68A 4NW4A 5HTDA 2GTLN 3P6EA 4NNTA 3I17A 1DFVA 2XKLA 3BLGA 1AQBA 3BSZE 1JV4A 4RUNA 3NADA 2R74A 3FR4A 5D48A 2ALLX 4ZHGA 4O4SA 3CBSA 1YIVA 1DZJA 1LKEA 1Z24A 2ACPX 3UEUA 2GTLM 5LJGA 5HA1A 1I06A 3O22A 4LZVA 3FA9A 3HWGA 4FGIB 4LQZA 5FAZA 4ZH6A 3C77X 3L4RA 1OEJA 3BY0A 2W2AA 4QGWA 3ZUIA 1ADLA 4ZHDA 3CQRA 2WQAE 1KT4A 3WOVA 1L6MA 1ZNEA 2KT4B 4I95A 4O3XB 3PP6A 4O9SA 3TZSA 1DZKA 4IB8A 4UU3A 2QO5A 4LZUA 4IAWA 2M4LA 4ZHCA 1SY2A 1MX8A 1GT3A 4ZFXA 3RWXA 1CBRA 1OEKA 3S26A 1ACDA 3H3IA 4O3WA 1G74A 4A8ZA 4TLJA 3BRNA 3EMMA 4TQ2A 4ORUA 4I3BA 1BWYA 5HTEA 1AVGI 2JW1A 1QY0A 3BU9A 3FIQA 4IBAA 4D6BA 4EEJA 3EM0A 3PQSA 4ODDA 5LJBA 3WJBA 4YBPA 1JIWI 2NNDA 4ON1A 1LIBA 1LFOA 4IB9A 2X8SA 4I9SA 3FMZA 2L5PA 2L9CA 1FENA 1IKJA 1QABE 5L8OA 3FA7A 1SXXA 2QM9A 2NP1A 4U8UO 1BLRA 2JU8A 4O3ZA 1EIOA 5F1EA 4IB6A 4BQUA 5EPQA 2F09A 3TF6A 2OVAA 4XMFA 3P6CA 1EXSA 1JYJA 5K06A 3OJYC 2MHDA 1EPAA 1FEMA 1BEBA 2Q39A 4EQAC 4U8UN 1OEEA 4XMHA 3U0DA 5C0NA 1KT5A 3FEPA 1JZUA 4IMOA 3RSWA 3D4RA 3LV4A 5L8IA 3UEXA 1AELA 3D95A 2RA6A 1SY1A 3SOTA 3WJFA 4ZHHA 4A60A 4WBKA 4I6SA 4QZTA 1KXOA 3AKMA 3VG3A 1CJ5A 2WSJA 3B2IA 4U8UM 3FLLA 4CK4A 1A18A 4N7CA 4Y0SA 1KZXA 1IKEA 3DSZA 1EI5A 2W2FA 2LB6A 3UEVA 4CSBA 1UZ2X 2FRSA 2GTFX 4U9CA 2A2GA 2RQ0A 2BLGA 1HMTA 3AKNA 4HPAA 1T8VA 1B4MA 2JU7A 2MJIA 1KT7A 1S7DA 4HFOA 1GT1A 3TGBA 3ZQ3A 1ALBA 1G5WA 1YWBA 2NNQA 2WR6A 1T0VA 3WJGA 4ZGUA 1MVGA 1MX7A 2K23A 4QQ1A 5BYPA 2POAA 1I05A 2CBSA 3NQ3A 3D96A 2OVDA 5B29A 2BT9A 5EEDA 3TGCA 2JN3A 1IIUA 4WFUA 3S5XA 1ICNA 1QFTA 2WUTA 5LJEA 1G85A 5F6ZA 2GC9A 5KHPA 3VG5A 2GTLO 1IFCA 3FYFA 3F8AA 3JS1A 4GETA 1QWDA 2Z4HA 2Q9SA 2AL0X 4A1YA 4BOEA 2ZAIA 3P02A 2E4JA 1PBOA 1ZNDA 2X8FA 4YGHA 5D8JA 2AT6X 5F6BA 5LJCA 4HPBA 1IW2A 4O49A 4YDAA 4CV7A 3HK1A 1SMPI 2CZTA 2AMMX 4AZMA 2FR3A 3VG6A 5KIDA 2LBVA 1SXUA 4ZH9A 2JOZA 4Y0QA 2QOSC 1SA8A 1SY0A 1FDQA 4TJZA 2OZQA 5DG4A 2AKQA 2OFMX 5LJDA 1BJ7A 1JJXA 2LFOA 2DM5A 4ORYA 3ZW2A 5H9KA 2A13A 3FELA 2RCTA 1ZNHA 3WJCA 2MM3A 2HLVA 3RBYA 1GT4A 5LJHA 2WWPA 2BHVA 5IO6A 5D4AA 1HN2A 3MVFA 3GAQA 3QKGA 4QGXA 5BVQA 3O19A 3HOLA 3ZI8A 3LHNA 1GX9A 4U3QA 1LICA 3F6ZB 2OVEA 5L8NA 3WJDA 5DPQA 1LPJA 1HBPA 3ELXA 1HMRA 3CQNA 4MVIA 4XMDA 2QO6A 4JGLA 1SXYA 2R56A 3NX2A 1B0OA 1NP4A 4GNWA 3JQOA 1OBQA 1S44A 1U17A 3CR6A 4YFRA 1BRPA 3APWA 2AT3X 2X45A 1UREA 4TKJA 2KW1A 3SAOA 4HWMA 1B56A 4ZGFA 1R0UA 3STMX 2ASNX 3OD9A 1TOWA 3BX8A 4EXZA 2BS6A 3VG2A 1GXAA 1D3SA 1EQDA 3JSQA 5EDBA 4FBRA 4K19A 3B2JA 1VYGA 3WBGA 5HAEA 1ICMA 3VPJE 1G7NA 3N91A 2ACOA 3P6GA 3FA6A 4GKCA 4YH0A 1CRBA 2N93A 2G79A 4ORXA 5D45A 1LIDA 2OVSA 4D6AA 5HZ5A 4QYNA 5HCEC 2Q4NA 1DV9A 2NNEA 3C76X 1CBQA 1LF7A 4FBOA 4NYQA 3F9DA 3B2HA 3NR3A 4GK9A 4MIRA 4ORWA 3D97A 1XCAA 2K62A 4MVLA 1EW3A 2FLJA 1X8OA 3PQUA 5IO5A 5HZ8A 4AZRA 1ZNGA 3HTYA 1QQSA 3BS2A 1E5PA 2AT0X 3I0AA 4ZCBA 3B2LA 1HMSA 1I04A 1O1UA 3PH6A 3NBXX 2WEWA 2CM4A 3EBWA 4ID2A 1E06A 5HZQA 2Z4IA 1LIFA 4GZVA 2QMIA 4QAEA 4QRLA 5IO7A 4PJ2A 4YGGA 3UAQA 2FS6A 1LIEA 4FQBB 2G78A 4O4OA 1TW4A 1KQWA 4NYRA 4OMXA 3ZWEA 3P6DA 2AT8X 3ELZA 2FWVA 1T68X 4XMCA 2X46A 3U9PC 1CBSA 4INNA 1TOUA 1BSQA 1GKAB 1O8VA 3STKA 1OPAA 3WVMA 3NPOA 1B8EA 3PH5A 5H9AA 3EBKA 4QYPA 2PY1A 4KH8A 2IFBA 4N7DA 4GH7A 1TXLA 1H91A 2MWHA 1ERXA 5LKEA 1X8NA 1EUOA 1FTPA 2ANSA 2RCQA 5B27A 1E02A 1ERBA 2CBRA 4I3DA 2FTBA 1EALA 3BU1A 2A0AA 3UEWA 5CYBA 2R73A 4IABA 4YGZA 3S60A 3MBTA 4M7MA 4NP1A 1JJJA 1FE3A 4TKHA 2F73A 1KT6A 3KFFA 3HWDA 5EZ2A 3VE2A 3C78X 3KFGA 3CBCA 3VG4A 4OMWA 2ZAGA 3KQ0A 2W2BA 3FR5A 1NGLA 1QY1A 4HPCA 3ZUOA 2HMBA 4UU2A 1PMPA 1EPBA 5F58A 5AJCA 1BSYA 1YWDA 4NLIA 5LJKA 5AJBA 2P8GA 1S2PA 4DQ3A 1OBPA 4I3CA 3WJEA 1KZWA 5D47A 1X8PA 2G7BA 1JBHA 5AQ6A 3RKGA 4YMYA 4KC8A 2FT9A 3ZW1B 5FFHA 1N0SA 4M6SA 3VE1A 4WFVA 1PEEA 2L67A 2Q2MA 3HWEA 1MUPA 1NP1A 4YKOA 4OS8A 4ALBA 5FENA 2AH7X 1O1VA 2WEXA 4ARHA 4EDEA 3E3CA 1LNMA 3RZYA 3S5VA 4KT5A 1HBQA 2KTDA 2AT5X 3APVA 2YG2A 3FEKA 4GRJA 4AYHA 4KCAA 4EFGA 1SXWA 5HWZA 3OE3A 1DF3A 1XKIA 4KIIA 3ZW1A 1TVQA 4AZQA 4ORSA 1A2DA 1HQPA 1OBUA 2CM9A 4NLJA 2A3FX 5FQ7E 2HNXA 3T1DA 1RBPA 1GT5A 1OPBA 2X8TA 3IFBA 3NQ9A 4RUUA 3K3LA 2BS5A 2OFRX 1A3YA 1JYDA 3ZW0B 5HA0A 1KGLA 3BDRA 2FS7A 3HWFA 3IA8A 4YFQA 2LKKA 4QZUA 4AZOA 3B2KA 2Q2PA 1ZNLA 4ALOA 5F7GA 3VU1A 5KICA 2GJ5A 4ORRA 3APUA 3STNA 4O3YA 1D2UA 5H9NA 1U0XA 4XMGA 4R0BA 1ZRYA 4ML7B 5FQ8E 5BVSA 5HBSA 1A57A 4IAXA 4YDBA 3APXA 3FENA 4NNSA 5LKFA 4O4XA 2FR2A 4BVMA 1PM1X 4LKPA 4MVEA 3ZW0A 4TNNA 3MX7A 4YBUA 3ZZVA 3CMPA 2LA7A 4L1NA 4HPDA 4Y0PA 5EEEA 4YCHA 1IFBA 3G7XA 4LKTA 3U03A 4KC7A 1QG5A 3HOEA 1RLBE 1GM6A 3PPTA 1YWAA 4I9RA 4MVKA 2QO4A 4IMNA 2HZRA 4AZNA 3FW4A 1CBIA 3GE2A 3P6FA 4GNYA 1BM5A 2HZQA 4ZR2A 1I4UA 4GE1A 2EU7X 5EDCA 3O2YA 3WXQA 3KZAA 1YUPA 2MO5A 1ML7A 1X89A 3P6HA 5AEOA 1EIIA 4COTA 4GU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHF A;  5BVT A;  1DC9 A;  4AZP A;  3VG7 A;  3PED A;  3BX7 A;  3NX1 A;  4YFP A;  2JU3 A;  5H9L A;  3FR2 A;  4YCE A;  1GX8 A;  4PSQ A;  1DZP A;  4YKM A;  4A1H A;  4QGV A;  1BSO A;  4ES7 A;  4XME A;  5HCC C;  4TKB A;  3EYC A;  4AW8 A;  3CWK A;  3DTQ A;  5HZ6 A;  5HZ9 A;  2RD7 C;  3TGA A;  2A2U A;  1GKA A;  3KFH A;  1ZNK A;  1YP7 A;  1BBP A;  1KQX A;  1KOI A;  5JR8 A;  1X71 A;  1X8U A;  1FEL A;  3FW5 A;  1X8Q A;  1YWC A;  2LBA A;  1MDC A;  1KT3 A;  3PEC A;  1BRQ A;  3Q6L A;  4IB7 A;  1VPR A;  1DZM A;  4DQ4 A;  1GGL A;  4ZJ0 A;  2O62 A;  1P6P A;  5CE4 A;  3NP1 A;  5H8T A;  4OS0 A;  2WQ9 A;  3FA8 A;  3KFI A;  2HYS A;  1U18 A;  1VYF A;  4OS3 A;  1QFV A;  5HCD C;  1QY2 A;  2CZU A;  1SY3 A;  4Y0R A;  2XST A;  1E00 A;  1YP6 A;  2L68 A;  1AB0 A;  5HTD A;  3P6E A;  4NNT A;  3I17 A;  1DFV A;  2XKL A;  3BLG A;  1AQB A;  3BSZ E;  1JV4 A;  4RUN A;  3NAD A;  2R74 A;  3FR4 A;  5D48 A;  2ALL X;  4ZHG A;  3CBS A;  1YIV A;  1DZJ A;  1LKE A;  1Z24 A;  2ACP X;  3UEU A;  5LJG A;  5HA1 A;  1I06 A;  3O22 A;  4LZV A;  3FA9 A;  3HWG A;  5FAZ A;  4ZH6 A;  3C77 X;  3L4R A;  1OEJ A;  3BY0 A;  2W2A A;  4QGW A;  3ZUI A;  1ADL A;  4ZHD A;  3CQR A;  2WQA E;  1KT4 A;  1L6M A;  1ZNE A;  2KT4 B;  4O9S A;  3PP6 A;  3TZS A;  1DZK A;  4IB8 A;  4UU3 A;  2QO5 A;  4LZU A;  4IAW A;  4ZHC A;  1SY2 A;  1MX8 A;  1GT3 A;  4ZFX A;  1CBR A;  1OEK A;  3S26 A;  1ACD A;  1G74 A;  4A8Z A;  4TLJ A;  3BRN A;  3EMM A;  4TQ2 A;  4ORU A;  4I3B A;  1BWY A;  5HTE A;  1AVG I;  1QY0 A;  3BU9 A;  3FIQ A;  4IBA A;  4D6B A;  4EEJ A;  3EM0 A;  4ODD A;  5LJB A;  3WJB A;  4YBP A;  2NND A;  1LIB A;  1LFO A;  4IB9 A;  4I9S A;  3FMZ A;  2L5P A;  2L9C A;  1FEN A;  1IKJ A;  1QAB E;  5L8O A;  3FA7 A;  1SXX A;  2QM9 A;  2NP1 A;  1BLR A;  2JU8 A;  1EIO A;  5F1E A;  4IB6 A;  4BQU A;  5EPQ A;  3TF6 A;  2OVA A;  4XMF A;  3P6C A;  1EXS A;  1JYJ A;  5K06 A;  3OJY C;  1EPA A;  1FEM A;  1BEB A;  2Q39 A;  3U0D A;  1OEE A;  4XMH A;  5C0N A;  1KT5 A;  3FEP A;  1JZU A;  4IMO A;  3RSW A;  1AEL A;  5L8I A;  3UEX A;  3D95 A;  2RA6 A;  1SY1 A;  3WJF A;  4ZHH A;  4A60 A;  4WBK A;  4QZT A;  1KXO A;  3AKM A;  3VG3 A;  1CJ5 A;  2WSJ A;  3B2I A;  4CK4 A;  3FLL A;  1A18 A;  4N7C A;  4Y0S A;  1KZX A;  1IKE A;  3DSZ A;  2W2F A;  2LB6 A;  3UEV A;  1UZ2 X;  2FRS A;  2GTF X;  2A2G A;  2RQ0 A;  2BLG A;  1HMT A;  3AKN A;  4HPA A;  1T8V A;  1B4M A;  2JU7 A;  2MJI A;  1KT7 A;  1S7D A;  4HFO A;  1GT1 A;  3TGB A;  3ZQ3 A;  1ALB A;  1G5W A;  1YWB A;  2NNQ A;  2WR6 A;  1T0V A;  3WJG A;  4ZGU A;  1MVG A;  1MX7 A;  2K23 A;  2POA A;  1I05 A;  2CBS A;  3NQ3 A;  3D96 A;  2OVD A;  5B29 A;  5EED A;  3TGC A;  2JN3 A;  1IIU A;  4WFU A;  1ICN A;  1QFT A;  2WUT A;  5LJE A;  1G85 A;  5F6Z A;  2GC9 A;  5KHP A;  3VG5 A;  1IFC A;  3F8A A;  3JS1 A;  4GET A;  1QWD A;  2Q9S A;  2AL0 X;  4A1Y A;  4BOE A;  2E4J A;  1PBO A;  1ZND A;  4YGH A;  5D8J A;  5F6B A;  2AT6 X;  5LJC A;  4HPB A;  1IW2 A;  4YDA A;  3HK1 A;  2CZT A;  2AMM X;  4AZM A;  2FR3 A;  3VG6 A;  5KID A;  2LBV A;  1SXU A;  4ZH9 A;  2JOZ A;  4Y0Q A;  2QOS C;  1SA8 A;  1SY0 A;  1FDQ A;  4TJZ A;  2OZQ A;  5DG4 A;  2AKQ A;  2OFM X;  5LJD A;  1BJ7 A;  1JJX A;  2LFO A;  2DM5 A;  4ORY A;  5H9K A;  2A13 A;  3FEL A;  2RCT A;  1ZNH A;  3WJC A;  2MM3 A;  2HLV A;  1GT4 A;  5LJH A;  2WWP A;  5IO6 A;  5D4A A;  1HN2 A;  3MVF A;  3GAQ A;  3QKG A;  4QGX A;  5BVQ A;  3O19 A;  1GX9 A;  1LIC A;  2OVE A;  5L8N A;  3WJD A;  5DPQ A;  1LPJ A;  1HBP A;  3ELX A;  1HMR A;  3CQN A;  4MVI A;  4XMD A;  2QO6 A;  1SXY A;  2R56 A;  3NX2 A;  1B0O A;  1NP4 A;  4GNW A;  1OBQ A;  1S44 A;  1U17 A;  3CR6 A;  4YFR A;  1BRP A;  3APW A;  2AT3 X;  2X45 A;  1URE A;  4TKJ A;  3SAO A;  1B56 A;  1R0U A;  3STM X;  2ASN X;  1TOW A;  3BX8 A;  4EXZ A;  3VG2 A;  1GXA A;  1D3S A;  1EQD A;  3JSQ A;  5EDB A;  4K19 A;  3B2J A;  1VYG A;  3WBG A;  5HAE A;  1ICM A;  1G7N A;  2ACO A;  3P6G A;  3FA6 A;  4GKC A;  4YH0 A;  1CRB A;  2N93 A;  2G79 A;  4ORX A;  5D45 A;  1LID A;  4D6A A;  5HZ5 A;  4QYN A;  5HCE C;  2Q4N A;  1DV9 A;  2NNE A;  3C76 X;  1CBQ A;  1LF7 A;  4NYQ A;  3F9D A;  3B2H A;  3NR3 A;  4ORW A;  3D97 A;  1XCA A;  2K62 A;  4MVL A;  1EW3 A;  2FLJ A;  1X8O A;  5IO5 A;  5HZ8 A;  4AZR A;  1ZNG A;  1QQS A;  3BS2 A;  1E5P A;  2AT0 X;  3I0A A;  4ZCB A;  3B2L A;  1HMS A;  1I04 A;  1O1U A;  3PH6 A;  2WEW A;  2CM4 A;  3EBW A;  1E06 A;  5HZQ A;  1LIF A;  4QAE A;  5IO7 A;  4YGG A;  2FS6 A;  1LIE A;  2G78 A;  1TW4 A;  1KQW A;  4NYR A;  4OMX A;  3P6D A;  2AT8 X;  3ELZ A;  2FWV A;  1T68 X;  4XMC A;  2X46 A;  3U9P C;  1CBS A;  1TOU A;  1BSQ A;  1GKA B;  1O8V A;  3STK A;  1OPA A;  3WVM A;  3NPO A;  1B8E A;  3PH5 A;  5H9A A;  3EBK A;  4QYP A;  2PY1 A;  2IFB A;  4N7D A;  4GH7 A;  1TXL A;  1H91 A;  1ERX A;  5LKE A;  1X8N A;  1EUO A;  1FTP A;  2ANS A;  2RCQ A;  5B27 A;  1E02 A;  1ERB A;  2CBR A;  4I3D A;  2FTB A;  1EAL A;  3BU1 A;  2A0A A;  3UEW A;  2R73 A;  4YGZ A;  3MBT A;  4M7M A;  4NP1 A;  1JJJ A;  1FE3 A;  4TKH A;  2F73 A;  1KT6 A;  3KFF A;  3HWD A;  5EZ2 A;  3C78 X;  3KFG A;  3CBC A;  3VG4 A;  4OMW A;  3KQ0 A;  2W2B A;  3FR5 A;  1NGL A;  1QY1 A;  4HPC A;  3ZUO A;  2HMB A;  4UU2 A;  1PMP A;  1EPB A;  5F58 A;  1BSY A;  1YWD A;  4NLI A;  5LJK A;  2P8G A;  1S2P A;  4DQ3 A;  1OBP A;  4I3C A;  3WJE A;  1KZW A;  5D47 A;  1X8P A;  2G7B A;  1JBH A;  5AQ6 A;  4YMY A;  2FT9 A;  5FFH A;  1N0S A;  4M6S A;  4WFV A;  1PEE A;  2L67 A;  2Q2M A;  3HWE A;  1MUP A;  1NP1 A;  4YKO A;  4OS8 A;  4ALB A;  5FEN A;  2AH7 X;  1O1V A;  2WEX A;  4ARH A;  4EDE A;  1LNM A;  3RZY A;  1HBQ A;  2KTD A;  2AT5 X;  3APV A;  2YG2 A;  3FEK A;  4GRJ A;  4AYH A;  4EFG A;  1SXW A;  5HWZ A;  1DF3 A;  1XKI A;  4KII A;  1TVQ A;  4AZQ A;  4ORS A;  1A2D A;  1HQP A;  1OBU A;  2CM9 A;  4NLJ A;  2A3F X;  2HNX A;  3T1D A;  1RBP A;  1GT5 A;  1OPB A;  3NQ9 A;  3IFB A;  4RUU A;  3K3L A;  2OFR X;  1A3Y A;  1JYD A;  5HA0 A;  1KGL A;  3BDR A;  2FS7 A;  3HWF A;  3IA8 A;  4YFQ A;  2LKK A;  4QZU A;  4AZO A;  3B2K A;  2Q2P A;  1ZNL A;  4ALO A;  5F7G A;  5KIC A;  2GJ5 A;  4ORR A;  3APU A;  3STN A;  1D2U A;  5H9N A;  1U0X A;  4XMG A;  4R0B A;  1ZRY A;  5BVS A;  5HBS A;  1A57 A;  4IAX A;  4YDB A;  3APX A;  3FEN A;  4NNS A;  5LKF A;  2FR2 A;  4BVM A;  1PM1 X;  4LKP A;  4TNN A;  4YBU A;  3CMP A;  4HPD A;  4Y0P A;  5EEE A;  4YCH A;  1IFB A;  3G7X A;  4LKT A;  3U03 A;  1QG5 A;  1RLB E;  1GM6 A;  3PPT A;  1YWA A;  4I9R A;  4MVK A;  2QO4 A;  4IMN A;  2HZR A;  4AZN A;  3FW4 A;  1CBI A;  3P6F A;  4GNY A;  1BM5 A;  2HZQ A;  4ZR2 A;  1I4U A;  4GE1 A;  2EU7 X;  5EDC A;  3O2Y A;  3WXQ A;  3KZA A;  1YUP A;  2MO5 A;  1ML7 A;  1X89 A;  3P6H A;  1EII A; 
#chains in the Genus database with same CATH topology
 3AUM O;  4WHI A;  4ZHF A;  5BVT A;  1SWO A;  1VWD B;  1DC9 A;  4AZP A;  3VG7 A;  1VWG B;  3NQK A;  2QOM A;  2RN4 A;  3PED A;  1VWK B;  3BX7 A;  3HPE A;  2RTB B;  3NX1 A;  4YFP A;  2JU3 A;  5H9L A;  1MOY A;  1SWE A;  3OBL A;  4CPH A;  3FR2 A;  1SRE A;  4YCE A;  1GX8 A;  4PSQ A;  1DZP A;  4YKM A;  1MEP A;  2JGS A;  4A1H A;  4QGV A;  1BSO A;  1SWU A;  2IZK A;  4BX6 A;  4DNE A;  4GDZ A;  4XME A;  4ES7 A;  5HCC C;  4TKB A;  3EYC A;  4AW8 A;  4Y5D A;  4QNI A;  3CWK A;  2KTS A;  4CPF A;  3DTQ A;  4O4U A;  1Y9L A;  2AVI A;  5HZ6 A;  2RD7 C;  5HZ9 A;  3TGA A;  2A2U A;  1GKA A;  3P24 A;  3V8U A;  1I78 A;  5FQ6 E;  4L3R A;  3KFH A;  3PDF A;  1ZNK A;  1YP7 A;  5K67 A;  1BBP A;  1KQX A;  1VWL B;  1KOI A;  5JR8 A;  1X71 A;  1X8U A;  1FEL A;  3X00 A;  3FW5 A;  1X8Q A;  1YWC A;  2LBA A;  2JMB A;  1MDC A;  1KT3 A;  3PEC A;  1BRQ A;  3Q6L A;  4IB7 A;  1VPR A;  1DZM A;  4DQ4 A;  1GGL A;  4ZJ0 A;  2O62 A;  1P6P A;  5CE4 A;  3NP1 A;  5H8T A;  2YMS A;  4OS0 A;  1JQP A;  1N4J A;  2WQ9 A;  3RE6 A;  3FA8 A;  1WUB A;  2FKG A;  3KFI A;  2HYS A;  3VHI A;  1U18 A;  3WVM A;  1VYF A;  4OS3 A;  1KL3 A;  1FJ1 E;  2OF9 A;  1SRI A;  1QFV A;  2KD2 A;  1QY2 A;  2CZU A;  4FBV A;  5HCD C;  1SY3 A;  4Y0R A;  4MIS A;  2XST A;  1E00 A;  1Y9T A;  1YP6 A;  1AB0 A;  2L68 A;  4NW4 A;  5HTD A;  2GTL N;  3FID A;  3P6E A;  1SLE B;  1DFV A;  3I17 A;  4NNT A;  1LDQ A;  3EW1 A;  2XKL A;  3BLG A;  1AQB A;  3BSZ E;  1JV4 A;  4RUN A;  2OY5 O;  2Y3F A;  2R74 A;  3FR4 A;  3NAD A;  2ALL X;  5CHK A;  4O4S A;  5D48 A;  4ZHG A;  2X32 A;  1OSP O;  1SWF A;  3CBS A;  1YIV A;  1DZJ A;  1LKE A;  1Z24 A;  1HQQ A;  2ACP X;  3EC5 A;  3WZQ A;  4NV8 A;  3UEU A;  4CDE A;  2GTL M;  5LJG A;  1HXZ A;  1I06 A;  5HA1 A;  3O22 A;  1SLD B;  4LZV A;  3FA9 A;  3HWG A;  4MEE A;  4FGI B;  4LQZ A;  5FAZ A;  4ZH6 A;  3C77 X;  2IZD B;  1JJU A;  1OEJ A;  3BY0 A;  2W2A A;  3L4R A;  4QGW A;  2X34 A;  3ZUI A;  1ADL A;  4BGF A;  4ZHD A;  3CQR A;  2WQA E;  1KT4 A;  3WOV A;  2OL7 A;  1L6M A;  1ZNE A;  2KT4 B;  2RTQ B;  4I95 A;  1LCV A;  3PP6 A;  4O3X B;  4O9S A;  3TZS A;  1DZK A;  4IB8 A;  4UU3 A;  2QO5 A;  1E2T A;  4LZU A;  4IAW A;  2M4L A;  4ZHC A;  4B55 A;  1SWN A;  1SY2 A;  1MX8 A;  1GT3 A;  4YVB A;  5IRA A;  3WZO A;  3RWX A;  4ZFX A;  1CBR A;  1OEK A;  2PI3 O;  3S26 A;  1ACD A;  3H3I A;  1LCZ A;  2VFB A;  1G74 A;  4O3W A;  4Z2O A;  4A8Z A;  4TLJ A;  1I9H A;  1VWO B;  2RTD B;  2RTO B;  3BRN A;  3EMM A;  4TQ2 A;  4ORU A;  1NBX A;  2RTH B;  4I3B A;  1BWY A;  5HTE A;  1AVG I;  2JW1 A;  1QY0 A;  3BU9 A;  3FIQ A;  2DJF A;  4IBA A;  4JO6 A;  3WZP A;  4GDA A;  1VWR B;  3EM0 A;  2Y32 A;  4BCS A;  3PQS A;  4D6B A;  4EEJ A;  2A5C A;  4ODD A;  2IZJ A;  5LJB A;  3WJB A;  1SWA A;  1JIW I;  4CDD A;  2NND A;  4ON1 A;  1LIB A;  4CPI A;  4YBP A;  4JNJ A;  1LFO A;  3PK2 A;  4IB9 A;  2X8S A;  3WYP A;  3AEH A;  4I9S A;  3FMZ A;  2L5P A;  2L9C A;  1FEN A;  1IKJ A;  1QAB E;  3RDM A;  5L8O A;  2X56 A;  3FA7 A;  1SXX A;  2QM9 A;  2NP1 A;  4U8U O;  1BLR A;  2JU8 A;  4O3Z A;  1EIO A;  4GJV A;  1SWP A;  5F1E A;  5B2A O;  4IB6 A;  4BQU A;  5EPQ A;  2RTL A;  3SLO A;  2F09 A;  2RTG B;  3TF6 A;  1STR B;  2C1Q A;  2OVA A;  2FHN X;  4XMF A;  3P6C A;  1EXS A;  1JYJ A;  5K06 A;  3OJY C;  1VWA B;  2MHD A;  1EPA A;  1FEM A;  4I60 A;  1BEB A;  2Q39 A;  4EQA C;  4U8U N;  1OEE A;  4XMH A;  3U0D A;  5C0N A;  1KT5 A;  3FEP A;  3VHM A;  1JZU A;  4IMO A;  3RSW A;  1DF8 A;  1GX3 A;  3D4R A;  3LV4 A;  5L8I A;  1PTS A;  3UEX A;  1MK5 A;  1AEL A;  3D95 A;  2RA6 A;  1SY1 A;  1IJ8 A;  2OYB O;  3SOT A;  3WJF A;  5LJC A;  2RTF B;  4ZHH A;  4A60 A;  4WBK A;  4I6S A;  1SWK A;  3T6L A;  4QZT A;  1KXO A;  1K24 A;  3AKM A;  3VG3 A;  1CJ5 A;  5IXG A;  3MG5 A;  1VYO A;  2WSJ A;  3B2I A;  3FLL A;  4U8U M;  4CK4 A;  1A18 A;  2BC3 A;  4N7C A;  4Y0S A;  3SLT A;  1IKE A;  3DSZ A;  1EI5 A;  2W2F A;  1KZX A;  2LB6 A;  3UEV A;  2F01 A;  1UZ2 X;  2FRS A;  2GTF X;  4U9C A;  4CSB A;  2A2G A;  2RQ0 A;  2BLG A;  1HMT A;  1STS B;  3AKN A;  4HPA A;  1T8V A;  3RDO A;  1B4M A;  2JU7 A;  2MJI A;  1KT7 A;  1S7D A;  4HFO A;  1GT1 A;  3TGB A;  3ZQ3 A;  1ALB A;  1G5W A;  1HY2 A;  1YWB A;  1UYO X;  2NNQ A;  2WR6 A;  3VGW A;  1SWT A;  1VWN B;  1T0V A;  4Z2V A;  3WJG A;  4ZGU A;  3LTW A;  1STP A;  1MVG A;  3SZI A;  1MX7 A;  2K23 A;  2Y3E A;  4QQ1 A;  2POA A;  1I05 A;  2CBS A;  1RSU B;  3NQ3 A;  5BYP A;  3D96 A;  2OVD A;  5B29 A;  1NQM A;  4GD9 A;  2X4M A;  2BT9 A;  5EED A;  4GUZ A;  2JN3 A;  3TGC A;  1IIU A;  4WFU A;  3S5X A;  1ICN A;  1QFT A;  1VWB B;  2WUT A;  5LJE A;  1SWQ A;  1G85 A;  1VWM B;  5F6Z A;  4JHQ A;  2GC9 A;  2FGS A;  4GGT A;  3VG5 A;  5KHP A;  2GTL O;  1IFC A;  2G8C O;  2BSZ A;  3F8A A;  3FYF A;  3JS1 A;  4GET A;  4BJ8 A;  1QWD A;  2Z4H A;  2Q9S A;  5F2B A;  2AL0 X;  4A1Y A;  4BOE A;  1W6F A;  2ZAI A;  3P02 A;  2E4J A;  1PBO A;  1ZND A;  2X8F A;  4YGH A;  2A5B A;  2AT6 X;  2IZE B;  5D8J A;  5F6B A;  5CSE A;  1SWR A;  4HPB A;  1IW2 A;  4O49 A;  4Z2P A;  1KL5 A;  4YDA A;  4CV7 A;  3HK1 A;  1SWJ A;  1SMP I;  2CZT A;  2AMM X;  4AZM A;  2FR3 A;  3VG6 A;  3EW2 A;  5KID A;  2LBV A;  1SXU A;  4ZH9 A;  2JOZ A;  4Y0Q A;  2QOS C;  1SA8 A;  1SY0 A;  1FDQ A;  4TJZ A;  3RDS A;  2OZQ A;  5DG4 A;  2AKQ A;  2OFM X;  1W5R A;  1BJ7 A;  5LJD A;  5IRW A;  1JJX A;  2LFO A;  2DM5 A;  4ORY A;  3ZW2 A;  5H9K A;  2A13 A;  3SZH A;  3FEL A;  2RCT A;  5K68 A;  1ZNH A;  3WJC A;  2HLV A;  2MM3 A;  1LCW A;  3RBY A;  3T2W A;  1GT4 A;  5LJH A;  2WWP A;  2BHV A;  2A8G A;  5IO6 A;  5D4A A;  1HN2 A;  3MVF A;  3GAQ A;  1N9Y A;  3SLJ A;  3QKG A;  4QGX A;  5BVQ A;  2IZB A;  3O19 A;  3HOL A;  3ZI8 A;  3LHN A;  1GX9 A;  4U3Q A;  1LIC A;  3F6Z B;  2OVE A;  2OL8 O;  3WJD A;  5L8N A;  2OY8 A;  5DPQ A;  1LPJ A;  1HBP A;  3ELX A;  2OY7 A;  1SWH A;  1HMR A;  3CQN A;  4MVI A;  4XMD A;  2QO6 A;  4JGL A;  1SXY A;  2RTK A;  2R56 A;  4BX5 B;  1VWI B;  3NX2 A;  1B0O A;  3RDU A;  1NP4 A;  2RTE B;  4GNW A;  3JQO A;  1OBQ A;  1RAV A;  1S44 A;  2RTN B;  1U17 A;  3VHH A;  2ZSC A;  1KL4 A;  1N7Y A;  3CR6 A;  1BRP A;  3APW A;  4YFR A;  2AT3 X;  2X45 A;  1URE A;  4TKJ A;  2KW1 A;  2UYW A;  3SAO A;  1VWP B;  4HWM A;  1B56 A;  4BBO A;  1R0U A;  3STM X;  4ZGF A;  2ASN X;  3OD9 A;  1SWD A;  2CAM A;  3CKG A;  1TOW A;  3BX8 A;  4EXZ A;  4Z6J A;  2BS6 A;  2IZF B;  3VG2 A;  1GXA A;  2I5Z O;  1D3S A;  1EQD A;  3JSQ A;  1SLF B;  5EDB A;  3SZJ A;  4FBR A;  4K19 A;  1Y55 X;  3B2J A;  1VYG A;  1RXK A;  3WBG A;  5HAE A;  1ICM A;  4GGR A;  3VPJ E;  4Z27 A;  1G7N A;  3N91 A;  2ACO A;  3P6G A;  3FA6 A;  4GKC A;  2I5V O;  2UZ2 A;  4IRW A;  4YH0 A;  1RST B;  1CRB A;  2N93 A;  2G79 A;  4ORX A;  5D45 A;  1LID A;  2OVS A;  4D6A A;  5HZ5 A;  4QYN A;  5HCE C;  2OFB A;  2Q4N A;  1DV9 A;  2NNE A;  3C76 X;  1CBQ A;  1LF7 A;  2RTI B;  4FBO A;  4NYQ A;  3F9D A;  2QCB A;  5B5F A;  1AVE A;  3B2H A;  3NR3 A;  4GK9 A;  4MIR A;  2IZC B;  3D97 A;  1XCA A;  4ORW A;  2K62 A;  4CPE A;  4MVL A;  1EW3 A;  2FLJ A;  1X8O A;  1KFF A;  3PQU A;  5IO5 A;  5HZ8 A;  3T2X A;  4AZR A;  1SWG A;  1RXJ A;  1ZNG A;  1SRG A;  1QQS A;  3HTY A;  3BS2 A;  2X55 A;  1E5P A;  2AT0 X;  1Y52 X;  2DJG A;  3I0A A;  4ZCB A;  3B2L A;  1HMS A;  1I04 A;  1O1U A;  3PH6 A;  2IZI A;  3NBX X;  2WEW A;  2CM4 A;  1SWL A;  3EBW A;  4ID2 A;  1E06 A;  5HZQ A;  2Z4I A;  1LIF A;  2OFA A;  4GZV A;  2QMI A;  4QAE A;  4QRL A;  5IO7 A;  4GGZ A;  4PJ2 A;  4YGG A;  5B11 O;  3UAQ A;  2FS6 A;  2RTP B;  3RE5 A;  1LIE A;  4FQB B;  2G78 A;  4O4O A;  3Q34 A;  1NQN A;  1TW4 A;  1KQW A;  4NYR A;  4OMX A;  3ZWE A;  3P6D A;  2AT8 X;  3ELZ A;  2FWV A;  1T68 X;  4XMC A;  3RDX A;  2X46 A;  3U9P C;  4U46 A;  1CBS A;  1SRH A;  4INN A;  1TOU A;  1BSQ A;  1GKA B;  1O8V A;  2RTC B;  1OPA A;  4NV7 A;  3RY2 A;  3STK A;  2C1S A;  3NPO A;  1B8E A;  3PH5 A;  5H9A A;  2AF5 A;  3EBK A;  2PY1 A;  4KH8 A;  2IFB A;  4QYP A;  4N7D A;  4GH7 A;  1TXL A;  1H91 A;  2MWH A;  1ERX A;  5LKE A;  1X8N A;  1EUO A;  1WBI A;  1FTP A;  2ANS A;  2OY1 O;  2RCQ A;  3CKF A;  5B27 A;  1E02 A;  1Y0G A;  2VFC A;  5B10 O;  1ERB A;  2CBR A;  4I3D A;  2FTB A;  2OL6 O;  3BU1 A;  2IZA A;  1EAL A;  2A0A A;  3UEW A;  2GH7 A;  1SWC A;  2R73 A;  4IAB A;  4YGZ A;  5CYB A;  3MBT A;  4M7M A;  4NP1 A;  1RXH A;  3S60 A;  1JJJ A;  1FE3 A;  4TKH A;  2RTR B;  1KT6 A;  1VWH B;  2C4I A;  2F73 A;  3HWD A;  3KFF A;  3C78 X;  3KFG A;  3CBC A;  5EZ2 A;  3VE2 A;  4OMW A;  3VG4 A;  2ZAG A;  3KQ0 A;  4BX7 B;  3T6F A;  1VWE B;  2W2B A;  1VWQ B;  2RTA A;  1Y53 X;  3FR5 A;  5L3Y A;  1NGL A;  1QY1 A;  4HPC A;  1LDO A;  2HMB A;  3ZUO A;  4UU2 A;  1PMP A;  1EPB A;  5F58 A;  5AJC A;  1BSY A;  1YWD A;  3QQ2 A;  4NLI A;  5LJK A;  5AJB A;  2P8G A;  1S2P A;  4DQ3 A;  1OBP A;  4I3C A;  3WJE A;  1KZW A;  5D47 A;  4OKA A;  2IZH B;  1X8P A;  2G7B A;  1JBH A;  5AQ6 A;  3RKG A;  4YMY A;  4KC8 A;  2FT9 A;  3ZW1 B;  5FFH A;  1N0S A;  4M6S A;  3VE1 A;  1SLG B;  4WFV A;  1N43 A;  2L67 A;  2Q2M A;  3HWE A;  1PEE A;  1MUP A;  4BX7 A;  1NP1 A;  4OEM A;  2RTM A;  4YKO A;  5JD2 A;  4OS8 A;  2IZL B;  1LUQ A;  1VWF B;  4ALB A;  5FEN A;  2AH7 X;  1O1V A;  2WEX A;  1K3B A;  4ARH A;  4EDE A;  3E3C A;  1LNM A;  3RZY A;  3S5V A;  4KT5 A;  1HBQ A;  2KTD A;  2RTJ A;  2AT5 X;  3APV A;  2YG2 A;  3FEK A;  4GRJ A;  4AYH A;  4KCA A;  4EFG A;  1SXW A;  2VDF A;  5HWZ A;  3OE3 A;  1DF3 A;  4CDF A;  1XKI A;  4KII A;  3ZW1 A;  1TVQ A;  4AZQ A;  4ORS A;  2OF8 A;  4Z28 A;  1A2D A;  1HQP A;  1OBU A;  2CM9 A;  4NLJ A;  4EKV A;  2A3F X;  5FQ7 E;  3WZN A;  2HNX A;  3T1D A;  4C5P A;  1RBP A;  1GT5 A;  1OPB A;  2X8T A;  3IFB A;  2IZG B;  3MM0 A;  3NQ9 A;  4RUU A;  3K3L A;  3RY1 A;  4CDC A;  2BS5 A;  2OFR X;  1A3Y A;  1JYD A;  3ZW0 B;  5HA0 A;  1SRF A;  3BDR A;  5IRU A;  2FS7 A;  3HWF A;  3IA8 A;  1KGL A;  4YFQ A;  2LKK A;  1NDJ A;  4QZU A;  4AZO A;  3B2K A;  2FHL A;  1ZNL A;  2Q2P A;  1HXL A;  3RDQ A;  4ALO A;  5F7G A;  3VU1 A;  5KIC A;  2GJ5 A;  1PBY A;  4ORR A;  1N9M A;  1JMX A;  1JMZ A;  3APU A;  4OEL A;  3STN A;  1VWC B;  1W4T A;  4O3Y A;  1D2U A;  1SRJ A;  5H9N A;  1U0X A;  4XMG A;  4BX5 A;  4R0B A;  1ZRY A;  4ML7 B;  3FDC A;  5FQ8 E;  5BVS A;  5HBS A;  1A57 A;  1MM9 A;  4IAX A;  4YDB A;  1VWJ B;  3APX A;  3FEN A;  4NNS A;  5LKF A;  5B5G A;  1SWS A;  4O4X A;  2MF6 A;  2FR2 A;  4BVM A;  1PM1 X;  4LKP A;  4MVE A;  3ZW0 A;  4TNN A;  3MX7 A;  4YBU A;  3ZZV A;  3D9W A;  3CMP A;  2LA7 A;  1UYN X;  4L1N A;  4HPD A;  4Y0P A;  5EEE A;  4YCH A;  1IFB A;  3G7X A;  4LKT A;  3U03 A;  5B3M O;  4DCB A;  2WPU A;  4KC7 A;  1QG5 A;  2FKJ A;  3HOE A;  1RLB E;  2HKD A;  1GM6 A;  3PPT A;  1SWB A;  1YWA A;  4I9R A;  4MVK A;  2QO4 A;  4IMN A;  2HZR A;  4GJS A;  4AZN A;  3FW4 A;  1CBI A;  4CPH B;  3GE2 A;  1LEL A;  3P6F A;  4GNY A;  1AVD A;  2HZQ A;  1NC9 A;  4Y59 A;  4ZR2 A;  1I4U A;  4GE1 A;  2EU7 X;  5EDC A;  1BM5 A;  3O2Y A;  2G5L A;  3WXQ A;  3KZA A;  4BX6 B;  3WYQ A;  1YUP A;  2MO5 A;  1ML7 A;  1X89 A;  3P6H A;  5AEO A;  1EII A;  4COT A;  3KVN A;  4GU8 A; 
#chains in the Genus database with same CATH homology
 4WHI A;  4ZHF A;  5BVT A;  1DC9 A;  4AZP A;  3VG7 A;  3NQK A;  2RN4 A;  3PED A;  3BX7 A;  3NX1 A;  4YFP A;  2JU3 A;  5H9L A;  3OBL A;  3FR2 A;  4YCE A;  1GX8 A;  4PSQ A;  1DZP A;  4YKM A;  4A1H A;  4QGV A;  1BSO A;  4ES7 A;  4GDZ A;  4XME A;  5HCC C;  4TKB A;  3EYC A;  4AW8 A;  4QNI A;  3CWK A;  2KTS A;  3DTQ A;  4O4U A;  1Y9L A;  5HZ6 A;  5HZ9 A;  2RD7 C;  3TGA A;  2A2U A;  1GKA A;  3P24 A;  3V8U A;  5FQ6 E;  4L3R A;  3KFH A;  1ZNK A;  1YP7 A;  1BBP A;  1KQX A;  1KOI A;  5JR8 A;  1X71 A;  1X8U A;  1FEL A;  3FW5 A;  1X8Q A;  1YWC A;  2LBA A;  2JMB A;  1MDC A;  1KT3 A;  3PEC A;  1BRQ A;  3Q6L A;  4IB7 A;  1VPR A;  1DZM A;  4DQ4 A;  1GGL A;  4ZJ0 A;  2O62 A;  1P6P A;  5CE4 A;  3NP1 A;  5H8T A;  2YMS A;  4OS0 A;  2WQ9 A;  3FA8 A;  3KFI A;  2HYS A;  1U18 A;  1VYF A;  4OS3 A;  1QFV A;  2KD2 A;  1QY2 A;  2CZU A;  4FBV A;  5HCD C;  1SY3 A;  4Y0R A;  4MIS A;  2XST A;  1E00 A;  1Y9T A;  1YP6 A;  1AB0 A;  2L68 A;  4NW4 A;  5HTD A;  2GTL N;  3P6E A;  4NNT A;  3I17 A;  1DFV A;  2XKL A;  3BLG A;  1AQB A;  3BSZ E;  1JV4 A;  4RUN A;  3NAD A;  2R74 A;  3FR4 A;  5D48 A;  2ALL X;  4ZHG A;  4O4S A;  3CBS A;  1YIV A;  1DZJ A;  1LKE A;  1Z24 A;  2ACP X;  3UEU A;  2GTL M;  5LJG A;  5HA1 A;  1I06 A;  3O22 A;  4LZV A;  3FA9 A;  3HWG A;  4FGI B;  4LQZ A;  5FAZ A;  4ZH6 A;  3C77 X;  3L4R A;  1OEJ A;  3BY0 A;  2W2A A;  4QGW A;  3ZUI A;  1ADL A;  4ZHD A;  3CQR A;  2WQA E;  1KT4 A;  3WOV A;  1L6M A;  1ZNE A;  2KT4 B;  4I95 A;  4O3X B;  3PP6 A;  4O9S A;  3TZS A;  1DZK A;  4IB8 A;  4UU3 A;  2QO5 A;  4LZU A;  4IAW A;  2M4L A;  4ZHC A;  1SY2 A;  1MX8 A;  1GT3 A;  4ZFX A;  3RWX A;  1CBR A;  1OEK A;  3S26 A;  1ACD A;  3H3I A;  4O3W A;  1G74 A;  4A8Z A;  4TLJ A;  3BRN A;  3EMM A;  4TQ2 A;  4ORU A;  4I3B A;  1BWY A;  5HTE A;  1AVG I;  2JW1 A;  1QY0 A;  3BU9 A;  3FIQ A;  4IBA A;  4D6B A;  4EEJ A;  3EM0 A;  3PQS A;  4ODD A;  5LJB A;  3WJB A;  4YBP A;  1JIW I;  2NND A;  4ON1 A;  1LIB A;  1LFO A;  4IB9 A;  2X8S A;  4I9S A;  3FMZ A;  2L5P A;  2L9C A;  1FEN A;  1IKJ A;  1QAB E;  5L8O A;  3FA7 A;  1SXX A;  2QM9 A;  2NP1 A;  4U8U O;  1BLR A;  2JU8 A;  4O3Z A;  1EIO A;  5F1E A;  4IB6 A;  4BQU A;  5EPQ A;  2F09 A;  3TF6 A;  2OVA A;  4XMF A;  3P6C A;  1EXS A;  1JYJ A;  5K06 A;  3OJY C;  2MHD A;  1EPA A;  1FEM A;  1BEB A;  2Q39 A;  4EQA C;  4U8U N;  1OEE A;  4XMH A;  3U0D A;  5C0N A;  1KT5 A;  3FEP A;  1JZU A;  4IMO A;  3RSW A;  3D4R A;  3LV4 A;  5L8I A;  3UEX A;  1AEL A;  3D95 A;  2RA6 A;  1SY1 A;  3SOT A;  3WJF A;  4ZHH A;  4A60 A;  4WBK A;  4I6S A;  4QZT A;  1KXO A;  3AKM A;  3VG3 A;  1CJ5 A;  2WSJ A;  3B2I A;  4U8U M;  3FLL A;  4CK4 A;  1A18 A;  4N7C A;  4Y0S A;  1KZX A;  1IKE A;  3DSZ A;  1EI5 A;  2W2F A;  2LB6 A;  3UEV A;  4CSB A;  1UZ2 X;  2FRS A;  2GTF X;  4U9C A;  2A2G A;  2RQ0 A;  2BLG A;  1HMT A;  3AKN A;  4HPA A;  1T8V A;  1B4M A;  2JU7 A;  2MJI A;  1KT7 A;  1S7D A;  4HFO A;  1GT1 A;  3TGB A;  3ZQ3 A;  1ALB A;  1G5W A;  1YWB A;  2NNQ A;  2WR6 A;  1T0V A;  3WJG A;  4ZGU A;  1MVG A;  1MX7 A;  2K23 A;  4QQ1 A;  5BYP A;  2POA A;  1I05 A;  2CBS A;  3NQ3 A;  3D96 A;  2OVD A;  5B29 A;  2BT9 A;  5EED A;  3TGC A;  2JN3 A;  1IIU A;  4WFU A;  3S5X A;  1ICN A;  1QFT A;  2WUT A;  5LJE A;  1G85 A;  5F6Z A;  2GC9 A;  5KHP A;  3VG5 A;  2GTL O;  1IFC A;  3FYF A;  3F8A A;  3JS1 A;  4GET A;  1QWD A;  2Z4H A;  2Q9S A;  2AL0 X;  4A1Y A;  4BOE A;  2ZAI A;  3P02 A;  2E4J A;  1PBO A;  1ZND A;  2X8F A;  4YGH A;  5D8J A;  2AT6 X;  5F6B A;  5LJC A;  4HPB A;  1IW2 A;  4O49 A;  4YDA A;  4CV7 A;  3HK1 A;  1SMP I;  2CZT A;  2AMM X;  4AZM A;  2FR3 A;  3VG6 A;  5KID A;  2LBV A;  1SXU A;  4ZH9 A;  2JOZ A;  4Y0Q A;  2QOS C;  1SA8 A;  1SY0 A;  1FDQ A;  4TJZ A;  2OZQ A;  5DG4 A;  2AKQ A;  2OFM X;  5LJD A;  1BJ7 A;  1JJX A;  2LFO A;  2DM5 A;  4ORY A;  3ZW2 A;  5H9K A;  2A13 A;  3FEL A;  2RCT A;  1ZNH A;  3WJC A;  2MM3 A;  2HLV A;  3RBY A;  1GT4 A;  5LJH A;  2WWP A;  2BHV A;  5IO6 A;  5D4A A;  1HN2 A;  3MVF A;  3GAQ A;  3QKG A;  4QGX A;  5BVQ A;  3O19 A;  3HOL A;  3ZI8 A;  3LHN A;  1GX9 A;  4U3Q A;  1LIC A;  3F6Z B;  2OVE A;  5L8N A;  3WJD A;  5DPQ A;  1LPJ A;  1HBP A;  3ELX A;  1HMR A;  3CQN A;  4MVI A;  4XMD A;  2QO6 A;  4JGL A;  1SXY A;  2R56 A;  3NX2 A;  1B0O A;  1NP4 A;  4GNW A;  3JQO A;  1OBQ A;  1S44 A;  1U17 A;  3CR6 A;  4YFR A;  1BRP A;  3APW A;  2AT3 X;  2X45 A;  1URE A;  4TKJ A;  2KW1 A;  3SAO A;  4HWM A;  1B56 A;  4ZGF A;  1R0U A;  3STM X;  2ASN X;  3OD9 A;  1TOW A;  3BX8 A;  4EXZ A;  2BS6 A;  3VG2 A;  1GXA A;  1D3S A;  1EQD A;  3JSQ A;  5EDB A;  4FBR A;  4K19 A;  3B2J A;  1VYG A;  3WBG A;  5HAE A;  1ICM A;  3VPJ E;  1G7N A;  3N91 A;  2ACO A;  3P6G A;  3FA6 A;  4GKC A;  4YH0 A;  1CRB A;  2N93 A;  2G79 A;  4ORX A;  5D45 A;  1LID A;  2OVS A;  4D6A A;  5HZ5 A;  4QYN A;  5HCE C;  2Q4N A;  1DV9 A;  2NNE A;  3C76 X;  1CBQ A;  1LF7 A;  4FBO A;  4NYQ A;  3F9D A;  3B2H A;  3NR3 A;  4GK9 A;  4MIR A;  4ORW A;  3D97 A;  1XCA A;  2K62 A;  4MVL A;  1EW3 A;  2FLJ A;  1X8O A;  3PQU A;  5IO5 A;  5HZ8 A;  4AZR A;  1ZNG A;  3HTY A;  1QQS A;  3BS2 A;  1E5P A;  2AT0 X;  3I0A A;  4ZCB A;  3B2L A;  1HMS A;  1I04 A;  1O1U A;  3PH6 A;  3NBX X;  2WEW A;  2CM4 A;  3EBW A;  4ID2 A;  1E06 A;  5HZQ A;  2Z4I A;  1LIF A;  4GZV A;  2QMI A;  4QAE A;  4QRL A;  5IO7 A;  4PJ2 A;  4YGG A;  3UAQ A;  2FS6 A;  1LIE A;  4FQB B;  2G78 A;  4O4O A;  1TW4 A;  1KQW A;  4NYR A;  4OMX A;  3ZWE A;  3P6D A;  2AT8 X;  3ELZ A;  2FWV A;  1T68 X;  4XMC A;  2X46 A;  3U9P C;  1CBS A;  4INN A;  1TOU A;  1BSQ A;  1GKA B;  1O8V A;  3STK A;  1OPA A;  3WVM A;  3NPO A;  1B8E A;  3PH5 A;  5H9A A;  3EBK A;  4QYP A;  2PY1 A;  4KH8 A;  2IFB A;  4N7D A;  4GH7 A;  1TXL A;  1H91 A;  2MWH A;  1ERX A;  5LKE A;  1X8N A;  1EUO A;  1FTP A;  2ANS A;  2RCQ A;  5B27 A;  1E02 A;  1ERB A;  2CBR A;  4I3D A;  2FTB A;  1EAL A;  3BU1 A;  2A0A A;  3UEW A;  5CYB A;  2R73 A;  4IAB A;  4YGZ A;  3S60 A;  3MBT A;  4M7M A;  4NP1 A;  1JJJ A;  1FE3 A;  4TKH A;  2F73 A;  1KT6 A;  3KFF A;  3HWD A;  5EZ2 A;  3VE2 A;  3C78 X;  3KFG A;  3CBC A;  3VG4 A;  4OMW A;  2ZAG A;  3KQ0 A;  2W2B A;  3FR5 A;  1NGL A;  1QY1 A;  4HPC A;  3ZUO A;  2HMB A;  4UU2 A;  1PMP A;  1EPB A;  5F58 A;  5AJC A;  1BSY A;  1YWD A;  4NLI A;  5LJK A;  5AJB A;  2P8G A;  1S2P A;  4DQ3 A;  1OBP A;  4I3C A;  3WJE A;  1KZW A;  5D47 A;  1X8P A;  2G7B A;  1JBH A;  5AQ6 A;  3RKG A;  4YMY A;  4KC8 A;  2FT9 A;  3ZW1 B;  5FFH A;  1N0S A;  4M6S A;  3VE1 A;  4WFV A;  1PEE A;  2L67 A;  2Q2M A;  3HWE A;  1MUP A;  1NP1 A;  4YKO A;  4OS8 A;  4ALB A;  5FEN A;  2AH7 X;  1O1V A;  2WEX A;  4ARH A;  4EDE A;  3E3C A;  1LNM A;  3RZY A;  3S5V A;  4KT5 A;  1HBQ A;  2KTD A;  2AT5 X;  3APV A;  2YG2 A;  3FEK A;  4GRJ A;  4AYH A;  4KCA A;  4EFG A;  1SXW A;  5HWZ A;  3OE3 A;  1DF3 A;  1XKI A;  4KII A;  3ZW1 A;  1TVQ A;  4AZQ A;  4ORS A;  1A2D A;  1HQP A;  1OBU A;  2CM9 A;  4NLJ A;  2A3F X;  5FQ7 E;  2HNX A;  3T1D A;  1RBP A;  1GT5 A;  1OPB A;  2X8T A;  3IFB A;  3NQ9 A;  4RUU A;  3K3L A;  2BS5 A;  2OFR X;  1A3Y A;  1JYD A;  3ZW0 B;  5HA0 A;  1KGL A;  3BDR A;  2FS7 A;  3HWF A;  3IA8 A;  4YFQ A;  2LKK A;  4QZU A;  4AZO A;  3B2K A;  2Q2P A;  1ZNL A;  4ALO A;  5F7G A;  3VU1 A;  5KIC A;  2GJ5 A;  4ORR A;  3APU A;  3STN A;  4O3Y A;  1D2U A;  5H9N A;  1U0X A;  4XMG A;  4R0B A;  1ZRY A;  4ML7 B;  5FQ8 E;  5BVS A;  5HBS A;  1A57 A;  4IAX A;  4YDB A;  3APX A;  3FEN A;  4NNS A;  5LKF A;  4O4X A;  2FR2 A;  4BVM A;  1PM1 X;  4LKP A;  4MVE A;  3ZW0 A;  4TNN A;  3MX7 A;  4YBU A;  3ZZV A;  3CMP A;  2LA7 A;  4L1N A;  4HPD A;  4Y0P A;  5EEE A;  4YCH A;  1IFB A;  3G7X A;  4LKT A;  3U03 A;  4KC7 A;  1QG5 A;  3HOE A;  1RLB E;  1GM6 A;  3PPT A;  1YWA A;  4I9R A;  4MVK A;  2QO4 A;  4IMN A;  2HZR A;  4AZN A;  3FW4 A;  1CBI A;  3GE2 A;  3P6F A;  4GNY A;  1BM5 A;  2HZQ A;  4ZR2 A;  1I4U A;  4GE1 A;  2EU7 X;  5EDC A;  3O2Y A;  3WXQ A;  3KZA A;  1YUP A;  2MO5 A;  1ML7 A;  1X89 A;  3P6H A;  5AEO A;  1EII A;  4COT A;  4GU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...