2A35A

1.5 a crystal structure of a protein of unknown function pa4017 from pseudomonas aeruginosa pao1, possible epimerase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
208
Chain Sequence
TPKRVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKALAEHPRLDNPVGPLAELLPQLDGSIDTAFCCLGTTIKEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSALGADAKSSIFYNRVKGELEQALQEQGWPQLTIARPSLLFGPREEFRLAEILAAPIAGKYHGIEACDLARALWRLALEEGKGVRFVESDELRKLGKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.5A crystal structure of a hypothetical protein PA4017 from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PA4017
total genus 70
structure length 208
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08732 HIM1 HIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a35A00
2G0TA 2B5VA 2QZZA 3D3EA 3H3FA 3JQEA 2YDXA 1B8UA 3PPIA 3JQDA 3CMCO 4TVOA 3U09A 3WR5A 1YJ8A 4RL6A 4MIOA 2VCYA 3Q2KA 1KETA 1V6AA 2VWHA 1DAPA 1X15A 4RF2A 1NHGA 1QSGA 4GAEA 3GOHA 1C1DA 5L7TA 1H0KA 5IF3A 4UEKA 4BGVA 1QRRA 5CPFA 3PDUA 3IJPA 1N7GA 1HXHA 1K5HA 4B3IA 5H82A 8ADHA 3S2GA 1DAOA 1YL6A 4B3HA 3JQ9A 3VZRA 1ISGA 2TMGA 1UXJA 2VHXA 1ZUD1 1VKNA 2YY7A 2WYUA 1WW8A 1HYGA 3ORFA 3F46A 4P8RA 4BQPA 3TL2A 1P0CA 1O6ZA 3NGXA 4JBIA 3QWAA 4NDNE 4ZRMA 2GGSA 3ZU4A 3GDFA 1JU9A 1W4ZA 3W6ZA 3FNHA 1P33A 4IDCA 1DB3A 1E6WA 1Y1PA 3ZNOA 4CMIA 3AI1A 4Y67A 3NTOA 7MDHA 2NVBA 1LEHA 1HL3A 1V3VA 1ARZA 5CG1A 3C7AA 1K6IA 5K9ZA 1JA9A 1YXMA 2OMEA 5DCWA 1IHXA 5F1KA 5FI5A 5DCUA 5A9TA 4RVGA 4PLFA 3RFVA 4EEZA 2RIRA 3EZLA 4G81A 2GSDA 2OHXA 4BNFA 4PZEA 2FR8A 5HA5A 1ZSVA 1UZMA 3WSVA 5U4QA 3GC6A 4ZICA 5C5IA 1YJQA 3NDIA 3D4OA 1XLTA 3ANMA 5J23A 7ADHA 1T4DA 2O7QA 1ZEJA 1T4BA 2EG9A 3AY7A 1ENZA 3QIVA 3RU7A 2P9CA 1YRLA 3EVTA 3FTNA 3E9NA 2W2KA 3GT0A 2HK8A 3GZNA 1Y7TA 2D4AA 2DM6A 1PS9A 1PGJA 1DOHA 2AG8A 3DBHA 3JYNA 3H9JA 4MKZA 3ZNNA 4GGOA 3H4VA 4JK3A 1IULA 3EAGA 4Z9FA 5TT0A 1VRWA 3DZBA 4M8SA 4JIGA 3W4KA 2EERA 2VZ0A 3PHJA 4IBOA 4LCEA 2NWQA 3WDSA 3OMLA 3UHAA 1D8AA 1F8GA 4C7KA 4F6LA 1P3DA 1NP3A 2GR9A 2PR2A 3BMNB 1YKFA 3JQCA 3SXPA 5F5LA 1ZK3A 2PY6A 1B7GO 4Z9XA 3DBHB 2Y0DA 1IZ0A 3WIDA 1UDBA 1GCOA 2IZ0A 2JCXA 2VHYA 3GY0A 4GBJA 1E1NA 4HADA 2YV2A 4OHUA 4NR0A 1ISHA 5L53A 3NV9A 1LDYA 1QYCA 1BW9A 1BXZA 1JTVA 3ETDA 3PJDA 4NNJA 1OAAA 3OETA 1HEUA 3M6IA 3DXFA 4W9NC 4OMUA 4R68A 4CQLB 3KEQA 3WOHA 2J5QA 1BGVA 3PK0A 3MJ4A 1GADO 1OC2A 3ANLA 1VC2A 3BMQA 3LU1A 3MCVA 1I24A 3ROKA 3ZWYA 3V2UA 4LSMA 1Y8QA 3GN1A 1C14A 1AN9A 1DPGA 3GG9A 4GX1A 3OP4A 2FSVA 4I9HA 4GX5A 4BL5A 2DLDA 1FDUA 3LSYA 3IIEA 2A94A 5HS4A 3PYXA 2J3KA 2EIHA 4TVBA 1GYPA 1NQ5A 1H2BA 3NEPX 4YAGA 1DDOA 4CLRB 4CR8A 4H15A 1N92A 2Q99A 3VPFA 3WJAA 4KDFA 3D5TA 1B15A 2JAHA 1ZSNA 4GQAA 4K6FA 4HFRA 1HE5A 2I9PA 2VYND 3JQ7A 1EMDA 4LRTB 1I36A 3GMSA 2BGMA 3T4EA 5KJCA 5IDWA 4Y98A 3K5PA 3KEOA 1DC3A 4ALLA 4W82A 3W8DA 2D8AA 5BSGA 1QYDA 2W2LA 1VL0A 1KVUA 3O26A 4CLHA 5TLSA 4CMBA 5U1PA 4NBRA 4J2OA 1B3RA 2CSUA 1RYDA 4XJSA 2DTXA 5TQVA 1LC3A 1V9LA 2VRCA 3D3WA 3H7AA 2ZJ1A 1DLIA 4M89A 3KVOA 1HRDA 3H9UA 4FBGA 2NUAA 1E77A 2VHZA 4RVUA 5DCYA 3RJ9A 2NU7A 1R16A 1K2WA 1N7HA 3GNSA 5IZCC 2OUIA 1NAHA 1EE2A 3UXYA 3F4BA 3LT1A 4B4OA 2Q2WA 1O94A 2J8ZA 3UCXA 2RCYA 1E7QA 1T2CA 3GHYA 1ZSYA 1XHLA 2YUTA 5EESA 3RUIA 1K3TA 4AJEA 1AHHA 4PRKA 1BW9B 5T8KC 1UUFA 1C1DB 3ETGA 4FN4A 3W6UA 4D41A 1LDNA 4YQZA 2WE7A 3FPCA 1R4NA 3IUSA 4NH4A 3TZHA 4BUCA 4WEOA 4BMVA 1EK6A 4DREA 5CEEA 2O2YA 4PZDA 3RIHA 4ZQGA 4DQVA 1YOVB 1WDKA 1PGOA 4B7CA 5TF4A 3KZVA 1AE1A 4IGEA 3ROPA 2AQIA 3VDRA 3R1IA 3PIDA 1UXIA 2VTEA 4HKTA 4FOOA 4AJ4A 3JD1A 5COAA 1EBUA 3RC1A 4XIYA 1LI4A 3O03A 1MG0A 1BDMA 4GWKA 5KVCA 4KUGA 4CLRA 4CMIB 2VHWA 1OMOA 1MC5A 1T2EA 3V1UA 1FF9A 4FDAA 4DIBA 2DUUA 3OQ6A 4B4WA 1EFKA 3NTRA 4M87A 5JMWA 1BWSA 1MFZA 3B6ZA 4IDGA 3VKVA 1WMBA 5FWNA 1NFFA 2FOIA 4A0SA 4OXYA 3RSHA 1RYEA 2VTDA 3COSA 4D3FA 4J1NA 1KVSA 2LDBA 4FJ0A 3F4LA 3RCBA 3DMTA 3L07A 3AUUA 4I5DA 5EQDA 3IKTA 2XF8A 1FDWA 3RI3A 3KM0A 2ET6A 1UAGA 1QP8A 2VHVA 4CL3A 2CFCA 3D64A 2E82A 5GY7A 1IYZA 3ZHXA 2O7SA 4YACA 1HZZA 2X9VA 2VYVA 3OA0A 1TT7A 4CMJA 3D4PA 1GQYA 3L6EA 4ZQFA 4EDFA 3WMXA 2R6JA 1SNYA 5G4LA 3INTA 1A4UA 1Y9AA 3QSGA 4D46A 4BNYA 1U2GA 2PNFA 4BO2A 1CDOA 1G1AA 4D79A 5JXWA 2DBZA 3QWBA 1PL8A 2OZPA 3LT2A 4K26A 2O50A 4QFCA 4BV8A 3I9NA 4YA6A 5LDHA 3S1LA 2J6IA 3V5NA 4CM1A 3RUFA 3GPDG 4R1TA 1TI7A 1U3VA 5KJ6A 3RUHA 3UW3A 3AFNA 3ENKA 3HDHA 3QWHA 5DN9A 2I6TA 4XGKA 4BNTA 5MGBA 4QO8A 1GUYA 4S1VA 1K6XA 4D42A 1DIHA 4L75A 2AXQA 4MVJA 2G17A 1EDOA 4CM4B 1HDXA 3TOZA 4BOYA 4AJPA 3OJ0A 5F3RA 4CM5A 4IQGA 2EJWA 4IIVA 3JQBA 4YJDA 4AJLA 3GH3A 1ZK1A 1LRKA 4L4SA 4N18A 3WS7A 5BNFA 2JCYA 1GUFA 2OXIA 3VAZA 4Q3DA 2XPCA 3ONFA 3PQEA 4CMGA 4I08A 2Q45A 5BSFA 3Q3CA 1ZO8A 2HMWA 4OAQA 5C7LO 1WNTA 3H3JA 1UAYA 4O59O 2GYYA 2QW8A 2WYVA 3VH3A 1HSZA 1GZ6A 3E1KA 1HLDA 5CDYA 4J91A 1X7HA 2JL1A 1WDMA 2CZCA 2VOJA 1OI7A 5DULA 2OP0A 3K73O 1PTJA 1HT0A 3BYZA 4K28A 1QR6A 3FWZA 5U9CA 4PG8A 1UJMA 1M6HA 2HJSA 4U5QA 1J0XO 2Q4BA 2ZB4A 2BI8A 1I33A 4K6CA 2CF5A 3ZN2A 5T64A 3IDSA 2E4AA 5A03A 1FK8A 4PG4A 3DHYA 5A1TA 1ONNA 1DBVO 5A3JA 2PKQO 5H83A 3LK7A 3PLNA 1Q7BA 3QWFA 2OO5A 1U5AA 4E5MA 1PJTA 4LW8A 4U0JA 4IPTA 3WTCA 1TT5A 1H6AA 3JTMA 9LDBA 1YBMA 5L4SA 3KYDA 2BI7A 3UKOA 1ZMTA 3GRPA 3PXXA 2QRJA 1J5PA 2O3QA 3BA1A 3RWBA 1VSUA 1NR7A 2P4HX 4PLHA 4R41A 3UGKA 1Y8QB 5C7OO 3PRJA 3PYLA 5JO9A 4EI2A 4MIEA 1PU2A 1F06A 1JKJA 3HHPA 1JWBB 2D2IA 2Q50A 4XQGA 4MOWA 3ICPA 1GV0A 1I3KA 3GFBA 1SBYA 4PG7A 3JV7A 3ONEA 3VTFA 3SLGA 4HV4A 5BQFA 4GKVA 3CE6A 2NVUB 3DZFA 1GEEA 4GVLA 2X5JO 1YDEA 3ZWBA 2ZTVA 2YHIB 3U4DA 4E12A 1DC4A 5EQFA 1DRWA 4XYMA 2GO1A 4HXYA 3TOXA 1E7YA 4E2ZA 3B70A 1NXQA 2VYVD 4OOEA 1OFGA 3MJSA 2Q1TA 3NJ4A 4IMRA 3IL2A 3D3WB 1HE4A 4WKGA 4YVFA 4FR5A 1M75A 3VPSA 4YT2A 1MC4A 5A5EA 3ZNPA 1A9YA 4II3A 4LRSB 5BT9A 4BMNA 2A4KA 2POQX 1L7DA 4W7HA 1PJSA 4JXKA 4L8VA 1DLJA 3U49A 4PLVA 4RZIA 3ZW9A 2CMDA 3I9MA 4HX5A 4FD3A 2AQ8A 4A10A 6LDHA 3ROQA 2BD0A 2ZIZA 4BNGA 3AUSA 2HMSA 4YWJA 4UVIA 4FB5A 2UYYA 4KTVE 3LT0A 4OXNA 3ZH2A 1BXGB 1GFSA 3JQAA 2RBEA 4UREA 2QQ5A 4DLBA 4PLYA 3RBXA 1NHWA 3M2PA 1NAIA 1ZEMA 3UH1A 3MWEB 2VUSA 3DBRB 4BO3A 3PLRA 3VZPA 3H9QA 4F45A 4CM8B 1Z75A 3JQ9C 4NJOA 4GMGA 3AM5A 1UXKA 3G1TA 4A03A 1R4NB 1ZK0A 3TZCA 8LDHA 1LJ8A 3BAZA 3FTPA 4YXFA 3I4CA 4UVGA 3SVTA 2PGLA 4EJ6A 5L7WA 2X86A 3EZYA 2OL4A 3HUDA 4BGUA 5THQA 4XR4A 4B7XA 4FJ2A 1N1GA 3E9MA 1RM0A 3ABIA 3WB9A 1F8FA 4YRBA 3QLJA 1EVJA 4N5NA 3PGJA 3DFUA 1DSSG 1NQOA 1XYGA 1YH3A 1M6WA 3STHA 1NFRA 3DTYA 5LC1A 4XR9A 1I5RA 2VNSA 4IDBA 1Z73A 1WPQA 2V6BA 1JKIA 1P74A 1ISFA 3TNLA 1KEWA 4A73A 1CIVA 1LDGA 2AEJA 1P0FA 4H7PA 5I9MA 3L4BC 2I67A 2Y1DA 2HDHA 2GERA 1EUCA 1RM5A 1GL3A 2DVMA 3GG2A 1PWXA 2RH4A 4KUEA 1C1XB 2Y99A 4U6QA 1PQPA 1LA2A 4R3WA 3K30A 3PHGA 2NNLD 1U4OA 1N1EA 1PR9A 4RPGA 5HBRA 2CY0A 3U3XA 5ADHA 4FGWA 4TKMA 3M1AA 5I7FA 2X7HA 4FFOA 3NX4A 3TFQA 3TJRA 3OECA 2UUOA 4ESOA 3F3SA 4UAGA 3V8BA 4ZVVA 5B4UA 5MDHA 3OQ1A 3U0BA 2EP7A 3HE3A 3ZWCA 4HFMA 3EY4A 3LYLA 4E13A 4CLOA 2B69A 4XRRA 5A06A 2WD8A 1VJTA 2UV8A 4IY1A 1DRVA 1YWGO 5AYVA 4BNZA 2P5UA 1D1SA 4PVDA 1E7RA 2UUPA 5I7SA 4FC7A 5ILOA 3I6QA 4FFLA 4DXHA 5A4DA 2AG5A 2BRUA 4ZQBA 1H6BA 2P4QA 3BTUA 4JJGA 4XQCA 4D45A 4I5EA 1T2FA 1MA0A 5TSDA 4R01A 4YBZA 4IDFA 1BRMA 4IQ0A 1XCBA 1EE9A 1KOLA 1Y6JA 2ZYDA 4O5OA 3WGZA 2Q1WA 2GRAA 3DBRA 2ILTA 4UEJA 4CM8A 3PIIA 2GZ3A 4QUKA 2ZCUA 3SJ7A 4BO0A 3AI2A 3AOEC 2QZ9A 3CXRA 3H65A 1E7SA 3A9WA 2XOXA 3AY6A 4J1QA 3U4CA 3JYPA 2QRKA 4BGEA 3KLPX 1VM6A 1A27A 3DZIA 2AQKA 1PJQA 1UZLA 4BKPA 4JJFA 2E37A 2GD1O 1PJ3A 1Q0HA 3GRKA 1D7OA 2F00A 3HFSA 1N9GB 1NQTA 3VH4A 4NBUA 1E6UA 1JKFA 1WVGA 2EW2A 2I66A 4BNKA 4F3YA 3OICA 4IS3A 4E32A 2HKIA 1KC3A 1X7DA 4RLHA 1FXSA 5KVVA 4NFHA 4QX6A 4XIJA 3ZWNA 1A72A 5JAZA 4TZKA 2ZTMA 2Z5LA 2B0JA 2WMDA 3JQ6A 1A7AA 2EGGA 4RZHA 4WE3A 5G0UA 5CEFA 3RBZA 1B2LA 1J6UA 3DL2A 2CDCA 5BR7A 3UFXA 1ADFA 1RKXA 3H2ZA 3L77A 4QTZA 3W8EA 3WX0A 2P5YA 4ILKA 1HYHA 3WYEA 5AXAA 5H81A 1ENPA 4PN3A 5L45A 3GR6A 1HF3A 5A9RA 3WGQA 3LZ6A 1DIGA 4R51A 1FDSA 2JD2A 4C7JA 2WDZA 2NV6A 3KSZO 4D44A 2GASA 5IN4A 3FI9A 1Q7GA 3C1TA 3RD5A 5TRTA 5JY1A 1YQDA 4CJXA 4JJIA 1U2DA 2Z95A 3JD0A 4KP7A 3D4NA 1MXFA 4U6SA 4IGFA 1WWKA 2AMFA 1QV6A 4WASA 4CL8A 1H93A 1P1RA 1PQUA 1G0OA 1KBZA 3GK3A 1U3TA 2I76A 4XWYA 1T24A 2A92A 2DTDA 2FP4A 1ADCA 1EFLA 3PJEA 5FYDA 1BG6A 1BXGA 1R66A 3JQAB 2CVQA 4DL9A 1NPYA 2C20A 3FNEA 4NK5A 2ZQYA 2QHXA 4TZTA 4YR9A 5I9LA 2CNBA 3JYQA 1YOVA 3F47A 2EHDA 2FZEA 1WXDA 3EYWA 4ZQHA 5CDGA 1KVRA 1GPJA 1S6YA 4WLUA 1XSEA 4DWVA 1HDYA 4BO8A 1E1LA 5G0TA 2HCTA 4CODB 3PGXA 3TSCA 4AJNA 5G0SA 5TGDA 4NFYA 2WEKA 4PLZA 1N9GA 2B5WA 2DT5A 4BNMA 2OOSA 1R37A 3CIFA 2NQTA 2F1KA 1HDZA 1I8TA 1XR3A 5JLAA 2ZTLA 4YT4A 3ZU5A 4YJGA 4BO4A 3TZKA 4CMAA 3JD3A 4I9NA 4NG5A 5L4NA 3PFFA 3E8XA 5B4TA 2AEFA 2WWRA 3SX2A 2Q1SA 3H5RA 1YB5A 3DBLA 4B4VA 3F9IA 2HO5A 1BXKA 4NIMA 2IYOA 4CMCA 5KJFA 1SEPA 4N5LA 3I5MA 4E5PA 3HSKA 4L9RA 2PZMA 3U4IA 1E3IA 2V65A 1SMKA 2BMAA 3C1AA 2G82A 4PLWA 2ZKLA 2GN9A 3UVEA 3ZV6A 4B7UA 3JQ8B 1CRWG 3RKRA 3INGA 1PJ4A 5IG2A 1K89A 4R9RA 1GV1A 4RV9A 4FCCA 2NTJA 3QVOA 3ZW8A 1IL0A 2CD9A 4M86A 4L4XA 2HQ1A 4D3SA 1PGPA 2PFGA 3PWKA 2HU2A 3NTQA 3GPIA 1ID1A 2C29D 3QHAA 4MVJI 3JQ8A 1C0KA 1FJHA 1A4IA 3ZU2A 4J1SA 2IDZA 3I6IA 3A14A 4ALJA 4YPOA 1DJNA 2YV1A 4RDIA 2HMVA 5I8ZA 3QQPA 4R9SA 4D7AA 2EEZA 1QG6A 3WYBA 1PS0A 1C3VA 4IJKA 1LLUA 2X0JA 1VSVA 4CM9D 1LU9A 1XQ6A 4CR6A 4PGFA 1E5QA 3WNVA 4TWRA 1V35A 4RJTA 1KEPA 2X1HA 1DHRA 3ENNA 1TXGA 3FBGA 3WFIA 5KNLA 4BKQA 3W4IA 4I1IA 2HJRA 1MX3A 1LSUA 4AFNA 3H6KA 1ULSA 3WGYA 5G4KB 5IZ4A 1PL7A 2Y1FA 2X8LA 4BIIA 3WFJA 5IFLA 2PKRA 3L9XA 4CMKA 1UZNA 1DFIA 1GYRA 5TX7A 3TZQA 5IDYA 4RO0A 1XWFA 5KVSA 2FPIA 3A4VA 1IE3A 1PJ2A 5ICMA 4UULA 3JCZA 5F5NA 3QE3A 4BKRA 3IP3A 3ZV3A 2P9EA 2QX7A 4A5OA 3EUWA 3MJCA 1YBAA 2H1SA 5TNXA 1P45A 2P9GA 4TQGA 3INRA 4R3NA 5IXYA 4UVDA 3AOGA 3BMCB 1LSJA 1GQQA 1LTHR 2VUTA 4OM8A 4YRAA 3ROMA 4B3JA 3AWDA 3GLQA 1WZEA 2CVZA 3MZ0A 4CLOB 3HDJA 2LDXA 1LLDA 1RPNA 2QRLA 3CZMA 4XDZA 2PWZA 3GAFA 4DQUA 4PRLA 2BHLA 4RORA 3C24A 1R15A 4ND2A 3VVBA 3NUGA 4KTTE 2I65A 4MVJE 2YV3A 1XGKA 1A9ZA 3BMCA 3IP1A 4MIYA 3C7CB 4Z9YA 1ENOA 1P9LA 3ONDA 5JBIA 1JVBA 1ZFNA 4L4RA 4BO6A 3KYBA 5JC1A 3NDJA 1KS9A 3K6JA 1NASA 4UEOA 3QA9A 1YQGA 1HKUA 4UUMA 4UVHA 4J9VA 1Y9EA 3FSRA 4H3VA 1ZXLA 4QQRA 3I9OA 1XELA 2GF2A 4UVEA 1N2SA 1MG5A 1EUDA 4ONEA 3PJFA 1LBEA 4IUYA 2EV9A 3ETEA 2O23A 4QT0A 2QYTA 4CUJA 2ZJ0A 2PH5A 3NKLA 2GN6A 4D0RA 1F14A 3WICA 3I83A 1DC6A 1Z6ZA 4R16A 1U8XX 1XA0A 1XU7A 2PZKA 2BFMA 5IZCA 4AJHA 3DONA 3E48A 5F1OA 5KTKA 3WQRA 1VJ1A 3DHEA 4FQ8A 5I8WA 1I01A 1X13A 4EJ0A 1EUZA 4XKJA 4E4YA 1SZJG 5I9NA 2J5RA 4NQZA 1ZIDA 1Y5MA 3GMDA 3PZRA 1T2AA 4HFJA 3PJGA 4MVJM 3MWDB 3JYOA 2JKVA 4LVCA 3OFSA 2X0NA 1KY4A 3WBFA 4XD2A 4PG5A 4RPJA 3AU8A 1B0AA 5JCJA 4MDHA 4P38A 4TROA 1PZGA 3T7EA 4YCAA 4D3DA 5JE8A 3HDQA 3PWSA 3WGOA 4Y6PA 4LGVA 5GZ3A 3C1OA 3H9EO 4W4TA 4OGWA 1M66A 2HAEA 3AUAA 4EGFA 5AQ1A 4E21A 1PX0A 3RKUA 1U3UA 3QW2A 2C5AA 3RASA 4WNIA 3E5RA 3AFMA 5ITWA 4YYZA 4AICA 3DR3A 4MVJP 1SAYA 3B1FA 4ALMA 4E30A 1YL5A 4YJFB 4PCVA 4NBTA 4MVJF 5CEJA 2O3RA 1KVTA 2ZB7A 4IM7A 3DZHA 3JD2A 3S2EA 1IPEA 4NJMB 4ZN6A 4GL4A 2RH8A 3EDMA 2G1UA 4N7RA 3GUCA 4OIMA 5B12A 5F21A 2WYWA 1X0XA 1U7HA 3CMMA 1ZH8A 4WPGA 1P1JA 1GTMA 3OHSX 5LCXA 1YDWA 4ZGWA 5JNLA 4I8XA 4YJFA 3JSAA 2J3IA 3N7UA 3R3SA 4JP2A 2OORA 3UAGA 1T1SA 1GR0A 4FS3A 3VPGA 3UCEA 4FOSA 3GGPA 1TT5B 1X7GA 1U4SA 5AVOA 3RFXA 1LLCA 3CZRA 3KYDB 4L73A 5COQA 1XKQA 4WNCA 1KVQA 4MVJH 4OQZA 2FSSA 3HWRA 5JDIC 1HE3A 1XDWA 4RVHA 1VLLA 3MTGA 1LC0A 3P2YA 3GF4A 4XYLA 1GZ3A 2NLOA 3EMKA 3L4BA 5BNIA 1DFGA 3K8ZA 5FEUA 4Z0TA 4IMPA 5GZ1A 3WIEA 4BNNA 4E2WA 2SCUA 1TB4A 1T25A 1PGQA 4J4HA 2Y0EA 4YJGB 3DO5A 3RFTA 4BKOA 3KLMX 3SLKA 4Z6KA 1VJ0A 2EWMA 2IXBA 5CP8A 3DBLB 1HDGO 4IXTA 2NVUA 1L1FA 5DBIA 1DXYA 2QG4A 2JCVA 2B83A 4UUOA 2YJZA 3B20A 3RVDA 5L95A 3NYWA 3EW7A 5JYDA 2ZQZA 1GYQA 1UXHA 1N5DA 5JDIA 1CQIA 1HE2A 3N74A 1GQ2A 1B8PA 4LMPA 3F1LA 4DIOA 3WTBA 5JAIA 3OIFA 4NBWA 5DP2A 1UH5A 4PLPA 4FFRA 4EZBA 4Z0HO 4XB1A 2W2LD 4D43A 3AY3A 2IEDA 1YBVA 1R4MA 3WQQA 2FPPA 2FPGA 3DOJA 4DC1A 4IIUA 4INAA 4RPLA 2EGHA 3BTOA 4GPD1 4R69A 1E3WA 1F0YA 3DAGA 3C85A 1RM4A 4Q3NA 4EJMA 2PA3A 3NRCA 1RWBA 4EBFA 1CETA 3K2BA 3QVSA 1I32A 1JVSA 1ZNQO 3HB4X 1O5IA 5COBA 1SOWA 3UUWA 2BF7A 5A5FA 2O3JA 4XB2A 3T7CA 3UCFA 4BMSA 3PWZA 3VZSA 4OJNA 5DNAA 4W7IA 1U8FO 5CDTA 3DTTA 5K0ZA 1V0JA 2HLPA 1BHSA 1PS8A 5I7EA 1ONOA 3WMWA 1IZ9A 5HTOA 4HBGA 4UUNA 2XXBA 2C2YA 2FR0A 3PYMA 1GY8A 3U62A 1LLQA 2BLLA 2VQ3A 5G4KA 3LLSA 3KYCA 2Y1CA 4OSOA 3RU9A 4GWGA 2YFQA 3HZZA 4NMHA 3A06A 2R00A 4R54A 1YS4A 2YDYA 4RVDA 3OSUA 3BMOB 6ADHA 4J4BA 3D0OA 2OP1A 3ST7A 1C0LA 2GDZA 5KJEA 3ZCXA 3NT2A 4O63O 2Q2QA 3ASUA 4NU5A 5ITVA 2Y67A 4WOKA 3ITKA 1I2ZA 1LNQA 2YZ7A 1C0PA 1H94A 2Y93A 1HYEA 3VC7A 5BSHA 4I5GA 2JAPA 3G3EA 3O9ZA 1YVEI 4B4UA 4YT8A 1PJLA 1B8VA 2DAPA 3IKVA 3X2EA 3VZQA 1E5LA 3WBBA 1H6DA 2IXAA 3I9KA 4L76A 2FMUA 3CKYA 4BV9A 2J3JA 1KERA 1X1EA 3AJRA 4DTIA 3G17A 1QYXA 2FWMX 4DGSA 1P1KA 2FHSA 3FBTA 1CYDA 3AM4A 3TZ6A 3PQFA 4URFA 5ILGA 4ALKA 4CV0A 4DPMA 4GSLA 4ND5A 2VYNA 4JGBA 4Q3AA 5TS3A 1QLJA 4Y8VA 1CERA 2YHUA 4RPKA 3OH8A 2FZWA 1GU7A 1U5CA 4BNXA 4BHTA 4Q3BA 4FIZA 2BFOA 3DAPA 3KBOA 3LC1O 4OH1A 4CPDA 1PR3A 3OJEA 2EKPA 2AEMA 1PWZA 4J43A 2I3AA 1E92A 5K6AA 4X54A 3GEDA 3KOUA 1Y8RB 4DA9A 1AXGA 1HDRA 2AA3A 3QVTA 4M49A 3WWYA 1X14A 2PTGA 4CMEC 5A9SB 2ZTUA 3VPXA 1ZK2A 3FCOA 3CH6A 4NPCA 5JFOA 4YAJA 4N5MA 4ITUA 4LSWA 4DVJA 1LQTA 4B8ZA 5CFZA 1I3MA 3RUDA 3K92A 4XX0A 3QJ5A 2WE8A 3ICCA 4RVFA 4WCFC 3JQFC 3FNGA 1ORRA 5A9SA 2OFPA 3RC2A 4OXKA 2G76A 3CPSA 5IJZA 3S2IA 3GDOA 5I7VA 3Q6IA 4YDRA 3I23A 1E0DA 2EJVA 4MP8A 5ES3A 1LSOA 4R5MA 2E48A 4WJZA 2V7PA 1BVRA 1FDVA 4LK3A 2BGLA 3NT5A 1F12A 1ONPA 1P31A 3KB6A 4FFMA 1QV7A 1I10A 3PDJA 4RPHA 4RQUA 3I52A 5TJHA 3DWFA 3BIOA 3R6DA 3TF5A 3KHUA 5LDGA 2AHRA 3E03A 2X22A 4YTEA 4ZU3A 2QYSA 4UUPA 4ZJUA 1UP4A 4MKRA 4WLEA 4AG3A 1E6EA 4ALIA 4CMEA 1YE3A 3OM9A 2DKNA 1VKOA 1NM5A 3MJEA 4RLSA 4GLOA 3EC7A 5TT1A 3B1JA 3HADA 4ND4A 3OEWA 2VRBA 3SC4A 3QY9A 4II2A 3TWOA 4TRJA 3RAJA 4J90A 4DQXA 2FR1A 3KUXA 1TA4A 3ZI0A 3KRTA 2Q3EA 4J4TA 2P2SA 3OEYA 2Q2VA 4M1QA 3GVPA 3RQSA 4WUVA 2EF1A 2RHRA 4J9UE 4JROA 3C8MA 4BO9A 2X9GA 3E9QA 4WGGA 4XA8A 1Q1NA 4WLOA 4NJMA 3RBVA 3DB2A 4TKLA 1EEHA 4I9UA 4MJLA 3RUEA 1BSVA 3DHNA 1QKIA 2NTVA 4FSHA 1ADGA 3BHIA 4GH5A 2HRBA 4GMFA 3DAFA 3Q2IA 1W8DA 4J7UA 1BVUA 5ENDA 1M67A 5JO0A 1NVGA 4CV1A 3O4RA 3PHIA 5IN5A 3GHHA 2V6MA 1CEQA 3IJRA 2VNAA 1M76A 5KOIA 2OGUA 1NR1A 4XYEA 2D1YA 1DJQA 4B79A 5BNTA 5DOZA 4J2HA 4YJHA 2PD3A 3IS3A 4KZPA 3AM3A 5JC8A 3ZWXA 3WWZA 4QFDA 5JDCC 3UOGA 2B4QA 1DO8A 1IOLA 3GQVA 3I9JA 5B4VA 4WLFA 4EYEA 3X2FA 3W1VA 3BMNA 4ND3A 1S7CA 4Z3DA 1K6JA 3G1UA 1D3AA 1M2WA 4HP8A 1HWYA 3SEFA 2UAGA 1VL6A 1GEGA 2PK3A 3ANNA 3GEMA 3O8QB 2Y1GA 1NNUA 1ULUA 1NWCA 4EEXA 5ENVA 1Q2XA 2WD7A 4J7XA 4E2XA 2VN8A 2CVOA 3GNTA 4TRMA 2NACA 3L9WA 4XQEA 2W98A 2JFHA 3FPLA 1C1XA 1RM3A 2NU9A 1CQJA 1UP7A 2NU6A 1KEVA 1TEHA 3Q9NA 5DOVA 3WGTA 1Y81A 3P7MA 4FW8A 1ZK4A 2B36A 4YAEA 4M55A 5DZSA 4CLXA 1O89A 3EK2A 4KWHA 4IJUA 2BELA 3ZWWA 3MOGA 1WLYA 2PD4A 4JP3A 4CM7A 5IAAA 1NBOA 5EN4A 1PZHA 4RCVA 4DIFA 1R4MB 3OF2A 2I5PO 1EQ2A 4FGSA 4O6VA 4TMFA 4E6PA 1JQBA 2XXJA 3RROA 2X4GA 4HNHA 5JW6A 3IMFA 4EUHA 1UP6A 1PJBA 2H63A 4BNVA 1FDTA 4W6ZA 1KIFA 4WECA 1EK5A 3UN1A 4I5FA 4YT5A 1P1HA 3WXBA 2DQ4A 4FPXA 1NYTA 3IC5A 1U7TA 2GLXA 1E1MA 5AXDA 3V1TC 3H5NA 1ZVMA 3E6AA 2GZ2A 4BO7A 1P44A 1I0ZA 5L40A 1E7WA 1K0UA 1U3WA 4EUFA 4EITA 2DU8A 2X23A 2VWPA 1OOEA 1X0VA 2XAAA 3GA0A 4IDDA 3MOIA 3VHRA 2W8ZA 2JFGA 2VWGA 3H8VA 5L3ZA 4F6CA 1IPFA 2J5KA 2NQ8A 4J6FA 3KYCB 1E7MA 1VE9A 4XDYA 4JX8A 1V8BA 4CM3A 5A04A 4GI2A 3BHMA 3HG7A 3JQGA 2CUKA 2GPTA 3GGGA 1PEDA 4E5KA 1E3LA 3ZWVA 4OSPA 3G49A 3ZHZA 4YRDA 1Z45A 2X0IA 4KOAA 2O48X 4GSKA 2GN8A 3PVZA 3SJUA 1HZJA 2B37A 1PQWA 3TFOA 4DRYA 4E3ZA 1W6UA 1QLHA 4ZRNA 1RJWA 4OQYA 1DFHA 3E5MA 2HMTA 4JBHA 5TC4A 1O8CA 3ULKA 4BNJA 4MINA 3EGOA 2O3TA 4YAKA 3QWIA 5JAQA 3ZV4A 2HK9A 2PH3A 4FFPA 3DOCA 3OJLA 3NDRA 3QVWA 2GCGA 4ZHSA 1EBFA 3IQDB 4HY3A 1U28A 2JD0A 3P5SA 2C82A 3PHHA 4KQWA 5CG2A 5A02A 4WLNA 4AJOA 4Q3EA 5ER9A 4C4OA 1IUKA 4QSMA 2QIOA 3ZV5A 5TIIA 2EP5A 2X0RA 4MPDA 4CQMA 4PLTA 3E82A 2VUUA 1SC6A 3S8MA 3VKUA 4CV3A 3ITDA 1NWHA 1A5ZA 1TVEA 3ASVA 4FJ1A 3GVCA 2AQHA 2DPHA 3U5TA 2NADA 3IUPA 2C0CA 2P68A 2IZZA 4LCJA 4OL9A 1XG5A 1YB1A 5JYEA 2CF6A 3VPHA 2Y1EA 1LRLA 2JHGA 3M1LA 4NI5A 2X5OA 5JS6A 3BZUA 1QYVA 1Z7EA 1HSOA 3AI3A 3NJ8A 4WCDA 2P91A 1HLPA 5HWSA 2VZ9A 2HSDA 3OQBA 1JN0A 4KWIA 3ADOA 1B16A 2C54A 3GNQA 5G2OA 3K2EA 4J16A 3H2SA 5L9AA 3DEYX 4BVAA 1HTBA 3PEFA 1D4FA 3LQFA 3WYCA 5FF9A 4OO3A 3WGIA 2BH9A 1QXSA 2W4QA 3UICA 3CSDA 4BNUA 1ZKMA 3WGHA 3DDNA 4R4JA 4CUZA 1QORA 4TRRA 1VL8A 4KMSA 4MP3A 4DBZA 5EJ2A 3KV3O 4BO1A 2DPGA 3DBVO 4OYRA 4QXMA 1W0CA 4AL4A 2IODA 3MJTA 5C7IO 4J7CA 4ROSA 1FMCA 3LF2A 5KJ1A 3LLVA 2V6FA 3FN4A 4IZIA 3TDKA 5C3MA 2PD6A 4XGNA 1LSSA 4AJ1A 1LX6A 2ZCVA 3RUCA 4JN6B 4H16A 4HUJA 4CUKA 1IHYA 1MP0A 1LQUA 3G0OA 1MFPA 4EUEA 1E3JA 1CF2O 1E3EA 3TQHA 1UDAA 3GFGA 3VOSA 3F1KA 1ZCJA 4IDAA 4RVSA 1XQ1A 3QRWA 3VH1A 1ISJA 3CEAA 3WSWA 3T4XA 3GN2A 1GDHA 3Q11A 1GZ4A 4IJVA 5GZ6A 3HJAA 4CM9A 3JD4A 4DMMA 4PFJA 1XIVA 2YQ5A 3BHJA 1SPXA 1R0LA 4CM4A 3ON5A 1Q0LA 2BFPA 5CAEA 3CINA 4E0BA 3KSDO 2C59A 1E3SA 3ADPA 3QV1A 4A26A 1SOVA 2HUNA 3RJ5A 3AW9A 2YFHA 5DBFA 5F1PA 5C37A 2BKAA 1DIBA 2EKQA 2O4UX 4GKBA 3L6DA 4CR7A 4OKNA 2VWQA 1N8KA 1QYWA 4JBGA 4TRNA 1XEAA 3TRIA 1PIWA 5L4LA 1E1KA 2EKLA 4A7PA 4YJHB 2HRZA 3FNFA 3F5QA 2PGJA 1DRUA 2R2GA 1T1RA 1I2CA 2IZ1A 4BNLA 3C3XA 3K31A 3DZKA 5CDSA 3AUTA 1B3BA 1Z7BA 5AXBA 3Q9UA 4BNIA 3MEQA 3MJVA 5KIAA 4E2YA 1LDBA 2B35A 2WTBA 1NX6A 2Y1OA 4QO7A 4E31A 3MTJA 1I30A 3GZNB 3I9LA 4XQ9A 4DLLA 3JQBC 2PKQP 5EERA 3GVXA 3UF0A 3P2OA 3PQDA 2GZ1A 4RF4A 3ZWAA 4IINA 4IQ8A 3R3JA 3U9LA 3ZU3A 3LT4A 4IJWA 5A3VA 3L4SO 4DYVA 1EVYA 5FI3A 4LISA 1G0NA 3L6OO 4U8GA 4LVUA 1WP4A 5T57A 3I3OA 3I4FA 3DZJA 4AJKA 1HDOA 4DC0A 4ZQEA 4G65A 5JCXA 4XJTA 2EW8A 2CDAA 1UDCA 5JPIA 4Y9DA 2ZK7A 2X58A 1H5QA 1EVZA 3S2FA 2AW5A 5A05A 4LMRA 1AXEA 4DPKA 2UDPA 2WJPA 2TMDA 2JFFA 2ZATA 5AOVA 2Y0CA 5IDQA 2VT3A 1PJCA 3ZWOA 2OBYA 4PLCA 5EIOA 4R1SA 4DYDA 1A7KA 4HWKA 1IB6A 4P4NA 4XYGA 5HS6A 4CM6A 3WLFA 4Z0PA 3H9GA 1DHTA 3LVFO 4B8WA 3NGLA 3RC9A 2B4RO 5CPBA 1NPTO 1H6CA 4JQCA 2DTEA 4DLAA 2NVWA 1B26A 4BB5A 1MLDA 1R0KA 3FD8A 3DMYA 4DUPA 4L74A 4BO5A 1LDEA 5KKAA 1EDZA 2YHIA 2C2XA 3OIDA 4JNKA 2C5EA 4Q9NA 4WOJA 4YEDA 1LDMA 1YQXA 3DOOA 2Q4EA 3D1LA 2DBQA 2ZYGA 4XCVA 1MV8A 2NM0A 4OKIA 3PTZA 4EW6A 3R0IA 4U0KA 1Y5RA 2AE1A 4DMLA 1JDJA 5ER6A 5DBGA 3ZGYA 4GGPA 5B37A 1HETA 2H6EA 3PFWO 2BGKA 1EVIA 3V2HA 1LRJA 3JYLA 4IS2A 4GX0A 4NBVA 4PG6A 4ND1A 1O0SA 2VT2A 3RUAA 3VH2A 3V1YA 3L0DA 3JQGB 3OIGA 1JAXA 4ZA2A 1J49A 3ZHBA 5EINA 1L7EA 3BTSA 4CV2A 4ZD6A 3ZWMA 4WEQA 1VPDA 5G0WA 4J0EA 1KC1A 3GEGA 4FFNA 3TL3A 2PZLA 4IXWA 1BDBA 4KUHA 3HDYA 4XRGA 1ML3A 2PGDA 4GVXA 4M54A 4CMHA 4RQTA 1ZMOA 1AGNA 3GAZA 4PLGA 4P4GA 1OBFO 4Q39A 4P4LA 3TPCA 5JDCA 1MUUA 2DBVO 4MO2A 1ISMA 1AUPA 2JJYA 4BB6A 4MKXA 2D5AA 4PIVA 5KCZA 1SB8A 3KETA 2WSBA 3GUYA 1Q0QA 2E6UX 3CUKA 3BTVA 1Z74A 2YW9A 3QVXA 2J3HA 2ZB3A 2D3TA 3Q1LA 1A71A 1W73A 4J1TA 1SO8A 1V3UA 3ZNQA 4G2NA 1EQUA 1BTOA 1DEHA 1PSDA 4JCOA 4HFNA 1GD1O 1R6DA 3GGOA 5L51A 5JAMA 3HNPA 3OJOA 1JW9B 3PZBA 1IY8A 3E18A 2JHFA 1H9BA 3FR7A 4Y6SA 5BSEA 1ZW1A 2DFVA 3HN7A 4LN1A 4R1NA 4YAIA 4K9DA 3K9QO 1ZZEA 2X6TA 2YYYA 3EVNA 3CTMA 3K96A 1ZJYA 4XYBA 1F17A 3IOYA 1UR5A 2A35A 1GCUA 3WLEA 4QECA 2G5CA 1ENYA 1U9JA 4NU6A 2D5CA 3C7DB 1LXCA 4NZ9A 3RC7A 1PZFA 1ZJZA 1P1IA 2UVDA 5JSFA 3FHLA 4BQRA 1WMAA 2E49A 3I1JA 3JQAD 2NU8A 3WQSB 3N58A 5EL0A 3DQPA 3WGGA 4D0SA 5T67A 3LF1A 4XZ3A 3SC6A 3BXXA 3DZGA 2V6GA 4BNHA 4BKUA 4J3FA 4N54A 1NQAO 3O8QA 1QMGA 1B14A 1X1TA 2O3UA 4AJIA 2FRDA 2FN7A 2IYPA 5G0VA 1NPDA 2HK7A 2VZ8A 2DC1A 3P19A 4XGIA 2WD7B 5FFFA 4Y6RA 2O4CA 3PI7A 2IEBA 4DPLA 3D7LA 4YQYA 2HMUA 1CWUA 3JQFA 1WZIA 5HRUA 4BS9A 1JLLA 3LC2O 4RGBA 5GMOA 2DUWA 1ADBA 3HN2A 1SB9A 3ZDFA 2A9FA 4F46A 2O2SA 2D59A 2B4TO 2VRCD 1KYQA 3D5QA 2C07A 3EHEA 3FR8A 5EMHA 5KWEA 3GZ4A 5T8KA 3IAHA 4J0FA 4P22A 1EZ4A 3W4JA 4R5HA 1Q7CA 2NSDA 1YO6A 4A27A 4E5NA 3ZZNA 2C7GA 1DIAA 3B1KA 4CQLA 1PZEA 2Z1MA 3WJ7A 1JWAB 4G5HA 1ZXBA 2FY8A 4CLDA 1H2HA 3U4HA 4Q3CA 1MXHA 1LUAA 5AXCA 1R12A 4WLVA 2Y05A 1J4AA 5KVQA 3WNQA 4KQXA 2BFAA 3HFGA 4AJ2A 4WCFB 5HM8A 4W99A 4U7WA 3V2GA 2W90A 5T5QA 3VTZA 4DBVO 1I3NA 3LC7O 5CDUA 4IZHA 4AVYA 1P1FA 1H9AA 3QP9A 1MGOA 1Z82A 2Q1UA 3PHLA 3ZWPA 2AE2A 4MP6A 4RF5A 1E3WB 4BGIA 3H5AA 1C0IA 3S55A 1KY5A 2X5KO 3F5SA 3GVIA 1WAMA 3AU9A 3NAQA 5THKA 1ZBQA 3OBBA 5CHEA 3AK4A 1R0SA 2RHCA 1GAEO 3JQ7B 1P77A 4KDEA 4FC6A 1YB4A 4E33A 5KKCA 4O1MA 2Z1NA 3FRJA 2VOEA 4L0QA 3GVHA 4NFSA 1AHIA 1T2DA 1NTOA 4GX2A 2IRWA 5JCJD 4TSKA 4O0LA 3PP8A 3M2TA 1OC4A 4JLWA 4NK4A 3DFZA 1WDLA 4XEHA 3DMTC 1MB4A 1OZAA 1BMDA 2RAFA 4A2CA 3FF4A 4HNGA 2GUGA 4ALNA 4CQMD 3KO8A 2H9IA 2GNAA 1HDCA 3OJFA 5DT9A 3OA2A 2CDBA 3WG9A 4MVJD 2ZB8A 3NT4A 2WM3A 3TN7A 4MVJG 2PV7A 4S3MA 4PVCA 3BMOA 3VDQA 1YONA 3Q0EA 2YQ4A 3VVCA 3F6YA 4OOFA 1V3TA 5ICSA 4WK6A 3AOEA 2Y66A 2C7VA 3HB5X 2DBRA 2DFDA 2GN4A 1T26A 5DDIP 1XU9A 9LDTA 4R1UA 5DF1A 1KEUA 5B1YA 3BMQB 1O9BA 2PLAA 4YB8A 3SBOA 1GPDG 2IE0A 1PL6A 2I3GA 3W8FA 5K6AC 2X9NA 2O3SA 3HQ4O 5JMPA 1JAYA 5JY6A 1NFQA 4ID9A 4CQMB 1NVMB 2JD1A 3KXDA 4RF3A 2H5LA 4CLEA 2Y68A 4Z3KA 3G79A 1CJCA 4QEDA 4AJJA 2Q46A 1O95A 1VI2A 3LDHA 5T6BA 4J49A 4WCFA 3O38A 2OBNA 1YGYA 2R00C 5DP1A 3ZHYA 2I99A 1GUZA 1I2BA 3DC2A 2PZJA 4K1LA 2D0IA 2NTNA 4E5YA 2Q49A 1U1IA 3A1NA 1TLTA 1D1TA 1YL7A 4W9NA 4IDEA 1ISIA 1PGNA 4PZCA 1UXGA 1DC5A 1I3LA 2EXXA 3GDGA 4RDHA 4BNWA 3FWNA 1G6KA 1SCUA 1SEVA 1Y8RA 2ZYAA 5EPOA 2W2KB 3A28A 3KSUA 4GLLA 5L7YA 5IXSA 1NVTA 5TJ9A 1DIRA 5IDXA 3KTDA 4NHEA
chains in the Genus database with same CATH superfamily
1XQ9A 3O3NB 4M4SA 4X1IA 2C7QA 3A1TA 2OXFA 1TMOA 1EXMA 2A88A 5BUQA 1D1PA 2NO0A 3BH6A 1B8UA 3F6CA 1ZLYA 2E5LB 2I6QA 3JQDA 1MB3A 1YKGA 3WR5A 1Q0SA 4RL6A 3TB6A 4D0GA 4JI6B 4KQ9A 2VCYA 2Q9CA 5LZ8A 1V6AA 5B58T 3LMKA 5JZVA 2H54A 3DCJA 3ZE7A 3ZVLA 3AEUA 3GW8A 4A8JA 5HP4A 3VNUA 2O8BB 1ZISA 1B76A 4HS9A 3T9BA 1VHWA 4PE5B 2R5FA 3OOJA 5GAJA 3U9SA 2CK3A 2YHBA 1Y33E 3GOHA 4RSGA 1C1DA 5L7TA 1XAJA 3U3MA 3M4ZA 4NL4H 5BRJA 2W9XA 2RGXA 3R6WA 4BGVA 1NXPA 5CBPA 1EK2A 2L19A 1K5HA 2DFNA 4LYJA 3KPVA 1W5EA 5DTMA 2BF4A 4ZOLB 1G8PA 3TNYA 2H4JA 2C1ZA 3OZUA 4RSHA 2E5FA 4Z9AA 3R7AA 3X1WA 1YL6A 3L6BA 4EVIA 1FDOA 4MPRA 1T35A 4X1YA 1CS0B 1HEIA 1L5HB 4JI3B 1UXJA 2VHXA 4EPXA 4RA6B 1VKNA 2ILVA 4KYUA 4LXGA 2MSDB 2OB2A 1KPHA 2AI1A 5TR9A 3LBIA 3F5DA 1N7IA 3NGXA 3CCCA 4D4GA 1DBQA 1U0JA 3SHOA 1JU9A 1JYEA 1NSYA 1W4ZA 2Q2OA 2VQ6A 2J9XB 2VZEA 3RM3A 1P33A 4QOSA 1W35A 4G36A 2XYPA 4UU8A 3K1YA 5JPCA 2PL9A 4V0RA 3SKVA 4TTQA 3U40A 4E5UA 4QBGB 2NVBA 1LEHA 3Q7IA 1YB7A 2QT1A 3RQIA 4L5YA 4I1OA 1VPEA 4WRRA 1JA9A 3F3YA 1Z4OA 3LECA 2OHIA 3HB9A 4EGAA 5ADVA 5FI5A 1WCIA 3U80A 2FQYA 2JLZA 2RIRA 2JH3A 5HGXA 3KOZA 4PY2A 4G81A 1WIWA 1CUEA 1XTIA 2GSDA 2OHXA 3BGWA 5FKJA 4BAGA 5HA5A 3NOQA 2OMKA 1UZMA 2C1EA 4ZICA 1M2FA 3GELA 1PNRA 4PZYA 3D4OA 1VKZA 4FHZA 5J23A 1U2ZA 4PHFA 5BMVF 1T4DA 4QZVA 4G8BA 2O7QA 1JALA 2EG9A 2WQZA 3L7BA 4DWJA 4LX0A 1YRLA 3QFCA 4FR0A 3E9NA 2W2KA 1O03A 2UYOA 3A3NA 4MRSA 4V0LA 2DPXA 4U7DA 4TWZA 1O57A 3GCDA 3K0BA 4GZMA 4KXQA 4JJKA 5A4JA 3DPSA 3H9JA 3IOMA 3U3OA 4FMCF 1DEXA 3GFQA 2GCOA 3R77A 3U7IA 1DS6A 1UWLA 1VRWA 3LPAA 4L0DA 5FH9A 1TYZA 4KQKA 3AQ4A 1RXIA 4JIGA 3W4KA 4B7ZA 2VZ0A 3HZOA 4Q4CA 3N8NA 3OM1A 1RZVA 2NWQA 2OCDA 3HDTA 3VR5D 3WDSA 4B73A 1JGTA 1D8AA 1ZGCA 2DWQA 3IV6A 5F3DA 4AZSA 3JQCA 1NP3A 3G9ZA 4MI9A 3MSCA 2FEKA 2WUDA 3OZRA 1B7GO 1F2TA 4Z9XA 3WIDA 2XI4A 1Q14A 1N5RA 4X7PA 5B6JA 2IOQA 3GY0A 4GBJA 3O7WA 5GV7A 3FKQA 3EVCA 3H99A 3CEMA 3GYGA 2Z8ZA 3ZPXA 1E4EB 5FAKA 4NS1A 4OHUA 1RE1A 2BYTA 5L53A 3HSSA 2YWEA 3NV9A 1LDYA 5J58A 5E9WA 3ETDA 2C42A 2ORED 4G6ZA 4NNJA 1OAAA 3OETA 4OGLA 1ZRSA 4KQMA 3WKDA 4W9NC 3OCWA 4QG3A 2PX6A 2W2MA 3WOHA 3B52X 1UPFA 2HMYB 4XWWA 2E6KA 3QKWA 4C5CA 5BYAA 4U7HA 1DX6A 1JAIA 3HUTA 3NC0C 3WLRA 1HTTA 2OZKA 1YVRA 3BMQA 3FY4A 1DXQA 2JFVA 3JR3A 2F1OA 3SC2B 3HKEB 4O1IA 1BXRA 4QULA 1OH5A 4I9HA 3KG2A 3D54D 1K98A 4TLBA 5FJIA 1USIA 4BL5A 2DLDA 2JAUA 2WT9A 3IIEA 3OM0A 2A94A 4PPYA 2WUWE 4F5ZA 3PYXA 2HT1A 1PF7E 1Q7EA 3O95A 4TVBA 4XGRA 1Z8FA 3I2HA 3JAKA 5GJVC 4E7OA 4F92B 3MTBA 4JD5A 4YAGA 4Y2TA 2AOXA 1ILEA 4CLRB 4CR8A 3OTHA 3RT1A 2I2DA 3DOIA 1N92A 2ODBA 3VPFA 1GKLA 2V7QD 4YLYA 1B15A 3PFGA 5F2EA 2FJ0A 4GI7A 4P0TA 2I9PA 2CV0A 5ITSA 1EMDA 4NYMR 1I36A 4IUCS 5KJCA 1G4UR 5KNCD 4M1KA 3K5PA 2XCTB 4MUBA 2A0XA 2FX3A 4YRSA 1EFAA 1AGRA 2W2LA 3VUEA 1KVUA 1CEYA 2VK4A 5GIPE 1EXDA 5DMHA 4L5IA 3E7XA 1SCQA 4OBXA 3KOWA 3O8OA 2I4LA 1FFXA 1HEYA 1NRJB 2DTXA 3D7NA 4XJSA 4ZHQA 5BWNA 3H97A 3ND7A 1Q11A 2ESRA 3SSNA 2XIJA 1TOAA 2NT3A 1UBJS 1AOXA 1D0SA 1TMGE 3KVOA 4IOKA 4OD0A 1HRDA 1TZKA 4CYMA 4DS3A 1M9NA 5EXSA 1B42A 1XX6A 3E27A 3H9UA 4I9FA 2VHZA 5EP4A 3RJ9A 2A14A 2HLHA 1TQ6A 2QAGA 3H11A 3J7TA 1EWKA 3GV0A 3R5FA 4YRRA 2VSNA 5JVDB 1N7HA 5IZCC 1VE1A 1N3IA 1EE2A 2OUIA 2ZJBA 3F4BA 4IRXA 2DR3A 4A1OA 3LY5A 1FFCA 5GIOE 1OX6A 3OO1A 1O94A 2J8ZA 2RCYA 1E7QA 1A69A 2VNIA 1Y4SA 1YZTA 3GHYA 3MWEA 3N7AA 4H9GA 2YUTA 4TLAA 5EJAA 1ZJWA 3D1JA 3N8IA 4M7PA 4N7JA 5K3BA 3URKA 5T8KC 3GLKA 3UKDA 1F0NA 3CUSA 2H2FA 2AUNA 3GPCA 4K9PA 1E9FA 1C4XA 4PIPA 4C2UA 1EI9A 4BQIA 1UBSB 4I4NA 4N0DA 1W5SA 2OBMA 2AI3A 3IUSA 1C1YA 4MRVA 1IY0A 1QF9A 2VHTA 2PSEA 1YR2A 1IJFA 4K40A 4PXAA 3RJTA 2O5EA 3COVA 5CVDA 1NP6A 4PZDA 4DQVA 1E2MA 1QIFA 1JHDA 1OGJA 1WDKA 1YOVB 3EZ9A 4UUBA 5DWVA 4D8XA 4DSAA 1UC5B 3C16C 4ZT4A 5TF4A 4B7CA 3IAEA 3KZVA 4GW3A 5DM2A 1IBCA 5BYKA 1QVZA 2H18A 2VXYA 4N12A 2AQIA 3VDRA 1S96A 5JZSA 1EFTA 2XMDA 3T5AA 3OPYB 3EG5A 2VSQA 3EXG1 3NHSA 4OQXA 4FVTA 1KRHA 3AR5A 2WZDA 4HKTA 4WZBE 2AW3A 4AJ4A 3CGWA 1TF7A 3GUHA 3S8EA 4CEIB 2VLBA 1LI4A 3C5WP 4NNOA 5KVCA 3KQQA 1X94A 2N1MA 4KUGA 2V98A 3OY2A 1BC5A 2CJXA 2B2NA 3Q1KA 1T2EA 1DOZA 1FF9A 2IYRA 5DBEX 1NLUA 3OQ6A 4H4EA 4B4WA 3NTRA 5EIXA 3EIWA 2YXNA 1X9GA 1KSFX 3L49A 1OXMA 2WJHA 2A86A 4BUZA 4IDGA 3GAAA 3VKVA 5FWNA 1GPLA 3M3HA 3K0HA 3PUVA 2NU8B 2XDYA 3OJCA 4A0SA 3O8NA 4R1PA 1E6KA 2OILA 2R8EA 3IVXA 4EJSA 4YCMA 5JRJA 2QQ0A 2LDBA 2DT8A 1HQKA 2XBLA 2YBEA 3A1UA 3C48A 3P2JA 1W0JD 3RCBA 3AUUA 1I6LA 1T9DA 2W71A 3GGCA 4M9QA 1SXJA 1FX0B 4XCQA 5B6PA 2B6HA 1EH5A 1QHHA 3E9ZA 5CTJA 1QP8A 2XAUA 1K4YA 4UHDA 3NVDA 2E82A 2RAUA 3ZHXA 4BE4A 2CE2X 2VRWA 1IAVA 1LW7A 4E70A 1II9A 2X9VA 1HT2E 2VYVA 4FDTA 4E1AA 3OA0A 1TT7A 4J3NA 3P9PA 3L6EA 2GM5A 1X1CA 1QKJA 2R96A 4FNAA 3ZX4A 4E5DA 5BQ3A 4EDFA 1KRWA 1N2IA 1L4YA 3GGSA 5C46F 1DL5A 1Y9AA 1Z6QA 2V58A 1U2GA 4BZXA 4LDZA 2CVHA 1E2GA 4BO2A 3QWBA 1HUQA 4P7JA 4OHYA 4GP7A 1T4CB 3LT2A 4K26A 1LFDB 2O50A 3ILYA 1OXXK 2JFZA 5BYJA 4TV8A 2E2WA 3T94A 4BGDA 4PNHA 3C4VA 2X2EA 3S1LA 3JWGA 4QXQA 3V5NA 1EFCA 1WKCA 2B1JA 4U2BA 5KJ6A 4QTYA 1FU4A 4NXNB 3HDHA 2QPOA 2AYXA 2ZDGA 5HR5A 2R60A 1R4AA 3ESDA 2HGSA 2Q5OA 3ZBPA 4HTFA 5GJCA 1GUYA 3UMBA 3ZBQA 1E2DA 5G3ZA 4D3YA 4L75A 3X44A 4D99A 5ELXA 2V0GA 2C7BA 3PKZA 2G17A 2YXPX 3T7RA 4A5SA 3AYZB 2Y6VA 3KXKA 3TOZA 3BL5A 1XRPA 1G4AE 2QTGA 3GP5A 4I3GA 1TW3A 2GKSA 4CM5A 3ELUA 1VECA 3S2SA 4BN5A 3AKYA 4IIVA 3NBAA 1I1OA 1R1DA 1GRNA 1W34A 4LHXA 2PSSA 2AMJA 4ARVA 3ZLBA 1LRKA 2O07A 4QEKA 3AKEA 1ZU5A 2PM8A 2Q0HA 4OMDA 3WS7A 1U5BB 1GGHA 3D8UA 3E1SA 3HMKA 1SBHA 4OXIA 4R6WA 4S0XA 4H77A 5BQPA 4AB1A 2ZBGA 2A8YA 3H4TA 3D4LA 3FYUA 4EA9A 4BQOA 3HVRA 1Z6PA 1HNXB 2FPIB 2RJ3A 3IMCA 3PQEA 3NUQA 4Q1VA 3SYLA 2AS0A 3K8QA 4W5TA 2Q45A 4K8RB 1L4GA 1RLJA 3LXRA 3CBGA 3VSBA 5FTKA 3SZOA 1QE3A 1UAYA 2BEUB 3RVMA 4CFYA 3LOUA 3Q98A 2QW8A 2WYVA 1EDBA 3MA0A 3HVUA 2DETA 5LVAA 1HSZA 1GZ6A 1PW5A 3BHNA 4HLDA 1FFHA 1HLDA 1H8HA 3ANYB 4L3WA 3EFHA 2WYHA 2P2LA 4N4AA 2F2TA 4Q47A 3DE5X 1QHYA 4N82A 3DUFA 1XDUA 3EEIA 2Y71A 3OEEA 1O95D 1Q16A 4N3BA 1P2FA 2OP0A 5DULA 2YHSA 1YK1A 4KN6A 3BYZA 1RAAA 2HXGA 2CLDX 4KLCA 5AM4A 4DCPA 1FQKA 5I9SA 4JLKA 4CT5A 5IWCA 1P9RA 1KDOA 3B53X 3K4QA 5CX4A 2JFOA 1XKXA 1M6HA 5IW8A 3SM3A 4KV9A 4U5QA 4ZCLA 1J0XO 2I6UA 2VH5R 2F43A 1I33A 5T64A 1D2NA 1P72A 3ROXA 1FK8A 2CLHB 3AG5A 2OO7A 4LPSA 5A03A 3AHIA 4YAWA 5KDOA 5FWXA 4AUEA 3LK7A 3PLNA 3GEIA 4KRYA 1ACJA 3N0TA 3VAAA 3FWPA 1NVEA 4JSTA 4E5MA 1C80A 1PJTA 4LW8A 4NU8X 3R8XA 1C8KA 2IITA 3V48A 1T0HB 3E3NA 1MB0A 5KOJB 4M37A 2ZRPA 3N0WA 1U7XA 1YZQA 1R9JA 3ECCA 4KCGA 3H2JA 5CYGA 1ZMTA 1DGQA 5JD6A 2IH4A 1JHRA 1SHKA 3BVPA 1SKMA 2B78A 2QYHA 1E1RA 3PXXA 2C84A 1OXUA 2O3QA 1L7NA 3OY7A 4H6PA 2ZUFA 3BA1A 1UQTA 5CMLA 5I4KA 2JBAB 1VSUA 2A1UB 4MYDA 1JZQA 5EXDA 3TD6A 5ADUS 1EA7A 1Z13A 1RQPA 4JR2A 1SU4A 3PRJA 3W34A 4HB4A 1ZNYA 5TV2A 1DEKA 5CM2Z 1HM5A 3W1WA 3F9CA 4RM3A 1M8KA 1WUHS 1JKJA 3V8QA 1JWBB 1UKCA 2Q50A 4URYR 5D3KA 4D3XA 4MOWA 4JJZA 2ZPTX 1GV0A 1I3KA 2JFXA 3GFBA 3ICPA 5BUCA 3E8SA 1HO3A 1A8IA 1XE3A 3ONEA 4NZNA 2LGJA 1YCGA 1E3TA 1YQWA 3NIGB 5C0OE 2XA1A 2NVUB 2JA2A 2IV2X 2BFBA 1UT8A 1YDEA 4P31A 3SEFA 1L4KA 5H02A 3NH9A 4QQ8A 3ILHA 1M1NB 3ORQA 1FFWA 5FP0A 5CXSA 2O59A 5EWJB 4JMPA 2OBBA 5EQFA 1DRWA 1AKRA 4PC1A 5EGSA 4UOZA 2GO1A 5F3WB 2OPBA 1L4HA 2DQKA 1ZG3A 4E07A 3B70A 4BMOB 3M6XA 4C4ZA 4Z1OA 1IXRC 4EFDA 4LXHA 1YJ5A 1OFGA 2Q1TA 3LCMA 3NJ4A 4IMRA 2X3UA 3VSEA 5JIBA 5LM3A 3IL2A 1UFOA 4FR5A 4KFRA 2H85A 1XMOB 1A9YA 1DNPA 1SZPA 3EN0A 4II3A 4LRSB 3RHSA 2LTAA 1Q95A 5KQRA 4W7HA 4HEHA 1TM2A 3LL7A 2XVAA 3R3UA 5K4AA 3U49A 3WWOA 1XTUA 5JNTA 2FWIA 3BG5A 1VGVA 4HDSB 4KFTA 1T8SA 1YZGA 2PZFA 4UUQA 4BJHB 5JAUA 3ROQA 1XTQA 2ZIZA 5H80A 3KVVA 3R20A 1Q5PA 2FZVA 1XP5A 4DUZB 4EPYA 5CBPB 1BZYA 3H83A 2CXRA 4JLNA 2GRUA 2RBEA 3WLAA 2QU7A 1OLXB 4K05A 1MB9A 2VHQA 2WTMA 4HHEA 4ZAZA 4PM4A 4B3GA 3OT4A 3UH1A 4P5DA 1ZCZA 2VUSA 3UW1A 1EIWA 3DBRB 1H0RA 1PKXA 3ZHTA 3PNOA 2XY4A 4F45A 7ABPA 3JQ9C 3NWOA 5ECYA 2CL6X 4GXQA 3UANA 4GMGA 3W2GA 3G1TA 1OU4A 4CCYB 1R4NB 1ZK0A 5EGNA 1PNVA 3TZCA 5MFPA 2PO5A 5EEGA 3MWJA 4KU4A 4XFKA 4B6RA 5B30A 3SVTA 1XDDA 2PGLA 2PLNA 4LC9A 3WMFA 1DCFA 4B32A 2GN2A 2WP0A 3HUDA 4F5EA 2ZRFA 5THQA 4FJ2A 3T7AA 2XT0A 4RTPA 2DWPA 2HREA 2OV6A 1S1MA 3BXEA 1T34A 3KZOA 3SIPA 1ZVJA 3D6JA 3DDWA 1WF6A 4H3KB 3QHPA 4OHOA 2LR0A 1U7DA 2VA9A 4XW2A 3DFUA 3CX4A 1XYGA 2P79A 3X1KA 4L57A 1M6WA 2VG8A 1NFRA 3OEHD 4IJ6A 2PPVA 2RGAA 2RCNA 5FXMA 3CURA 3NP9A 2H1CA 2WV7A 4IDBA 3PGKA 3PT5A 3SP1A 1YIAA 1WPQA 2OHHA 3MMNA 4LK2A 5IUJC 4G97A 1MDBA 2VRNA 4PCAA 3OP1A 1BCSA 1KEWA 2Q9AA 4A73A 1CIVA 3PUJA 9MHTA 3R9WA 1WMFA 3FMVA 2JASA 3G82C 5I9MA 1NBME 1VBKA 3L4BC 2HDHA 3CRMA 2Y0BA 4DE5A 4HGQA 2BH2A 1GL3A 5JROA 1VB5A 2RH4A 1AUXA 1C1XB 2GZRA 1PQPA 1OX4A 3B7PA 5K8TA 3W6NA 1XNQB 1LD3A 1PLJA 1SC9A 1TCAA 1X7WA 3M6VA 4IWYA 3BE5A 3CB4A 3PHGA 4RPGA 1N1EA 1V5IA 2JLBA 5HBRA 1VIAA 1KTIA 4HNQA 4FGWA 2WZBA 4M1OA 4RNCA 2ACEA 2ZAYA 4GHWA 3GJ6A 4UOQA 1PZNA 2FYTA 3I0NA 2X7HA 4QA9A 3U48A 2HO4A 3TJRA 3QW4B 4M9ZA 5JCOC 2UUOA 2ZOSA 3NIDB 1FJGB 2ZRIA 3V8BA 4JITA 4L50A 1T91A 4ZVKA 3AY0A 5A7HA 2QL7A 3QOWA 4OU4A 5HF9A 2EP7A 2X1MA 3OKPA 3W5UA 1AGYA 3ZWCA 1RI3A 3U44A 4G5OA 1Y6GA 3NASA 3O4VA 2ZSHA 2BTOA 1Z35A 1XXHA 4JSYA 2HWKA 2B69A 1PNTA 3NOOA 3H84A 1HMYA 4GR9A 4NU0A 2UV8A 4OQNA 5AYVA 5F1YA 1M0WA 4FC7A 2Y4NA 3I6QA 1DE0A 4HO1X 1GM5A 2ZWPA 3AL2A 5A4DA 1RHQA 2BRUA 2G7MC 3H5OA 3O21A 3OJWA 2QLBA 2WHQA 4JJGA 2AOWA 1XL1A 1ZIYA 2YIDA 4I5EA 4MQ6A 4NDAA 4AK9A 1QIHA 3EPHA 3K1AB 4DANA 4IDFA 2IHJA 1XCBA 2PEYA 4LDQA 1DRJA 4H18A 1MGPA 2BSAA 4Y30A 5DNEA 1QO7A 4X94A 2Q1WA 1ID8A 3QX7A 2ILTA 2D0OB 3KZCA 2XCIA 4PHTA 5F23A 2GZ3A 4QUKA 4WY5A 1JDTA 2EX4A 4BO0A 2J09A 1W9HA 4KWCA 4F8JA 1HFEL 1KZYC 2QLNA 5CT6A 1CF4A 4YUZA 2HT6A 1TUIA 3RYHB 1TQ8A 3EWAA 5J5AA 2WABA 3U4CA 2XOXA 5T41A 1XTBA 1M34E 2A1TS 2FG5A 4N49A 1FP4B 2OCGA 1OWMA 3GLIA 2YW2A 2EFGA 2WRZA 5ALWA 4NE9A 1BOOA 4DG9A 1DQZA 2ACKA 3QEMA 5C5CA 1M34B 2W6PA 3V55A 2Q5EA 3HFSA 2JHPA 3C3BA 1YS7A 1NQTA 3F7MA 3PQCA 1JKFA 1KHTA 2QAIA 1QQ6A 2RHDA 3AQIA 4DMFA 2I66A 3RVOA 2FWPA 4I1SA 2QGFA 4IS3A 4WFKA 3UZUA 2D0PB 3OURA 4E32A 1BCSB 1X7DA 4NH0A 1OXVA 2N1BA 3RRNA 3FB1A 4QX6A 2NO9A 3WKBA 3ZWNA 4F9TA 5JAZA 4KREA 5JNVA 2Z5LA 2ASEA 3OOHA 2B0JA 3CLSD 3DF9A 2O8FA 2X2PA 3UB3A 3AILA 4FHDA 3RAFC 2FG7C 2IBMA 2C9DA 1B2LA 3S8YA 2GF0A 3EZXA 4B74A 2FFJA 1TA0A 2D5LA 3O0DA 4JASB 4KX5A 5BSVA 4AKIA 2VJKA 4Q0MA 1ADFA 4X91A 3H2ZA 5ALKA 4B0PA 4DN6A 3WYAA 1Z4IA 5GOTA 4AQDA 4BRSA 1HYHA 4FFDA 4PX9A 4C7VA 3WYEA 4OJKA 3VNQA 5L45A 2RIPA 3GR6A 2V59A 2ZBVA 3I1FA 4CTNA 5IKXA 3WGQA 2JD2A 2XYVA 4C7JA 4C2AA 2A84A 3COYA 4QGGA 2X1VA 2YXLA 3LS2A 3BIXA 1CHNA 5IN4A 2QL5A 1V5EA 2QE6A 4V2UA 4HAWA 2P65A 2RAPA 4IX9A 5AKKA 5TRTA 4LJ6A 5EKSA 5C8ZA 3U9TA 1RKBA 1U2DA 1XVIA 1T3GA 4WBNF 1UMCB 5JALA 4PW0A 1MXFA 3RFFA 2BGJA 4IGFA 3G8YA 4KSYA 5FADA 4CL8A 2Q8QA 3IX7A 1N78A 4FDVA 2WHPA 1SKYE 1FU8A 1PQUA 3EXIA 3A6ZA 3GGJA 2ZVPX 4RTLA 2ISSD 4XWYA 3DD5A 3HV0A 2H2WA 3SCZA 2FP4A 1ADCA 1EFLA 2C2ZA 3KQPA 3GFFA 1MVNA 1R66A 2XX3A 1JEQB 2X1LA 3KJHA 2X19A 4E11A 2GJ8A 2WJGA 4RD6A 5KNCH 3DZCA 3IB3A 4YS6A 2PUAA 4CN9A 4CEJA 2QHXA 1C7RA 4GPEA 1G9TA 1MEEA 2I91A 2HUPA 4BX9A 1G7TA 2CNBA 3R23A 3J81k 1G6OA 3SJBA 3H87A 4MJ3A 1YA4A 2XR1A 3EXHB 4H7HA 4L4YA 1U2SA 1KVRA 3EEFA 3GLHB 4MKGA 4QU8A 3DCYA 2V9CA 3ANXA 2HI0A 4DEVA 3DGEC 2HCTA 1QYIA 3PGXA 3TSCA 4E08A 4WN3A 2ZEJA 2OM6A 2B5WA 4F4CA 3L0IB 4OHZA 1QHEA 2OV3A 4PV7A 1KJZA 3OQNA 2QVCA 2HSWA 2RHGB 3DXYA 1UFQA 3AP3A 1H65A 1HDZA 3HA7A 3ZCQA 4IIEA 3BQMB 3L0CA 4JB2A 1NVBA 1E61A 2H9AA 2ZTLA 4C2TA 4ETNA 2GKGA 3LNTA 4BNWA 1NVUQ 1I9CA 4GSYA 2RI6A 2AEFA 4QLAA 1TEXA 2Q1SA 4P54A 4KIJA 3H5RA 3ZQ6A 4B4VA 1BXKA 2WWHA 1DCMA 1UMDB 2Q62A 2DH5A 1DG1G 1WEKA 1NQVA 3IEIA 3O2QB 2FJUA 4LV8B 1IM5A 3ZQUA 1JE1A 1JJ7A 1JSXA 1ESCA 1UJNA 2PZMA 3NH6A 1XQVA 3U4IA 1E3IA 2V65A 2JA1A 4JP8A 4KLZA 4E5SA 5JNRA 4IIFA 3Q3JB 1TW2A 4GR5A 1MNQA 2EQAA 4HYQA 2G82A 5IASA 3PQ6A 1QPGA 4JZKA 4NZOA 5KWSA 2ZKLA 4EG7A 3ZV6A 1QUFA 1CRWG 1HG0A 3A3KA 3RTEA 3UMGA 3UK1A 2W2NA 1ZIXA 4RXTA 1R8QA 5CAEB 2BONA 1E0AA 3ONNA 5CDFA 5IKMA 1HC7A 5FTWA 3QVOA 5AW2A 4IICA 2V4ZA 4B35A 3CISA 1H2FA 5A4AA 5KYGA 3NTQA 3OZTA 3TMAA 3AIIA 1Q0UA 4X84A 3S40A 3ZU2A 2C29D 5HUJA 1A4IA 4WMLA 4J1SA 1LLFA 3I6IA 2VAXA 3A14A 3B1YA 3JRNA 1UPTA 4ZI7F 1DJNA 3EX7C 1AJEA 1QFXA 3DJYA 5EJ6A 4UATA 1B6GA 5I8ZA 3QQPA 4YGXB 2EEZA 3CX7A 3M70A 4OI1A 5IYZB 1C3VA 5F77A 2IGTA 3HJFA 4CG1A 3HYNA 1LLUA 4CEJB 4IXMA 1GITA 1RP1A 4QYSA 2OQRA 3H9CA 5DM4A 3UWOA 1WX1A 2YY6A 5J4KA 1IMJA 1U2EA 3KZKA 3OJXA 1V35A 3CJRA 3PEEA 4FE4A 3BIWA 2O9JA 3EQ6A 4MPPA 2RGYA 1YAJA 1U90A 4LS3A 1VSTA 4FNMA 4HNAA 3E8MA 3UNXA 4BKMA 1QBKC 3FBGA 3BFPA 2FE4A 3UFBA 5DNCA 2Y1LA 3T1NA 4Z4CA 2HJRA 4DTCA 1G60A 4UCXA 3U31A 3CF6R 3P2EA 3ER6A 4AFNA 3H6KA 3H75A 2EATA 1U1DA 3TCXB 2ONKA 5E1MA 1PR4A 1XNGA 4BIIA 3WFJA 4X45A 3CLKA 2PKRA 3OX2A 1UZNA 1U5BA 3DYIA 4BLVA 1J2RA 2XUGA 5LB4A 3W77A 3FW1A 1JQ5A 2RI0A 3QVLA 4RO0A 1XWFA 5LQAA 3DDOA 3K9BA 1IAQA 1BHQ1 2YV5A 3RS8A 4HZUB 3TZLA 3JCZA 4BLRA 3W8NA 1M6VB 3MD0A 3MMPA 3V7UA 4B2IA 3E7PA 6REQB 3ZV3A 2HSEA 2NV2B 1NZFA 1QZZA 1QFZA 4G0NA 3VV3A 4FZ5A 2MMGA 1P45A 3P9QA 2G6TA 4I6JA 3CLSC 5IXYA 2Q5IA 3C74A 4UVDA 2W2TA 3BMCB 1SK9A 1LSJA 1C7JA 1GQQA 1LTHR 3L1VA 4OP2A 4YRAA 1XCOA 1WZEA 1VBNA 5CIWA 1FTNA 1DJLA 2H1LA 4YRKA 1T1IA 2JFBA 3HDJA 2LDXA 1FUUA 2UZAA 5TEVA 3BH7A 1GL7A 1E2QA 2PWZA 2LXNA 3N8KA 1IK6A 2ZULA 4W7SA 3NGMA 2BFDB 4ZO9A 1ZYUA 4JI2B 1Z33A 2FN4A 1R15A 2WT4A 3VVBA 2QX4A 5M04A 4M0MA 3MS7A 4KTTE 4MVJE 1XGKA 1A9ZA 1O9GA 4ZXPA 4LJ5A 1Z5WA 2XRFA 1ENOA 1P9LA 4Z9YA 4HEJA 1ZMBA 2X5XA 1JVBA 1VE6A 3DSRA 2XT6A 4KR9A 5LPNA 2LZ0A 4IVNA 3K6JA 5ELLA 1F0PA 3KQYA 2PAFA 4UVHA 1VCOA 1Y9EA 3KS9A 1Y5NA 2XD4A 1JQJC 3Q8WA 2Q28A 2BY4A 2A5GA 3JARB 3OCCA 1WD5A 2GF2A 2ZJYA 4NJEB 5HS6A 2M9MA 1QRUA 1PQ4A 3H2HA 2N46A 4ONEA 1IUNA 1CRZA 2Q5JA 3PJFA 2FQWA 4FLEA 3RAPR 1UAAA 1RAIA 4JBXA 2EV9A 1N5KA 3FPFA 4QT0A 4CUJA 3HLKA 4LDPA 2PRSA 3WKCA 3KQKA 4HVTA 4OHBA 2J3QA 3WICA 3I83A 1A9OA 4R16A 1U8XX 1XA0A 3DYBA 3TW0A 1XU7A 6Q21A 2K4MA 2OCIA 2ZE7A 4C30A 2Y3IA 4NVRA 3SN6A 3UXMA 3V46A 2HRDA 3DHEA 3OZ7A 4FQ8A 1HE8B 3GYBA 3M6WA 1JHOA 2PX5A 2VDPB 3VPDA 5HGJA 3X1DA 1AZWA 2ZUCA 4OLHA 4EJ0A 2Z4RA 1IM2A 3A3YA 4RBNA 4LIPD 5EKXA 4E4YA 2JDID 2BKLA 3HUFA 4MJXA 5BO5A 3FFXA 4NQZA 4LJ9A 1RKUA 1Y5MA 3EBOA 5LLSA 3ODGA 4LC0A 2YJ3A 4S2UA 3HUEA 4MVJM 4WXRA 2JKVA 4JEHA 4Y9UA 3OFSA 1NUUA 5L3RA 1FW6A 3GRVA 3C3DA 1VQ1A 2ZIWB 6REQA 1ESMA 5JCJA 4MDHA 3DKVA 2IYUA 3HXKA 5LQSA 1VLZA 3T5BA 3M89A 5JFGA 3PWSA 2XMZA 1DZIA 4LGVA 3C1OA 1KGDA 3SIXA 1E2PA 4FOTA 5CH5A 2HAEA 4I4TB 4I55F 3SOPA 4EGFA 1JPJA 2BUCA 3FIJA 1XZCA 2C5AA 5CVJA 2D1SA 2KB0A 5G02A 1MB2A 1R5OA 1TIPA 4I99A 4C3ZA 4WZBA 3B1FA 1IBLB 1YL5A 3SYTA 3TLGB 1J00A 4PCVA 3VBCA 4JKOA 1WOMA 5CEJA 3RE1A 1KVTA 1SXHA 2QS9A 4FKBA 3MWFA 3JD2A 4LQDA 2J9RA 4TS1A 2QNRA 2IIBA 3VFDA 3YASA 5IC4A 2W11A 3EDMA 2CEKA 2G1UA 3PD7A 4N7RA 1AGPA 4BN0A 1P2UA 5F21A 1OROA 2WYWA 5F9MA 1XZNA 1JPVA 3CMMA 5JXIA 3TVYA 4XVQA 5BXQC 1RXUA 1U8EA 2ZRKA 3OHSX 1JSRA 2ASVA 3MLEA 4EHHA 4ZGWA 3ZX5A 1DX9A 2BMWA 4ARZA 3VU1A 3ZJYA 4CRWB 3W9YA 3N7UA 1NDHA 1GPMA 3NCTA 3ESCA 3MYRA 2PT6A 3C5CA 3I8XA 3MYYA 5FUBA 4UMVA 2FPSA 1EK0A 2O7RA 4FS3A 1RSZA 4OLFA 4XIGS 3V80A 1TT5B 1F9AA 2DWUA 2PZBA 1DWOA 2L69A 5FFMA 3H4MA 3OKCA 3RWOA 3VOTA 3W8RA 4FILA 4E6EA 4OQZA 2E55A 4QTXA 4E5VA 1EGHA 5JDIC 1XDWA 3X3HA 1ZOOA 1SBIA 3CVJA 5M3BA 4EBBA 3MB5A 3P2YA 3GF4A 1AK1A 1D09A 1GLNA 2QTHA 3HFJA 1G64A 3QPUA 4RV4A 4TOIA 4ZMSA 5FEUA 4IMPA 1N5OX 2Z2KA 9ABPA 1UPCA 3OVMA 4BNNA 4E2WA 2WWFA 3I5YA 2SCUA 3JU3A 4XGQA 4MPJA 3RVBA 3JQRA 1T25A 3ONWA 4WXHA 2Y0EA 4XXHA 3DO5A 5FWYA 2B5OA 1AUVA 5IRCD 3R5HA 2H5EA 5KQPA 3QEAZ 1VJ0A 2EWMA 2IXBA 2W4IA 4RESA 5BRNA 1T10A 3A2NA 3PRHA 3RT9A 4DJFC 5DBIA 1MC1A 3KHTA 3HY4A 4R8VA 3PTAA 3ISTA 1XWWA 3ZCVA 3M7IA 4Q37A 3RVDA 5L95A 3FOCA 1XLTC 2ZXEA 3N5CA 1N5MA 3UC9A 2VS1A 4EPWA 4CFZA 4ZVLA 4FMBB 1UXHA 5DK6A 2A3NA 1JIQA 1JYFA 2XVXA 4KO2S 5EUQB 1CQIA 2Q6OA 4G85A 4LXYA 4R1QA 1GQ2A 4JLAA 5I7RA 2I9KA 2YMPA 3AJDA 4B5LA 3HNRA 4UHBA 2FW8A 2Q07A 4BZZA 3QKRB 1V1RB 4DAEA 5DP2A 1YSCA 3H1EA 4FFRA 4PLPA 4EZBA 5JZ9A 1SD1A 2WPNA 5EJGA 1XV5A 3F9RA 3AY3A 4IKOA 4K7JA 5FL3A 1M2OA 1KI9A 2IWHA 5LP6F 1YBVA 3ND5A 1GGNA 4WCVA 5B3JC 4KDCA 1T9AA 2V7BA 3H2BA 3EFOA 2PA0A 4LHEA 4MJ7A 4RIIA 5JTTA 4YHHB 4X6UA 2XMRA 2G9RA 1YK0A 3P1JA 3VGJA 1N8TA 4UXIA 3DEIA 3WB2A 1OWLA 2B4KA 1YKSA 1LV8A 4N0PA 4MAFA 1XI2A 5AICA 4M1WA 2PA3A 5JCPA 4MB0A 4S2EA 3OWOA 1L7OA 3X1ZA 1I32A 5COBA 1YDHA 1O5IA 3OTIA 1MORA 1SQFA 1U1FA 4F7WA 1G17A 2J5BA 5A5FA 4B4KA 4DBLE 1K97A 2NZUG 4X85A 1O5TA 3CH7A 4ARZB 1CVRA 2WHRA 2G70A 2NX2A 3CC8A 2R8OA 4V0MA 5ALNA 3KUCA 4ZC1A 1H2EA 3VR6A 4K2HA 2WMYA 4OJNA 2BM8A 1D2HA 3ZZUA 1NMXA 5CDTA 3DTTA 5KWVA 4UZSA 1AMOA 2Q29A 3WMWA 5KTYA 1K7FB 1MQAA 3FUUA 2XXBA 4M9RA 3TOVA 3AKDA 5H7XA 3QJGA 1Z4MA 3DO8A 5IT5A 5G4KA 5BNWA 3ZV7A 3IEUA 2XUZA 2XCUA 3ZN2A 4OSOA 2YFQA 2Z2JA 4PNZA 2VEDA 3A06A 4NMWA 1ODKA 2ZZNA 4R54A 1YS4A 4RVDA 4LI0A 4RDXA 2WWTA 1PZXA 5DXAA 4C4SA 1A2BA 3Q15C 1D5CA 4IYJA 1UOPA 4ZODA 1NJ1A 4DIDA 1YJAA 1DAEA 3OZGA 4JFAA 5BOVA 3ZCXA 1FYWA 5B7NA 4TZ6A 4RULA 4O63O 3FWHA 3GFRA 3JVUA 1ZH0A 3ZHQA 5IM4A 1QPZA 3HBAA 4HB2A 4UASA 1Y1SA 2KJQA 2NXWA 3RV3A 1XMPA 4TT3D 1SIUA 3TXXA 2PZEA 5KI6A 4ES6A 4D02A 1QU3A 3T4PA 1SVWA 4JLMA 2GZAA 2V4UA 1R3DA 2HEIA 5BSHA 3CVUA 4D4JA 2Y1KA 1Z16A 4WKNA 1EVLA 3O9ZA 4B4UA 2O05A 3K72B 4NWIA 1VMAA 1JHPA 4KKVA 2K2WA 3B6MA 4MQEA 4U63A 4WKOA 5IVPA 1UT6A 3S3TA 3HJGA 1ULTA 2JIZA 4X20A 2IWRA 3N2EA 4CDRA 2IXAA 3IKLA 5CDHA 1JFLA 3EFBA 4JU8A 3AJRA 4GOXA 4WJKB 2CHEA 4KYTA 1BJRE 1AKTA 1Q44A 4G1UC 2FHSA 4LHYA 1CYDA 1KYVA 2WICA 2QR2A 4C78A 4ZJPA 3TW8A 4QDUA 3MRTA 4CV0A 1R3UA 4OX9B 2O52A 1SJ9A 3PC7A 4DPMA 2VYNA 3I30X 3H4IA 2O19A 1F3OA 1KWKA 1XTVA 2CLCX 2RGNA 2ZSAA 4U2FA 1T8YA 1U3FA 2EJCA 2H4HA 1WLSA 3OH8A 1Z5ZA 3ZLTA 4B43A 1GU7A 4X1OA 4ZVUA 2IHVA 3H86A 4GEGA 4Q3BA 3R5JA 4AUNA 4RAOA 4UNNA 4RTSA 3LC1O 3KBOA 3ESQA 4UMEA 1R6XA 1PWZA 4CEHA 4MYHA 3J80A 1CFJA 4G26A 1E92A 1QDLB 3NALA 1UBTS 4NMLA 1VJ5A 2IIPA 3K0AA 4DA9A 1AXGA 3ROFA 4DV7B 1HDRA 2RJOA 4G8DA 1JF8A 1X14A 4XTRA 2YOHA 5ALVA 3I5AA 3FCOA 3RR2A 3FSGA 4YAJA 1RIFA 2BFFB 1YRQA 4MQ4A 4N5MA 1BKDR 3ZK9A 2KLHA 3IBGA 5DH9A 1JBEA 1LQTA 3G2NA 1DP4A 4QVKA 5A4KA 4D92A 4R2MA 3WK9A 1F9EA 4DCJA 3ERCA 3B6EA 1EB8A 3ICCA 3V9PA 4BZWA 1JH8A 4E03A 2IH2A 1U2GC 5A9SA 2G4CA 2Z3ZA 4V1CI 4GL2A 1O2DA 3RC2A 3MCUA 3OKAA 4MUKA 1TE2A 3ZHCA 4DSNA 1FL9A 4FTWA 4PYOA 2QZSA 4RK7A 4UU0A 5IJZA 3GDOA 3OX4A 4Q4LA 1YE8A 4IDNA 4H0FA 1JFFA 3O4IA 4MP8A 4DV0B 3V4RA 3A32A 4XX0B 3A37A 2V7PA 3VH4A 3VTKA 4LK3A 5LQUA 1KO7A 3NM5A 3K0CA 3CS3A 1P31A 1P7WA 4LUCA 5HCUA 3PXDA 2ODNA 3OWHA 4C1NA 1QV7A 3PDJA 1ABFA 4KDRA 2NU9B 3VBEA 4PQEA 5KDDA 1H2XA 4RPHA 5CT5A 1ORVA 3L18A 1YS9A 3DWFA 3VJLA 3TKYA 4YP0A 3T5GA 3UBTA 2ZLBA 3AKZA 1YMVA 4PS0A 2NAFA 2GBLC 1MIOB 3G2HA 4F93B 3AF6A 4G1MB 4WFQA 2QXTA 4WLEA 3RF7A 1W49A 5INTA 2ZYRA 1E6EA 4O0MA 5FFNA 3ZD8A 2QMEA 2EKDA 1HMPA 1YE3A 4CMEA 2DKNA 5IT4A 3G8CA 3L7LA 1MO4A 2QN2A 4GLOA 4Z4FA 5IANA 5C8DA 4A4DA 4Z99A 1FTWA 4YXWA 3OEWA 5I4CA 4RACA 1E1QD 1U0GA 1N5IA 3QU4A 3GJ4A 3TD9A 4DQXA 1K3FA 2OG1A 2I1QA 2WFLB 4Q1BA 1UADA 4Q4HB 3KRTA 1HQDA 2Q3EA 4M1QA 3OEYA 3E9YA 3IDOA 1JJIA 1BE1A 3GVPA 3SK0A 2FHPA 2Z5GA 4J9UE 5J9FA 3SQWA 2V7VA 1T15A 4XSVA 4DGQA 4UNRA 3ZHVA 2EU8A 4AMYA 5I01A 1I4OA 3RBVA 1XLWA 3DB2A 5K0FA 4I9UA 2F17A 1Q7TA 4HWGA 5KHLB<