2A36A

Solution structure of the n-terminal sh3 domain of drk
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
b'MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein E(sev)2B
molecule tags Signaling protein
source organism Drosophila melanogaster
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a36A00
2ECZA 2AK5A 2AKLA 1Z9ZA 2EYWA 2DL8A 1T0HA 1QCFA 4GLMA 1PNJA 2D8JA 1YP5A 3M0RA 4RUGA 2DL5A 1G83A 3H0IA 1GFCA 1AVZC 4QT7A 3VRYA 5IXBA 1SHFA 2YT6A 1ARKA 1CKAA 2V1RA 1B07A 1WI7A 2MOXA 2A37A 3UATA 1J3TA 2JXBA 2K3BA 4CC4B 1AWJA 1ABOA 2GQIA 4RTYA 2A28A 2BTTA 4OMMA 1M30A 2K2MA 1V1CA 2FPEA 1WYXA 2JM9A 2RQRA 2J7IA 1JU5C 4Z88A 2CT4A 4E6RA 1HSQA 1H8KA 1JQQA 1AWXA 2EGCA 4LUDA 4A63B 1AWOA 1H92A 3EHRA 3EG3A 1PKTA 5FWBA 2EBPA 1SEMA 1UHCA 1GFDA 1I07A 1AEYA 4JJCA 1RI9A 1NYFA 4J9IA 2J6OA 2KGTA 1JXMA 2W0ZA 4EIKA 2RPNA 3TSZA 1QKWA 1T0JA 4D8KA 2YUOA 3VS5A 5L23A 1T3SA 2ED0A 2HEQA 2KEAA 5GJVB 2LJ1A 4AFUC 2KRMA 1M3AA 1X43A 5I11A 4F14A 3EG2A 4OMNA 1OPKA 1K9AA 2DE0X 2M51A 4RTUA 2EGAA 1UJYA 4CC2A 4Z8AA 1UGVA 2A08A 1G2BA 2DF6A 3NPFA 3M0TA 2RQTA 4M4ZA 1M3BA 2JM8A 1YWPA 2DVJA 1RLPC 1Z9QA 3H0HA 2MIOA 2CH4W 1QKXA 2BZYA 1WA7A 2DBMA 4CC7A 2NUZA 2RQUA 2DRMA 2LNHB 3REBB 1YWOA 2KRNA 4HVUA 1NLOC 2JW4A 1BB9A 2FPFA 2KT1A 2JS0A 2ROLA 1RUWA 4AFZC 2YUNA 1S1NA 2FPDA 1YNZA 1ZUKA 4D8DA 1AZEA 1K0XA 2J05A 4JZ4A 3EHQA 3ULRB 2K9GA 2DJQA 1GBQA 2AKKA 3TVTA 2CDTA 2JMCA 2G6FX 1TUDA 1UJ0A 2QDLA 2XMFA 3H41A 1GCQC 1XOVA 2X3WD 4OMOA 2DL4A 2ABLA 2LX7A 1AWWA 2F2XA 1BK2A 2OI3A 3VS1A 1VA7A 4R0KA 5IHNA 1N5ZA 1X6BA 1WXBA 2L0AA 2KYMA 2EPDA 2LCSA 3VRZA 1LCKA 1E7OA 1GCQA 2RMOA 2O31A 2O9SA 2KNBB 1M3CA 1SRLA 1E6GA 1A0NB 4J9DA 3I5RA 1T3LA 2PZ1A 4DEXA 2HSPA 3TSWA 2HDAA 3JV3A 2L3QA 4LN2A 4RTZA 5IHKA 3VS0A 2J06A 1X6GA 2DA9A 3NGPA 2DNUA 1CKBA 1ZLMA 2DILA 4RTVA 1MUZA 3U23A 2FO0A 2DL3A 2LJ0A 3FJ5A 1UFFA 2D0NA 1WFWA 2RQWA 5IHIA 5FWCA 1M8MA 1HJDA 1NG2A 2EYXA 3VS2A 1W1FA 1WLPB 1X2KA 1ZSGA 2LJ3A 1E6HA 2CREA 2KBTA 3ZL7C 2ESWA 4ORZA 1JEGA 3KFVA 3QWXX 2F2WA 3EGUA 1NYGA 3GBQA 3VS6A 3M0SA 2RN8A 4OMQA 1K4US 2LP5A 3CQTA 5FW9A 2GTJA 3QWYA 1GL5A 2BZ8A 2FG0A 1ZUYA 3VS4A 1PWTA 2OJ2A 3H0FA 3PE0A 2O88A 2LZ6B 2CUDA 2ED1A 1SPKA 1QWFA 1WXTA 2LQWA 1VYVA 4J9EA 4HXJA 4F16A 3M0PA 1FYNA 2CUBA 2FEIA 2H8HA 3I35A 2O2OA 2D8HA 3RNJA 4IIMA 2GTOA 4LE9A 3R6NA 2KXCA 4AFQC 4OMPA 2FRYA 2K7AA 1ABQA 1KJWA 2J6FA 2JS2A 2OAWA 1HD3A 1UTIA 2DRKA 4HVVA 1PHTA 2YUQA 1OEBA 2E5KA 5GJWB 4J9HA 2KE9A 1TG0A 1UUEA 1PRMC 1AZGB 2F2VA 2VVKA 2YSQA 2IIMA 2JMAA 3EG0A 1K0SA 2P4RA 1FMKA 2FRWA 1QWEA 2LQNA 4J9CA 2EYYA 2YUPA 1BU1A 1W6XA 1H3HA 1X27A 2GBQA 2HCKA 2L2PA 4RTWA 2VKNA 3O5ZA 2EYZA 2VWFA 2KXDA 2KR3A 4Y92A 1UE9A 1OPLA 1KFZA 1MV0B 1NEGA 5IH2A 3SHWA 2SEMA 2A36A 1EFNA 1U06A 2L3SA 1WIEA 3EG1A 3UA6A 2EW3A 2I0NA 3REAB 4KRTA 2SRCA 2W10A 1UHFA 1ZX6A 2DYBA 2EKHA 2ROTA 2J6KA 2L3PA 3IQLA 2YDLA 1JXOA 4IIOA 1W70A 1QLYA 2LMJA 3A98A 3NMZC 2KROA 4AG1C 1K76A 1Y0MA 2DMOA 2RQVA 1GCPA 2X3XD 3UF4A 1NLPC 5ECAA 4AFSC 2CSQA 2RF0A 1SHGA 2HBWA 3UA7A 2EGEA 2EQIA 4K11A 4FSSA 1UG1A 4X1VA 1K1ZA 4Z89A 2O9VA 1UDLA 2GGRA 2C0OA 2CT3A 4JJDA 3THKA 5I22A 2K79A 4JPBW 3VS3A 1VYUA 1AOJA 1WXUA 3RBBB 2D1XA 3PVQA 1NM7A 1OV3A 1CSKA 2JTEA 1GBRA 2PTKA 2DBKA 1NEBA 4LUEA 1KSWA 2DX1A 2PNIA 3PVLA 1PRLC 4J9GA 2K6DA 2DL7A 1OOTA 3VS7A 4HCKA 2B86A 3C0CA 5HCKA 1X2QA 4LNPA 1IO6A 2CSIA 4AG2C 4J9FA 1VYTA 2AZSA 2KYBA 1U3OA 2RNAA 1SRMA 1X69A 1ZUUA 4RTTA 4CC3A 5EC7A 1WX6A 1SSHA 4JZ3A 3M0QA 2GNCA 1Y57A 4ESRA 4GBQA 1PKSA 2DM1A 1UECA 2MCNA 1BBZA 1AD5A 1RLQC 2NWMA 4J9BA 4RTXA 3LH5A 1ZBJA 4OMLA 1TUCA 2JT4A 4F17A 4JJBA 1I0CA 1KIKA 1YCSB 1I1JA 2ENMA 4ZNXA 2DLPA 2V1QA 2KT8A 2C0IA 2KRSA 3M0UA 2CH4A 1YN8A 1B3QA 3I9QA 2AZVA 2C0TA 1GRIA 4WCIA 2M0YA 4DEYA 1WDXA 1MV3A 1M27C 3SEMA 3NHNA 2EVRA 3I5SA 5IXFA 4HVWA 1U5SA 2BZXA 1JO8A
chains in the Genus database with same CATH superfamily
1S72Q 2Z0WA 5KYUB 1M1GA 2AKLA 4E7KA 5GMKe 2K57A 3G6EQ 4II1A 3V8LA 4F7UG 1T0HA 1YP5A 5LJ3j 3CC4A 1LJOA 3G71Q 1AVZC 3VRYA 2LT4A 4ZGDB 1V76A 3EH2A 3CCQT 1B07A 3HFNA 4HKEA 3UATA 2JXBA 2P0PA 5CVIA 4CC4B 1VQKA 1AWJA 3S3MA 7AT1B 2GQIA 5GAOr 4XQ3A 1IREB 2A28A 2MAMA 5CAIA 2FPEA 5CKBA 2DEQA 2JM9A 3LYIA 2HKQB 2RQRA 4F7UB 2J7IA 2FZGB 2RA2A 2CT4A 4M77A 3L1AA 1JQQA 2EGCA 3EG3A 1PKTA 1SEMA 1UHCA 5LJ5j 1U1SA 5D6YA 4FL6A 4JJCA 3QO3A 1RI9A 4NS5A 2KGTA 1RAFB 5DM7R 3QDRB 3M56A 5GMKi 4EIKA 3TSZA 1QKWA 1T0JA 2F69A 4PLLA 4C92D 5L23A 1T3SA 2HEQA 2K5IA 2LTOA 4AFUC 2E12A 2MK5A 2XI9A 3OMCA 1M2VA 3CCVA 5FRNA 2A08A 2DF6A 2QG9B 2C06A 2NUPB 1RLPC 3OBWA 4J7IA 4ELYC 2CZ6B 2KQWA 2QDYB 1QKXA 3CEYA 4QVZA 3OYJA 2XG8D 1WQWA 5GAMe 2LNHB 3M4YA 1NLOC 2EQKA 4MZPA 2GQVA 2KT1A 4KUIA 2JS0A 2ROLA 2X4XA 3LH0A 2Y4XA 2YUNA 4L6V5 3X24B 3CXCA 2ZPFB 3EHQA 3ULRB 1Q81R 1VQ9A 2AKKA 3CMEQ 1VQ8A 3MEWA 2CDTA 1YI2T 2H3JA 2G6FX 1UJ0A 1BKBA 4FCYA 3H41A 2ZGWA 2DL4A 2RB6A 4HCZA 2DIGA 2LX7A 2EFIA 4YTLA 4E2FB 5KCOA 1BK2A 1HYOA 1ZBXA 1VA7A 3PIOA 3LW5E 1WJQA 2EAYA 4M78B 5GMKh 4B6MA 1VQ7Q 1NBEB 1UGSB 2XHCA 1B7TA 3QBYA 1BYMA 1X6BA 4IURA 2KAFA 3CCVT 2YWWA 3CD6T 2O31A 4LDWA 4V2SA 4J9DA 3I5RA 2COZA 3VYHB 4FT2A 4DEXA 1NJIU 4KULA 3P8DA 3VS0A 1KD1R 2DA9A 2XDDA 1XTDA 4PK4A 2DILA 4OB0B 1MUZA 1QVFP 2EJ9A 2FO0A 2DL3A 2VGMA 3FJ5A 4MDXA 1MMNA 1TXQA 3M54A 2QGGA 5IHIA 5FWCA 1M8MA 4FU6A 1VQ8Q 1NG2A 3PMIA 3CCUT 2EYXA 1WJRA 1ZSGA 2LJ3A 3FB9A 4M75B 2QXFA 3CCQA 3ZL7C 3PTAA 1TTHB 3AHUA 1VQNA 2OTJT 4ORZA 1ZQ1A 1VQMT 5GMKj 4QQGA 1WPYA 4XU3A 2Y90A 5CKDA 2X35A 2VC8A 1BI0A 5FW9A 2GTJA 2X9HA 4B9WA 2PUKB 1H641 1YJ9Q 2QGFB 1QVGS 4RCCA 3CCRA 2RHXA 2FG0A 1VQKQ 3H0FA 4WTOB 1YJWQ 5IAYA 4J83A 2ZPHB 4M78D 4PLIA 3G71A 4HCBA 4M7DG 1TU0B 1D0ZA 1G3WA 4HXJA 1VQOA 1TH7A 2CUBA 2FVUA 3I35A 3RNJA 4M78C 4DBHA 3QKJA 5LJ3e 1WZOA 2K7AA 1HD3A 1UTIA 3A8LB 1PD0A 2E5KA 2ZPEB 5I21A 1NPRA 1TG0A 1PRMC 3BY7A 2XK0A 2K3YA 4C8QE 2JMAA 4JJNK 1K0SA 2P4RA 2LVMA 4M7DE 4XU1A 4J9CA 2EYYA 1K9MR 1H3HA 3CCLQ 2KVQG 4F7UA 2GBQA 3GPLA 6AT1B 2R5MA 4RTWA 1RABB 3CCJQ 2JZ2A 3E1SA 1UE9A 1OPLA 2KY9A 1RAGB 1YHQQ 3SHWA 1DJ7B 2AHJB 3UA6A 4QQDA 2EW3A 1QVGP 3M57A 1VQ9T 1KQ1A 2CGHA 4C8QA 3HHTB 1C6VX 2W10A 2DYBA 5KYYA 4F7UF 4M7DA 3X26B 4ATOA 2J6KA 4XTVA 1QLYA 2BIVA 4F7UE 1HXDA 3CCQQ 3A98A 2KSSA 3HRUA 3NMZC 2ZAEA 3JCMh 4BI8B 4M7DD 2L8DA 1WHKA 3MP6A 4C92E 4C8QF 3ZBDA 2GFUA 3UA7A 2R5AA 1Q7YU 1YITA 4X1VA 1YCYA 4Z89A 2COWA 1FMVA 3X25B 4M77E 1Q82R 1UDLA 4IUUA 4BUGA 2FYKA 5M9OA 5C6SA 5GAMj 2P4TA 3CPWP 1QVFS 1OU8A 2R58A 2RHYA 1MNEA 2E6ZA 1R77A 2K79A 5FU7B 3VS3A 3L2RA 5CO7A 1AOJA 3RBBB 3CCET 3PVQA 4QVCA 1NM7A 3JCMc 3OYIA 1CSKA 2DBKA 3L42A 3QXEB 1KSWA 3PVLA 1RL2A 3AT1B 4JLIA 3I55T 2E64A 5GAOl 2NUTB 1IB8A 1LNXA 1O9SA 3J80E 3CPWS 1IO6A 4Y28E 4DBRA 5DY9A 3WVEB 4M78G 2O01E 4J9FA 1U3OA 1SRMA 1ZUUA 1PM3A 3E2UA 4JZ3A 1U1TA 4M78E 1JRIA 2P84A 3INZA 4BE0A 1UECA 2MCNA 1BBZA 1RLQC 2QASA 4RTXA 1LOJA 1ZBJA 2LNVA 3LH5A 4X9CA 1VQLA 1I0CA 2RK1A 1Y7XA 3R6OA 2DLPA 2MPXC 3M58A 1YN8A 2AZVA 2C0TA 2LX9A 2XIDA 1WDXA 3L2QA 3I5SA 3SB2A 3H6ZA 3BFMA 2ECZA 1Z9ZA 1KHCA 3HTRA 1UGRB 3QHSA 4FYVB 3OW2A 1VQPA 2DL8A 4XTYA 3PNWC 3EFOA 4GLMA 1VQ8T 1PNJA 1K9MU 3M0RA 2HQEA 3H0IA 1GFCA 2YRDA 1I81A 1SHFA 1Q82U 1QCNA 3I55A 3OYEA 3GLXA 2M16A 2DD5A 1WI7A 2MOXA 1J3TA 2QYZA 1OX9A 4C5IA 2MF2A 4OF1A 4OMMA 4J5YA 2K2MA 1QVPA 5CCAA 1QP2A 2KMTA 2XU8A 1JU5C 3VU3C 1HSQA 1JB0E 3PT9A 4LUDA 1H92A 4C8QG 4EMGA 4R55A 4O6JA 3MPUB 1I07A 1AEYA 4OMFB 4XTUA 1ZHIA 2RPNA 4F04B 3QG1A 1WQ7A 4D8KA 2X4YA 4C92F 1QCOA 2RHIA 2IPOB 4BE2A 3GOXA 1Q86R 5GANf 4BACA 1M3AA 3CCLA 2WSEE 1K9AA 3HRTA 3MKDA 9ATCB 3CCVQ 1OZ3A 4OVAA 2EGAA 4PKCC 3QYGB 4Z8AA 1UGVA 1C0MA 1G2BA 2RHUA 1RAAB 5J39A 3JCMd 4A53A 3CPWA 2YHTA 3H8ZA 2QEXA 2DVJA 2IVWA 2PVOB 2K3XA 2BZYA 1WA7A 1OU9A 4HA8A 2NUZA 1TOVA 3M5AA 1YWOA 2EQMA 3CCEA 4MMKA 3OB9A 4M7AA 3WVDB 1MHNA 1BB9A 3X28B 4N0AA 4AFZC 1V29B 3CCJT 1S1NA 2FPDA 1YNZA 2XDBA 3EAEA 1AZEA 4A54A 2J05A 1U8RA 5D6WA 2E3IA 5KYYB 5FRMA 4RKUE 1SF9A 3JB9J 3SDZA 2XMFA 5L8RE 2OTLA 2FL7A 3MO8A 2X3WD 2X4JA 2ATCB 3FC3A 2ABLA 3M59A 1BIAA 1AWWA 1BI1A 2V8IA 3EFSA 1RADB 5KYUA 3A1PA 2F2XA 1KC8C 1KQSS 4R0KA 5IHNA 4FYXB 4C5EA 3PMTA 3V8KA 3UT1A 1S72A 3TQ7P 2E4HA 4OB3B 3RMQA 2H3EB 3CCLT 3QZ5B 1ZSZB 2EPDA 2LCSA 5IN1A 1E7OA 2LT1A 2RMOA 2O9SA 1IRXA 1M3CA 1I5OB 2KNBB 3J7AF 1SRLA 1E6GA 2PZ1A 3QJYA 5I2SA 4N0AC 3PFSA 1G3TA 3JV3A 2L3QA 2J06A 5FU7C 4M78F 2E1HA 4C92C 4ZN1A 1ZLMA 4R56A 2DZCA 3GNFB 5KH6A 1OX8A 3RKXA 2YRVA 4ANJA 2LJ0A 3RKWA 1UFFA 2BE9B 3DKMA 3OQ5A 1VQNT 1W2BP 2OTJA 1WFWA 4P5NA 2RI3A 4N4GA 1IGUA 4M75G 2KBTA 2O4XA 3C4SA 2OTJQ 2RJDA 4C92A 4OGEA 1IHWA 2QAZA 4RG2A 5GANd 4J7FA 4L59A 4CRIA 4PJMA 1D1AA 3QWXX 1Y07A 2F2WA 1MMAA 3EGUA 3VS6A 1RAEB 3M0SA 1MGQA 3I56Q 4ZTJA 2KK4A 2GCXA 3GP8A 4BDZA 3CCEQ 4FM4B 3CBPA 5A0GA 3PGGA 3JRZA 3X20B 3JAME 3ASKA 2CUDA 2ED1A 1NJIR 1N8RU 1D0YA 1WXTA 1M1KC 4DOVA 1JJ2P 1VYVA 1FYNA 2HKNA 2H8HA 2F5TX 2D8HA 5FLXE 3I56T 4LE9A 4LXCA 3R6NA 4KGVB 5KE3A 2KXCA 1KJWA 2J6FA 1W2BS 2JS2A 2OAWA 2VGNA 2JUFA 4C0ZA 1WHGA 1OEBA 2KDSA 3M4GA 5GANj 2E65A 1MMGA 4L5GA 3OBYA 3ZFJA 4C0DC 4OB2B 3QYHB 3CCUQ 2LQNA 4JRIA 2YUPA 4M7AC 1YIJT 1X27A 3GNGA 4Q5WA 4M7DF 2VKNA 3CMEA 1FWZA 5KE2A 2VWFA 1VQMQ 3H9NA 3RIRA 2F1LA 2KR3A 2M9UA 8ATCB 5LJ5f 4PJOB 5IH2A 1U06A 1YHQT 2I0NA 2DIQA 3DLMA 2VXEA 3FDRA 2SRCA 4BD3A 2QI2A 2JJ9A 1ZX6A 2L3PA 5CR2A 1QMCA 3EH1A 1JXOA 3OS2A 1Y71A 3EFOB 8AT1B 1Y0MA 2DMOA 3S3OA 3F70A 3MHXA 2X3XD 2DERA 4PNOA 5LJ5g 1NLPC 1SHGA 2HBWA 2QA4Q 4FSSA 1K1ZA 1I4K1 2O9VA 4ZTFA 2OX7A 1SSFA 3L2ZA 2V8JA 2MMPA 3L2UA 3CCRT 4C8QC 5GAMd 4JPBW 3NFCA 1VQMA 2RI5A 1KC8R 1QQJA 2JTEA 4XU0A 4B9XA 4C8QD 2PTKA 3JB9F 1KD1U 3TREA 4LUEA 5IT9E 4BB7A 3KBGA 1OOTA 3VS7A 4GY5A 4C92G 2DPPB 3VUBA 3OYHA 3C0CA 1G3SA 5D6XA 2F5KA 2NUPA 4DOWA 1X2QA 4LNPA 2OTLQ 1WJSA 4AG2C 1TSFA 3OYLA 3CCMT 1D1CA 1VYTA 1N8RC 1M1KU 3QJ6A 3S6WA 1YITT 4A4FA 1WX6A 3CCRQ 2GF7A 2RJCA 1Y57A 1KQSA 4ESRA 4XAXB 3FJPA 1PKSA 5CQXA 1EX4A 2DM1A 1AD5A 2NWMA 3OYMA 4C0GA 4JRPA 1BI2A 2Y4YA 4F17A 1VQKT 1YFNA 2E3HA 1H3ZA 3NTKA 1I1JA 2ENMA 3OYBA 4OGCA 4ZNXA 1D09B 2C0IA 2KT8A 2VV5A 1B3QA 4E7HA 1GRIA 3SWNC 1M27C 5GAMf 5J26A 3NHNA 1Q82C 4HVWA 1U5SA 3HRSA 2AK5A 2QQRA 4NL2A 3I56A 2LRQA 3JB9H 2EYWA 1VQ4Q 1K73R 4M7DC 2CS7A 1VQ5A 1QCFA 4OP0A 4JS5A 2D8JA 4RUGA 1G3YA 3RDVA 2K5LA 3OS1A 2YT6A 1ARKA 1YJ9A 1CKAA 2QQAA 1ABOA 2HSEB 2DJZA 4RTYA 5CKEA 3QSUA 2AIRB 3G4SA 2BTTA 4IUTA 1M30A 1PD1A 5KYXB 1V1CA 5CK9A 3CCST 1WYXA 3QZ9B 5FROA 1N8RR 3JCMe 2MI6A 1TWBA 4M75A 4A63B 1AWXA 1VOMA 3RUXA 3CC7A 3BDUA 3E19A 4M7AG 5FWBA 2EBPA 4N4HA 4N4IA 1GFDA 1G5VA 1NYFA 5DLOA 2QQSA 2EQJA 2HQXA 4M75D 1NZ9A 1WHJA 3CC4T 2YUOA 3VS5A 1KD1C 2ED0A 2DXBA 1ZSZA 2KEAA 3GIBA 5GJVB 2LJ1A 5LJ5d 4M75C 2YXYA 2DTHA 5I11A 3EG2A 1QP3A 1OPKA 2JVVA 4A4EA 2M51A 3OYCA 4RTUA 4J6WA 1UJYA 4CC2A 4JDSA 2ZZDA 4FIBA 1XQHA 3NPFA 1IHVA 4M4ZA 3SD4A 4IUPA 1M3BA 1YWPA 1SG5A 2D6FA 4M78A 1WGSA 3NTHA 4M77F 1VQ7A 4CC7A 2RQUA 1HK9A 3A5ZB 3REBB 4MMLA 1N9RA 3A8GB 3TEEA 2JW4A 2FPFA 1QW1A 1RUWA 3G1JA 1K8AC 2DXTA 1ZUKA 4D8DA 2HD0A 3Q1JA 3CPFA 1K0XA 2XICA 4JZ4A 3HKSA 1ZSZC 2LC4A 2YLBA 4AMCA 5C0MA 2RM4A 2K5FA 1XOVA 4OMOA 2YRCA 1KQSP 2IG0A 2CZ0B 1VQOQ 3JSCA 3FEOA 3RERA 2BE7D 3VS1A 4MDWA 3CCUA 1M90R 2QA4A 1SKUB 2D9TA 1WHMA 4DQ2A 2A7YA 2E10A 3E9GA 1Q86C 1Q81U 1WXBA 2L0AA 3VRZA 4C92B 4RG8A 2MWPA 1T3LA 2RHZA 2HSPA 2MYSA 4XTXA 2HDAA 4RTZA 1M9SA 1X6GA 2QEXT 1YITQ 4RMOA 1M5Q1 3FIFA 3MEUA 2DNUA 2KI7A 4RTVA 5GAOp 4X34A 3GF5A 4PJOG 2BUDA 3EG9B 1PCXA 4PFPA 2FB7A 3DB4A 2D0NA 2FHDA 3JCMQ 2RQWA 1HJDA 2CP2A 5KYWA 1XNIA 1X2KA 3EGXB 4HCCA 3I55Q 3QUIA 2RJEA 2JNGA 1YJWT 2ZPIB 4PJNA 3QIIA 4LDVA 4HT9A 2HAXA 3KXTA 3OYAA 1KC8U 1JEGA 3HPWA 3KFVA 1O75A 1VQPQ 4WF2A 2QK0A 3L2VA 5KYXA 5LJ3h 4OMQA 2ZPBB 1K4US 3CQTA 2E5QA 1R0BG 2QQBA 5GAN7 1UEBA 1GL5A 2HNIA 2CZ1B 4ZGJB 4JS4A 3HFOA 1C1AA 2K2VA 1Y96A 2BZ8A 4M7AD 2VUBA 1PWTA 2OJ2A 3PE0A 1WHHA 4PFZA 2CP0A 4E7SA 1X75C 3HL8A 3T9NA 1WNLA 3JCMb 2LQWA 1VQ6T 2CKKA 5GAN6 3PIPA 3M0PA 2P0KA 3CC2Q 2EJFA 4LDUA 4LD6A 5CKFA 2EIFA 4AFQC 3CMAA 4PL6A 2ZCFB 1M90U 1OZ2A 2FRYA 1VQ9Q 1ABQA 4ME7A 2E41A 2HMAA 1EZZB 3OW2S 5GAOn 4M7AF 4J9HA 2KE9A 3RESA 3MP8A 5A0LA 2VVKA 2PVDB 3EG0A 5LJ3d 3N5BB 2FRWA 3JCMf 3CD6A 1KQ2A 3JB9I 1BU1A 4BDYA 1W6XA 2NUTA 2CP5A 1FMWA 4PFOA 2L2PA 2DXUA 5GANg 3MP1A 4QW2A 4J6XA 1OQKA 2EYZA 2KXDA 4Y92A 2DKGA 4XU2A 3HP9A 1MV0B 1NEGA 5A0DA 3LLRA 1S72T 3OY9A 5GANh 3FRNA 3JCMX 4KRTA 1K8AU 4J6YA 3RMSA 2DTIA 4PJOC 3EGDA 1ACMB 1UGPB 1UHFA 1YI2A 2ROTA 4XTZA 1JJ2S 3IQLA 2YDLA 3OYFA 4IIOA 3VUZA 1N9SA 2LMJA 4QVDA 2KROA 4BI4A 1YJNT 2RQVA 1GCPA 1RI0A 3UF4A 4AFSC 2RF0A 3OMGA 3A8HB 1UG1A 4MZTA 1NPPA 1LPLA 4M75E 2GGRA 5HK0A 4EDUA 3M9QA 3HSBA 1Y96B 2O4XB 3THKA 2EWNA 4X9DA 1WXUA 1WHLA 4A4HA 5EG2A 3CCJA 2EQUA 1VQOT 1FX7A 2NLUA 3KUFA 3V8JA 2DX1A 1PRLC 4O5VA 4J9GA 2WSFE 5D7UA 2QTVA 4CI0C 3P8BB 2VYTA 5GAN4 5HY6A 5HCKA 4NOYA 3EFRA 3EGXA 3RKYA 5LJ3f 2AZSA 2QQ9A 2RI2A 4XTWA 1X69A 2CP3A 4A4GA 1Q7YR 5EC7A 2M1HA 1Q86U 2CZ7B 5HK3A 2HL5C 3UDCA 1N27A 1TUGB 4J9BA 5FU6C 4JLGA 3J81E 2JT4A 4E47A 2RH2A 2LCLA 3MEVA 1B34B 4FT4A 1D1BA 1YCSB 5A2QE 1KIKA 1YIJQ 2X4WA 5AYFA 3BW1A 2RK2A 4XK8E 3VYGA 2KRSA 3SFMA 1BCMA 3CC2T 2LDMA 3UPUA 1BI3A 4WCIA 4DEYA 4BE1A 2LCCA 1MV3A 5KCHA 2BZXA 5GAMg 1PSFA 2RO0A 3CBOA 1VQ4T 4M77C 4EMHA 4KGZB 4BY6C 2AT1B 1VIFA 2DD4A 1VQNQ 2DL5A 1G83A 1IZ6A 4QT7A 5IXBA 5DLQE 2V1RA 4IUVA 1RAHB 2DFUA 5GANe 2A37A 2HQHA 4GLKA 2K3BA 1B34A 3SWNA 5GAN8 1PSEA 3CCSQ 1IXDA 4ZGEB 4LDXA 4ZN3A 1P92A 4Z88A 4E6RA 4BI3A 1YI2Q 1H8KA 1OI1A 1AWOA 1YBYA 2YLCA 3EHRA 4DBFA 1MMDA 2L5QA 3VV0A 3MCAB 4NL3A 2D0QB 2QTXA 1JBMA 5GAN2 1I5LA 4C8QB 2ZPGB 4J9IA 2J6OA 1AT1B 2G3RA 4PJOF 1JXMA 2W0ZA 4TVRA 3M55A 1M2VB 2JN0A 4KUDK 3OS5A 3CC4Q 5AT1B 2E70A 1OYXA 2KRMA 1K9MC 2FZKB 1X43A 2E6NA 4F14A 4OMNA 1VQLQ 4C0DB 2DE0X 2M02A 1YJNA 3OYGA 3CD6Q 3VKIA 4EMKC 3G4ST 3CBMA 3M0TA 4E7IA 3MJXA 2RQTA 1VQ4A 2JM8A 4E7ZA 3LX7A 2HL3A 5J3BA 4VUBA 1Z9QA 4M77B 3H0HA 4A4KA 2MIOA 3P8HA 3V7CA 2CH4W 3OW2P 2DBMA 2DRMA 1QVGA 2KRNA 4HVUA 1R8OB 3JCMJ 3O8VA 1I8FA 1IGQA 3URGA 1YJNQ 4E7LA 1M8VA 5I2MA 4DBQA 2K9GA 1UB4A 1M90C 2DJQA 1GBQA 3TVTA 1VQPT 2JMCA 1TUDA 2K4YA 3QPHA 1M2OA 2QDLA 1RAIB 1GCQC 2JTFA 2P0QA 1BIBA 3DLLA 1PC0A 3CMAT 2M0OA 4IUQA 2OI3A 2V26A 1ZA1B 3NTIA 2DYIA 3TU4K 1AHJB 3CXCP 1N5ZA 3G6EA 2VB6A 2KYMA 2FZCB 4D6WA 1D0XA 1LCKA 1VQ6Q 4JUVA 3JCMW 1GCQA 3CCMQ 4DA4A 1RACB 5LJ3g 2PUOB 1A0NB 2A3LA 3CC2A 3V7SA 3TSWA 3EG9A 2QEXQ 3OSVA 3LWHA 1PG5B 3C95A 2DO3A 4LN2A 5IHKA 4HT8A 4IKFA 2X51A 3NGPA 5GAOq 4Z02A 1Q7YC 2GFAA 1CKBA 3OA6A 1VUBA 3U23A 4EPCA 3FLGA 1YHQA 4PJJA 1Q95G 5GAN5 4OB1B 3A8MB 3VS2A 3G71T 1W1FA 1WLPB 3C12A 1M1FA 2DZ9A 1E6HA 2CREA 5LL6S 1W4SA 2ESWA 2LQKA 3LGLA 4Y91A 3SWNB 2BKDN 2B8AA 1NYGA 3GBQA 2EJGA 4KT0E 2RN8A 3JB9G 2LP5A 2PU9B 3QWYA 5GAOm 3OYKA 1QVFA 2L3RA 1VQ6A 1BCOA 1ZUYA 3VS4A 2O88A 2LZ6B 1FXXA 4M7DB 2V8KA 1SPKA 2OAUA 5GMKl 4E7JA 1K8AR 1QWFA 3OYYA 4J9EA 4F16A 3QDFA 5KYWB 1YJWA 2FEIA 2JTMA 2LQ8A 2O2OA 4KH1B 5LJ5e 1G8XA 4IIMA 2GTOA 4LDYA 2DEUA 4EMKA 1KHIA 4QKUA 4OMPA 3TCJA 4FYYB 3A8OB 3UWNA 2DRKA 4HVVA 1K73C 1PHTA 2RD1A 2YUQA 2MWOA 2WSCE 3D7SB 4PJLA 4UC4A 2DTOA 2DXCA 5GJWB 1UUEA 2XKOC 2HZYA 1AZGB 2F2VA 3JCMg 2YSQA 3WXMB 2IIMA 1LVKA 1FMKA 1QWEA 2A0FB 3C94A 4KBMB 3S3NA 1N6AA 3RR6A 1W2BA 4KH0B 2EYQA 2HCKA 4FW1A 2CP7A 5CQYA 1K73U 3L2WA 2XD0A 3O5ZA 1VQLT 2WACA 3LWIA 5FU6B 3ME9A 2VXFA 1KFZA 4BY6B 1Q81C 2SEMA 2QA4T 2A36A 1EFNA 2COYA 2L3SA 1WIEA 3EG1A 2PQWA 3OSSC 3REAB 4M77G 5GMKm 2EKOA 4ELZC 3CC7Q 2L89A 4J8OA 2EKHA 4AT1B 1VIEA 1F1BB 1D3BB 1W70A 1R0CB 4AG1C 1K76A 1MNDA 2XDPA 1UGQB 4KGXB 5ECAA 3OS0A 2CSQA 2EGEA 2EQIA 4K11A 2R57A 3CMET 1D3BA 4C5GA 3OYDA 3M53A 3VJPA 2C0OA 2CT3A 5LJ5h 2I2LA 4JJDA 1NJIC 1VQ5Q 5I22A 4PJOA 1XJWB 1X01A 2DVEA 4M7AB 3DB3A 5CIUA 3CCSA 1VYUA 2CP6A 2D1XA 2DAQA 3CC7T 1NE8A 1OV3A 2PVGB 4MZMA 1GBRA 1GXIE 1NEBA 3CMAQ 2PNIA 3EGDB 2K6DA 3ZEHA 2DL7A 2NYSA 3OYNA 4JRKA 4HCKA 2B86A 3JCMV 3META 5GAMh 3CXCS 1TS9A 2CSIA 4C0FA 3LGFA 4M77D 3V7RA 3G4SQ 2RJFA 4PJOE 2KYBA 2RNAA 5CKHA 1EIFA 1JJ2A 4RTTA 4CC3A 1VQ5T 1SSHA 1KK7A 3M0QA 2GNCA 3JCMP 2CYZB 4C5HA 4RCBA 4GBQA 4QQ6A 5HKCA 3MEAA 4EMKB 3G6ET 3JB9D 1ZA2B 1YIJA 3E9FA 3G7ZA 5KYNA 5GAN3 4M7AE 1YJ9T 4JRQA 4LD9K 4OMLA 1TUCA 1VQ7T 4JJBA 2HBPA 3ER0A 1M1KR 2OTLT 2V1QA 3M0UA 2CH4A 4FW2A 4PJOD 3I9QA 1M4ZA 2JOYA 1X6OA 3BE3A 4M75F 4FYWB 3BDLA 2DETA 2M0YA 2DK3A 3SEMA 2EVRA 4FSXA 5IXFA 1OULA 2VASA 1KG1A 3CCMA 1JO8A
chains in the Genus database with same CATH topology
2ECZA 2AK5A 2AKLA 1Z9ZA 2EYWA 2DL8A 1T0HA 1QCFA 4GLMA 1PNJA 2D8JA 1YP5A 3M0RA 4RUGA 2DL5A 1G83A 3H0IA 1GFCA 1AVZC 4QT7A 3VRYA 5IXBA 1SHFA 2YT6A 1ARKA 1CKAA 2V1RA 1B07A 1WI7A 2MOXA 2A37A 3UATA 1J3TA 2JXBA 2K3BA 4CC4B 1AWJA 1ABOA 2GQIA 4RTYA 2A28A 2BTTA 4OMMA 1M30A 2K2MA 1V1CA 2FPEA 1WYXA 2JM9A 2RQRA 2J7IA 1JU5C 4Z88A 2CT4A 4E6RA 1HSQA 1H8KA 1JQQA 1AWXA 2EGCA 4LUDA 4A63B 1AWOA 1H92A 3EHRA 3EG3A 1PKTA 5FWBA 2EBPA 1SEMA 1UHCA 1GFDA 1I07A 1AEYA 4JJCA 1RI9A 1NYFA 4J9IA 2J6OA 2KGTA 1JXMA 2W0ZA 4EIKA 2RPNA 3TSZA 1QKWA 1T0JA 4D8KA 2YUOA 3VS5A 5L23A 1T3SA 2ED0A 2HEQA 2KEAA 5GJVB 2LJ1A 4AFUC 2KRMA 1M3AA 1X43A 5I11A 4F14A 3EG2A 4OMNA 1OPKA 1K9AA 2DE0X 2M51A 4RTUA 2EGAA 1UJYA 4CC2A 4Z8AA 1UGVA 2A08A 1G2BA 2DF6A 3NPFA 3M0TA 2RQTA 4M4ZA 1M3BA 2JM8A 1YWPA 2DVJA 1RLPC 1Z9QA 3H0HA 2MIOA 2CH4W 1QKXA 2BZYA 1WA7A 2DBMA 4CC7A 2NUZA 2RQUA 2DRMA 2LNHB 3REBB 1YWOA 2KRNA 4HVUA 1NLOC 2JW4A 1BB9A 2FPFA 2KT1A 2JS0A 2ROLA 1RUWA 4AFZC 2YUNA 1S1NA 2FPDA 1YNZA 1ZUKA 4D8DA 1AZEA 1K0XA 2J05A 4JZ4A 3EHQA 3ULRB 2K9GA 2DJQA 1GBQA 2AKKA 3TVTA 2CDTA 2JMCA 2G6FX 1TUDA 1UJ0A 2QDLA 2XMFA 3H41A 1GCQC 1XOVA 2X3WD 4OMOA 2DL4A 2ABLA 2LX7A 1AWWA 2F2XA 1BK2A 2OI3A 3VS1A 1VA7A 4R0KA 5IHNA 1N5ZA 1X6BA 1WXBA 2L0AA 2KYMA 2EPDA 2LCSA 3VRZA 1LCKA 1E7OA 1GCQA 2RMOA 2O31A 2O9SA 2KNBB 1M3CA 1SRLA 1E6GA 1A0NB 4J9DA 3I5RA 1T3LA 2PZ1A 4DEXA 2HSPA 3TSWA 2HDAA 3JV3A 2L3QA 4LN2A 4RTZA 5IHKA 3VS0A 2J06A 1X6GA 2DA9A 3NGPA 2DNUA 1CKBA 1ZLMA 2DILA 4RTVA 1MUZA 3U23A 2FO0A 2DL3A 2LJ0A 3FJ5A 1UFFA 2D0NA 1WFWA 2RQWA 5IHIA 5FWCA 1M8MA 1HJDA 1NG2A 2EYXA 3VS2A 1W1FA 1WLPB 1X2KA 1ZSGA 2LJ3A 1E6HA 2CREA 2KBTA 3ZL7C 2ESWA 4ORZA 1JEGA 3KFVA 3QWXX 2F2WA 3EGUA 1NYGA 3GBQA 3VS6A 3M0SA 2RN8A 4OMQA 1K4US 2LP5A 3CQTA 5FW9A 2GTJA 3QWYA 1GL5A 2BZ8A 2FG0A 1ZUYA 3VS4A 1PWTA 2OJ2A 3H0FA 3PE0A 2O88A 2LZ6B 2CUDA 2ED1A 1SPKA 1QWFA 1WXTA 2LQWA 1VYVA 4J9EA 4HXJA 4F16A 3M0PA 1FYNA 2CUBA 2FEIA 2H8HA 3I35A 2O2OA 2D8HA 3RNJA 4IIMA 2GTOA 4LE9A 3R6NA 2KXCA 4AFQC 4OMPA 2FRYA 2K7AA 1ABQA 1KJWA 2J6FA 2JS2A 2OAWA 1HD3A 1UTIA 2DRKA 4HVVA 1PHTA 2YUQA 1OEBA 2E5KA 5GJWB 4J9HA 2KE9A 1TG0A 1UUEA 1PRMC 1AZGB 2F2VA 2VVKA 2YSQA 2IIMA 2JMAA 3EG0A 1K0SA 2P4RA 1FMKA 2FRWA 1QWEA 2LQNA 4J9CA 2EYYA 2YUPA 1BU1A 1W6XA 1H3HA 1X27A 2GBQA 2HCKA 2L2PA 4RTWA 2VKNA 3O5ZA 2EYZA 2VWFA 2KXDA 2KR3A 4Y92A 1UE9A 1OPLA 1KFZA 1MV0B 1NEGA 5IH2A 3SHWA 2SEMA 2A36A 1EFNA 1U06A 2L3SA 1WIEA 3EG1A 3UA6A 2EW3A 2I0NA 3REAB 4KRTA 2SRCA 2W10A 1UHFA 1ZX6A 2DYBA 2EKHA 2ROTA 2J6KA 2L3PA 3IQLA 2YDLA 1JXOA 4IIOA 1W70A 1QLYA 2LMJA 3A98A 3NMZC 2KROA 4AG1C 1K76A 1Y0MA 2DMOA 2RQVA 1GCPA 2X3XD 3UF4A 1NLPC 5ECAA 4AFSC 2CSQA 2RF0A 1SHGA 2HBWA 3UA7A 2EGEA 2EQIA 4K11A 4FSSA 1UG1A 4X1VA 1K1ZA 4Z89A 2O9VA 1UDLA 2GGRA 2C0OA 2CT3A 4JJDA 3THKA 5I22A 2K79A 4JPBW 3VS3A 1VYUA 1AOJA 1WXUA 3RBBB 2D1XA 3PVQA 1NM7A 1OV3A 1CSKA 2JTEA 1GBRA 2PTKA 2DBKA 1NEBA 4LUEA 1KSWA 2DX1A 2PNIA 3PVLA 1PRLC 4J9GA 2K6DA 2DL7A 1OOTA 3VS7A 4HCKA 2B86A 3C0CA 5HCKA 1X2QA 4LNPA 1IO6A 2CSIA 4AG2C 4J9FA 1VYTA 2AZSA 2KYBA 1U3OA 2RNAA 1SRMA 1X69A 1ZUUA 4RTTA 4CC3A 5EC7A 1WX6A 1SSHA 4JZ3A 3M0QA 2GNCA 1Y57A 4ESRA 4GBQA 1PKSA 2DM1A 1UECA 2MCNA 1BBZA 1AD5A 1RLQC 2NWMA 4J9BA 4RTXA 3LH5A 1ZBJA 4OMLA 1TUCA 2JT4A 4F17A 4JJBA 1I0CA 1KIKA 1YCSB 1I1JA 2ENMA 4ZNXA 2DLPA 2V1QA 2KT8A 2C0IA 2KRSA 3M0UA 2CH4A 1YN8A 1B3QA 3I9QA 2AZVA 2C0TA 1GRIA 4WCIA 2M0YA 4DEYA 1WDXA 1MV3A 1M27C 3SEMA 3NHNA 2EVRA 3I5SA 5IXFA 4HVWA 1U5SA 2BZXA 1JO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECZ A;  2AK5 A;  2AKL A;  1Z9Z A;  2EYW A;  2DL8 A;  1T0H A;  1QCF A;  4GLM A;  1PNJ A;  2D8J A;  1YP5 A;  3M0R A;  4RUG A;  2DL5 A;  1G83 A;  3H0I A;  1GFC A;  1AVZ C;  4QT7 A;  3VRY A;  5IXB A;  1SHF A;  2YT6 A;  1ARK A;  1CKA A;  2V1R A;  1B07 A;  1WI7 A;  2MOX A;  2A37 A;  3UAT A;  1J3T A;  2JXB A;  2K3B A;  4CC4 B;  1AWJ A;  1ABO A;  2GQI A;  4RTY A;  2A28 A;  2BTT A;  4OMM A;  1M30 A;  2K2M A;  1V1C A;  2FPE A;  1WYX A;  2JM9 A;  2RQR A;  2J7I A;  1JU5 C;  4Z88 A;  2CT4 A;  4E6R A;  1HSQ A;  1H8K A;  1JQQ A;  1AWX A;  2EGC A;  4LUD A;  4A63 B;  1AWO A;  1H92 A;  3EHR A;  3EG3 A;  1PKT A;  5FWB A;  2EBP A;  1SEM A;  1UHC A;  1GFD A;  1I07 A;  1AEY A;  4JJC A;  1RI9 A;  1NYF A;  4J9I A;  2J6O A;  2KGT A;  1JXM A;  2W0Z A;  4EIK A;  2RPN A;  3TSZ A;  1QKW A;  1T0J A;  4D8K A;  2YUO A;  3VS5 A;  5L23 A;  1T3S A;  2ED0 A;  2HEQ A;  2KEA A;  5GJV B;  2LJ1 A;  4AFU C;  2KRM A;  1M3A A;  1X43 A;  5I11 A;  4F14 A;  3EG2 A;  4OMN A;  1OPK A;  1K9A A;  2DE0 X;  2M51 A;  4RTU A;  2EGA A;  1UJY A;  4CC2 A;  4Z8A A;  1UGV A;  2A08 A;  1G2B A;  2DF6 A;  3NPF A;  3M0T A;  2RQT A;  4M4Z A;  1M3B A;  2JM8 A;  1YWP A;  2DVJ A;  1RLP C;  1Z9Q A;  3H0H A;  2MIO A;  2CH4 W;  1QKX A;  2BZY A;  1WA7 A;  2DBM A;  4CC7 A;  2NUZ A;  2RQU A;  2DRM A;  2LNH B;  3REB B;  1YWO A;  2KRN A;  4HVU A;  1NLO C;  2JW4 A;  1BB9 A;  2FPF A;  2KT1 A;  2JS0 A;  2ROL A;  1RUW A;  4AFZ C;  2YUN A;  1S1N A;  2FPD A;  1YNZ A;  1ZUK A;  4D8D A;  1AZE A;  1K0X A;  2J05 A;  4JZ4 A;  3EHQ A;  3ULR B;  2K9G A;  2DJQ A;  1GBQ A;  2AKK A;  3TVT A;  2CDT A;  2JMC A;  2G6F X;  1TUD A;  1UJ0 A;  2QDL A;  2XMF A;  3H41 A;  1GCQ C;  1XOV A;  2X3W D;  4OMO A;  2DL4 A;  2ABL A;  2LX7 A;  1AWW A;  2F2X A;  1BK2 A;  2OI3 A;  3VS1 A;  1VA7 A;  4R0K A;  5IHN A;  1N5Z A;  1X6B A;  1WXB A;  2L0A A;  2KYM A;  2EPD A;  2LCS A;  3VRZ A;  1LCK A;  1E7O A;  1GCQ A;  2RMO A;  2O31 A;  2O9S A;  2KNB B;  1M3C A;  1SRL A;  1E6G A;  1A0N B;  4J9D A;  3I5R A;  1T3L A;  2PZ1 A;  4DEX A;  2HSP A;  3TSW A;  2HDA A;  3JV3 A;  2L3Q A;  4LN2 A;  4RTZ A;  5IHK A;  3VS0 A;  2J06 A;  1X6G A;  2DA9 A;  3NGP A;  2DNU A;  1CKB A;  1ZLM A;  2DIL A;  4RTV A;  1MUZ A;  3U23 A;  2FO0 A;  2DL3 A;  2LJ0 A;  3FJ5 A;  1UFF A;  2D0N A;  1WFW A;  2RQW A;  5IHI A;  5FWC A;  1M8M A;  1HJD A;  1NG2 A;  2EYX A;  3VS2 A;  1W1F A;  1WLP B;  1X2K A;  1ZSG A;  2LJ3 A;  1E6H A;  2CRE A;  2KBT A;  3ZL7 C;  2ESW A;  4ORZ A;  1JEG A;  3KFV A;  3QWX X;  2F2W A;  3EGU A;  1NYG A;  3GBQ A;  3VS6 A;  3M0S A;  2RN8 A;  4OMQ A;  1K4U S;  2LP5 A;  3CQT A;  5FW9 A;  2GTJ A;  3QWY A;  1GL5 A;  2BZ8 A;  2FG0 A;  1ZUY A;  3VS4 A;  1PWT A;  2OJ2 A;  3H0F A;  3PE0 A;  2O88 A;  2LZ6 B;  2CUD A;  2ED1 A;  1SPK A;  1QWF A;  1WXT A;  2LQW A;  1VYV A;  4J9E A;  4HXJ A;  4F16 A;  3M0P A;  1FYN A;  2CUB A;  2FEI A;  2H8H A;  3I35 A;  2O2O A;  2D8H A;  3RNJ A;  4IIM A;  2GTO A;  4LE9 A;  3R6N A;  2KXC A;  4AFQ C;  4OMP A;  2FRY A;  2K7A A;  1ABQ A;  1KJW A;  2J6F A;  2JS2 A;  2OAW A;  1HD3 A;  1UTI A;  2DRK A;  4HVV A;  1PHT A;  2YUQ A;  1OEB A;  2E5K A;  5GJW B;  4J9H A;  2KE9 A;  1TG0 A;  1UUE A;  1PRM C;  1AZG B;  2F2V A;  2VVK A;  2YSQ A;  2IIM A;  2JMA A;  3EG0 A;  1K0S A;  2P4R A;  1FMK A;  2FRW A;  1QWE A;  2LQN A;  4J9C A;  2EYY A;  2YUP A;  1BU1 A;  1W6X A;  1H3H A;  1X27 A;  2GBQ A;  2HCK A;  2L2P A;  4RTW A;  2VKN A;  3O5Z A;  2EYZ A;  2VWF A;  2KXD A;  2KR3 A;  4Y92 A;  1UE9 A;  1OPL A;  1KFZ A;  1MV0 B;  1NEG A;  5IH2 A;  3SHW A;  2SEM A;  2A36 A;  1EFN A;  1U06 A;  2L3S A;  1WIE A;  3EG1 A;  3UA6 A;  2EW3 A;  2I0N A;  3REA B;  4KRT A;  2SRC A;  2W10 A;  1UHF A;  1ZX6 A;  2DYB A;  2EKH A;  2ROT A;  2J6K A;  2L3P A;  3IQL A;  2YDL A;  1JXO A;  4IIO A;  1W70 A;  1QLY A;  2LMJ A;  3A98 A;  3NMZ C;  2KRO A;  4AG1 C;  1K76 A;  1Y0M A;  2DMO A;  2RQV A;  1GCP A;  2X3X D;  3UF4 A;  1NLP C;  5ECA A;  4AFS C;  2CSQ A;  2RF0 A;  1SHG A;  2HBW A;  3UA7 A;  2EGE A;  2EQI A;  4K11 A;  4FSS A;  1UG1 A;  4X1V A;  1K1Z A;  4Z89 A;  2O9V A;  1UDL A;  2GGR A;  2C0O A;  2CT3 A;  4JJD A;  3THK A;  5I22 A;  2K79 A;  4JPB W;  3VS3 A;  1VYU A;  1AOJ A;  1WXU A;  3RBB B;  2D1X A;  3PVQ A;  1NM7 A;  1OV3 A;  1CSK A;  2JTE A;  1GBR A;  2PTK A;  2DBK A;  1NEB A;  4LUE A;  1KSW A;  2DX1 A;  2PNI A;  3PVL A;  1PRL C;  4J9G A;  2K6D A;  2DL7 A;  1OOT A;  3VS7 A;  4HCK A;  2B86 A;  3C0C A;  5HCK A;  1X2Q A;  4LNP A;  1IO6 A;  2CSI A;  4AG2 C;  4J9F A;  1VYT A;  2AZS A;  2KYB A;  1U3O A;  2RNA A;  1SRM A;  1X69 A;  1ZUU A;  4RTT A;  4CC3 A;  5EC7 A;  1WX6 A;  1SSH A;  4JZ3 A;  3M0Q A;  2GNC A;  1Y57 A;  4ESR A;  4GBQ A;  1PKS A;  2DM1 A;  1UEC A;  2MCN A;  1BBZ A;  1AD5 A;  1RLQ C;  2NWM A;  4J9B A;  4RTX A;  3LH5 A;  1ZBJ A;  4OML A;  1TUC A;  2JT4 A;  4F17 A;  4JJB A;  1I0C A;  1KIK A;  1YCS B;  1I1J A;  2ENM A;  4ZNX A;  2DLP A;  2V1Q A;  2KT8 A;  2C0I A;  2KRS A;  3M0U A;  2CH4 A;  1YN8 A;  1B3Q A;  3I9Q A;  2AZV A;  2C0T A;  1GRI A;  4WCI A;  2M0Y A;  4DEY A;  1WDX A;  1MV3 A;  1M27 C;  3SEM A;  3NHN A;  2EVR A;  3I5S A;  5IXF A;  4HVW A;  1U5S A;  2BZX A;  1JO8 A; 
#chains in the Genus database with same CATH topology
 1S72 Q;  2Z0W A;  5KYU B;  1M1G A;  2AKL A;  4E7K A;  5GMK e;  2K57 A;  3G6E Q;  4II1 A;  3V8L A;  4F7U G;  1T0H A;  1YP5 A;  5LJ3 j;  3CC4 A;  1LJO A;  3G71 Q;  1AVZ C;  3VRY A;  2LT4 A;  4ZGD B;  1V76 A;  3EH2 A;  3CCQ T;  1B07 A;  3HFN A;  4HKE A;  3UAT A;  2JXB A;  2P0P A;  5CVI A;  4CC4 B;  1VQK A;  1AWJ A;  3S3M A;  7AT1 B;  2GQI A;  5GAO r;  4XQ3 A;  1IRE B;  2A28 A;  2MAM A;  5CAI A;  2FPE A;  5CKB A;  2DEQ A;  2JM9 A;  3LYI A;  2HKQ B;  2RQR A;  4F7U B;  2J7I A;  2FZG B;  2RA2 A;  2CT4 A;  4M77 A;  3L1A A;  1JQQ A;  2EGC A;  3EG3 A;  1PKT A;  1SEM A;  1UHC A;  5LJ5 j;  1U1S A;  5D6Y A;  4FL6 A;  4JJC A;  3QO3 A;  1RI9 A;  4NS5 A;  2KGT A;  1RAF B;  5DM7 R;  3QDR B;  3M56 A;  5GMK i;  4EIK A;  3TSZ A;  1QKW A;  1T0J A;  2F69 A;  4PLL A;  4C92 D;  5L23 A;  1T3S A;  2HEQ A;  2K5I A;  2LTO A;  4AFU C;  2E12 A;  2MK5 A;  2XI9 A;  3OMC A;  1M2V A;  3CCV A;  5FRN A;  2A08 A;  2DF6 A;  2QG9 B;  2C06 A;  2NUP B;  1RLP C;  3OBW A;  4J7I A;  4ELY C;  2CZ6 B;  2KQW A;  2QDY B;  1QKX A;  3CEY A;  4QVZ A;  3OYJ A;  2XG8 D;  1WQW A;  5GAM e;  2LNH B;  3M4Y A;  1NLO C;  2EQK A;  4MZP A;  2GQV A;  2KT1 A;  4KUI A;  2JS0 A;  2ROL A;  2X4X A;  3LH0 A;  2Y4X A;  2YUN A;  4L6V 5;  3X24 B;  3CXC A;  2ZPF B;  3EHQ A;  3ULR B;  1Q81 R;  1VQ9 A;  2AKK A;  3CME Q;  1VQ8 A;  3MEW A;  2CDT A;  1YI2 T;  2H3J A;  2G6F X;  1UJ0 A;  1BKB A;  4FCY A;  3H41 A;  2ZGW A;  2DL4 A;  2RB6 A;  4HCZ A;  2DIG A;  2LX7 A;  2EFI A;  4YTL A;  4E2F B;  5KCO A;  1BK2 A;  1HYO A;  1ZBX A;  1VA7 A;  3PIO A;  3LW5 E;  1WJQ A;  2EAY A;  4M78 B;  5GMK h;  4B6M A;  1VQ7 Q;  1NBE B;  1UGS B;  2XHC A;  1B7T A;  3QBY A;  1BYM A;  1X6B A;  4IUR A;  2KAF A;  3CCV T;  2YWW A;  3CD6 T;  2O31 A;  4LDW A;  4V2S A;  4J9D A;  3I5R A;  2COZ A;  3VYH B;  4FT2 A;  4DEX A;  1NJI U;  4KUL A;  3P8D A;  3VS0 A;  1KD1 R;  2DA9 A;  2XDD A;  1XTD A;  4PK4 A;  2DIL A;  4OB0 B;  1MUZ A;  1QVF P;  2EJ9 A;  2FO0 A;  2DL3 A;  2VGM A;  3FJ5 A;  4MDX A;  1MMN A;  1TXQ A;  3M54 A;  2QGG A;  5IHI A;  5FWC A;  1M8M A;  4FU6 A;  1VQ8 Q;  1NG2 A;  3PMI A;  3CCU T;  2EYX A;  1WJR A;  1ZSG A;  2LJ3 A;  3FB9 A;  4M75 B;  2QXF A;  3CCQ A;  3ZL7 C;  3PTA A;  1TTH B;  3AHU A;  1VQN A;  2OTJ T;  4ORZ A;  1ZQ1 A;  1VQM T;  5GMK j;  4QQG A;  1WPY A;  4XU3 A;  2Y90 A;  5CKD A;  2X35 A;  2VC8 A;  1BI0 A;  5FW9 A;  2GTJ A;  2X9H A;  4B9W A;  2PUK B;  1H64 1;  1YJ9 Q;  2QGF B;  1QVG S;  4RCC A;  3CCR A;  2RHX A;  2FG0 A;  1VQK Q;  3H0F A;  4WTO B;  1YJW Q;  5IAY A;  4J83 A;  2ZPH B;  4M78 D;  4PLI A;  3G71 A;  4HCB A;  4M7D G;  1TU0 B;  1D0Z A;  1G3W A;  4HXJ A;  1VQO A;  1TH7 A;  2CUB A;  2FVU A;  3I35 A;  3RNJ A;  4M78 C;  4DBH A;  3QKJ A;  5LJ3 e;  1WZO A;  2K7A A;  1HD3 A;  1UTI A;  3A8L B;  1PD0 A;  2E5K A;  2ZPE B;  5I21 A;  1NPR A;  1TG0 A;  1PRM C;  3BY7 A;  2XK0 A;  2K3Y A;  4C8Q E;  2JMA A;  4JJN K;  1K0S A;  2P4R A;  2LVM A;  4M7D E;  4XU1 A;  4J9C A;  2EYY A;  1K9M R;  1H3H A;  3CCL Q;  2KVQ G;  4F7U A;  2GBQ A;  3GPL A;  6AT1 B;  2R5M A;  4RTW A;  1RAB B;  3CCJ Q;  2JZ2 A;  3E1S A;  1UE9 A;  1OPL A;  2KY9 A;  1RAG B;  1YHQ Q;  3SHW A;  1DJ7 B;  2AHJ B;  3UA6 A;  4QQD A;  2EW3 A;  1QVG P;  3M57 A;  1VQ9 T;  1KQ1 A;  2CGH A;  4C8Q A;  3HHT B;  1C6V X;  2W10 A;  2DYB A;  5KYY A;  4F7U F;  4M7D A;  3X26 B;  4ATO A;  2J6K A;  4XTV A;  1QLY A;  2BIV A;  4F7U E;  1HXD A;  3CCQ Q;  3A98 A;  2KSS A;  3HRU A;  3NMZ C;  2ZAE A;  3JCM h;  4BI8 B;  4M7D D;  2L8D A;  1WHK A;  3MP6 A;  4C92 E;  4C8Q F;  3ZBD A;  2GFU A;  3UA7 A;  2R5A A;  1Q7Y U;  1YIT A;  4X1V A;  1YCY A;  4Z89 A;  2COW A;  1FMV A;  3X25 B;  4M77 E;  1Q82 R;  1UDL A;  4IUU A;  4BUG A;  2FYK A;  5M9O A;  5C6S A;  5GAM j;  2P4T A;  3CPW P;  1QVF S;  1OU8 A;  2R58 A;  2RHY A;  1MNE A;  2E6Z A;  1R77 A;  2K79 A;  5FU7 B;  3VS3 A;  3L2R A;  5CO7 A;  1AOJ A;  3RBB B;  3CCE T;  3PVQ A;  4QVC A;  1NM7 A;  3JCM c;  3OYI A;  1CSK A;  2DBK A;  3L42 A;  3QXE B;  1KSW A;  3PVL A;  1RL2 A;  3AT1 B;  4JLI A;  3I55 T;  2E64 A;  5GAO l;  2NUT B;  1IB8 A;  1LNX A;  1O9S A;  3J80 E;  3CPW S;  1IO6 A;  4Y28 E;  4DBR A;  5DY9 A;  3WVE B;  4M78 G;  2O01 E;  4J9F A;  1U3O A;  1SRM A;  1ZUU A;  1PM3 A;  3E2U A;  4JZ3 A;  1U1T A;  4M78 E;  1JRI A;  2P84 A;  3INZ A;  4BE0 A;  1UEC A;  2MCN A;  1BBZ A;  1RLQ C;  2QAS A;  4RTX A;  1LOJ A;  1ZBJ A;  2LNV A;  3LH5 A;  4X9C A;  1VQL A;  1I0C A;  2RK1 A;  1Y7X A;  3R6O A;  2DLP A;  2MPX C;  3M58 A;  1YN8 A;  2AZV A;  2C0T A;  2LX9 A;  2XID A;  1WDX A;  3L2Q A;  3I5S A;  3SB2 A;  3H6Z A;  3BFM A;  2ECZ A;  1Z9Z A;  1KHC A;  3HTR A;  1UGR B;  3QHS A;  4FYV B;  3OW2 A;  1VQP A;  2DL8 A;  4XTY A;  3PNW C;  3EFO A;  4GLM A;  1VQ8 T;  1PNJ A;  1K9M U;  3M0R A;  2HQE A;  3H0I A;  1GFC A;  2YRD A;  1I81 A;  1SHF A;  1Q82 U;  1QCN A;  3I55 A;  3OYE A;  3GLX A;  2M16 A;  2DD5 A;  1WI7 A;  2MOX A;  1J3T A;  2QYZ A;  1OX9 A;  4C5I A;  2MF2 A;  4OF1 A;  4OMM A;  4J5Y A;  2K2M A;  1QVP A;  5CCA A;  1QP2 A;  2KMT A;  2XU8 A;  1JU5 C;  3VU3 C;  1HSQ A;  1JB0 E;  3PT9 A;  4LUD A;  1H92 A;  4C8Q G;  4EMG A;  4R55 A;  4O6J A;  3MPU B;  1I07 A;  1AEY A;  4OMF B;  4XTU A;  1ZHI A;  2RPN A;  4F04 B;  3QG1 A;  1WQ7 A;  4D8K A;  2X4Y A;  4C92 F;  1QCO A;  2RHI A;  2IPO B;  4BE2 A;  3GOX A;  1Q86 R;  5GAN f;  4BAC A;  1M3A A;  3CCL A;  2WSE E;  1K9A A;  3HRT A;  3MKD A;  9ATC B;  3CCV Q;  1OZ3 A;  4OVA A;  2EGA A;  4PKC C;  3QYG B;  4Z8A A;  1UGV A;  1C0M A;  1G2B A;  2RHU A;  1RAA B;  5J39 A;  3JCM d;  4A53 A;  3CPW A;  2YHT A;  3H8Z A;  2QEX A;  2DVJ A;  2IVW A;  2PVO B;  2K3X A;  2BZY A;  1WA7 A;  1OU9 A;  4HA8 A;  2NUZ A;  1TOV A;  3M5A A;  1YWO A;  2EQM A;  3CCE A;  4MMK A;  3OB9 A;  4M7A A;  3WVD B;  1MHN A;  1BB9 A;  3X28 B;  4N0A A;  4AFZ C;  1V29 B;  3CCJ T;  1S1N A;  2FPD A;  1YNZ A;  2XDB A;  3EAE A;  1AZE A;  4A54 A;  2J05 A;  1U8R A;  5D6W A;  2E3I A;  5KYY B;  5FRM A;  4RKU E;  1SF9 A;  3JB9 J;  3SDZ A;  2XMF A;  5L8R E;  2OTL A;  2FL7 A;  3MO8 A;  2X3W D;  2X4J A;  2ATC B;  3FC3 A;  2ABL A;  3M59 A;  1BIA A;  1AWW A;  1BI1 A;  2V8I A;  3EFS A;  1RAD B;  5KYU A;  3A1P A;  2F2X A;  1KC8 C;  1KQS S;  4R0K A;  5IHN A;  4FYX B;  4C5E A;  3PMT A;  3V8K A;  3UT1 A;  1S72 A;  3TQ7 P;  2E4H A;  4OB3 B;  3RMQ A;  2H3E B;  3CCL T;  3QZ5 B;  1ZSZ B;  2EPD A;  2LCS A;  5IN1 A;  1E7O A;  2LT1 A;  2RMO A;  2O9S A;  1IRX A;  1M3C A;  1I5O B;  2KNB B;  3J7A F;  1SRL A;  1E6G A;  2PZ1 A;  3QJY A;  5I2S A;  4N0A C;  3PFS A;  1G3T A;  3JV3 A;  2L3Q A;  2J06 A;  5FU7 C;  4M78 F;  2E1H A;  4C92 C;  4ZN1 A;  1ZLM A;  4R56 A;  2DZC A;  3GNF B;  5KH6 A;  1OX8 A;  3RKX A;  2YRV A;  4ANJ A;  2LJ0 A;  3RKW A;  1UFF A;  2BE9 B;  3DKM A;  3OQ5 A;  1VQN T;  1W2B P;  2OTJ A;  1WFW A;  4P5N A;  2RI3 A;  4N4G A;  1IGU A;  4M75 G;  2KBT A;  2O4X A;  3C4S A;  2OTJ Q;  2RJD A;  4C92 A;  4OGE A;  1IHW A;  2QAZ A;  4RG2 A;  5GAN d;  4J7F A;  4L59 A;  4CRI A;  4PJM A;  1D1A A;  3QWX X;  1Y07 A;  2F2W A;  1MMA A;  3EGU A;  3VS6 A;  1RAE B;  3M0S A;  1MGQ A;  3I56 Q;  4ZTJ A;  2KK4 A;  2GCX A;  3GP8 A;  4BDZ A;  3CCE Q;  4FM4 B;  3CBP A;  5A0G A;  3PGG A;  3JRZ A;  3X20 B;  3JAM E;  3ASK A;  2CUD A;  2ED1 A;  1NJI R;  1N8R U;  1D0Y A;  1WXT A;  1M1K C;  4DOV A;  1JJ2 P;  1VYV A;  1FYN A;  2HKN A;  2H8H A;  2F5T X;  2D8H A;  5FLX E;  3I56 T;  4LE9 A;  4LXC A;  3R6N A;  4KGV B;  5KE3 A;  2KXC A;  1KJW A;  2J6F A;  1W2B S;  2JS2 A;  2OAW A;  2VGN A;  2JUF A;  4C0Z A;  1WHG A;  1OEB A;  2KDS A;  3M4G A;  5GAN j;  2E65 A;  1MMG A;  4L5G A;  3OBY A;  3ZFJ A;  4C0D C;  4OB2 B;  3QYH B;  3CCU Q;  2LQN A;  4JRI A;  2YUP A;  4M7A C;  1YIJ T;  1X27 A;  3GNG A;  4Q5W A;  4M7D F;  2VKN A;  3CME A;  1FWZ A;  5KE2 A;  2VWF A;  1VQM Q;  3H9N A;  3RIR A;  2F1L A;  2KR3 A;  2M9U A;  8ATC B;  5LJ5 f;  4PJO B;  5IH2 A;  1U06 A;  1YHQ T;  2I0N A;  2DIQ A;  3DLM A;  2VXE A;  3FDR A;  2SRC A;  4BD3 A;  2QI2 A;  2JJ9 A;  1ZX6 A;  2L3P A;  5CR2 A;  1QMC A;  3EH1 A;  1JXO A;  3OS2 A;  1Y71 A;  3EFO B;  8AT1 B;  1Y0M A;  2DMO A;  3S3O A;  3F70 A;  3MHX A;  2X3X D;  2DER A;  4PNO A;  5LJ5 g;  1NLP C;  1SHG A;  2HBW A;  2QA4 Q;  4FSS A;  1K1Z A;  1I4K 1;  2O9V A;  4ZTF A;  2OX7 A;  1SSF A;  3L2Z A;  2V8J A;  2MMP A;  3L2U A;  3CCR T;  4C8Q C;  5GAM d;  4JPB W;  3NFC A;  1VQM A;  2RI5 A;  1KC8 R;  1QQJ A;  2JTE A;  4XU0 A;  4B9X A;  4C8Q D;  2PTK A;  3JB9 F;  1KD1 U;  3TRE A;  4LUE A;  5IT9 E;  4BB7 A;  3KBG A;  1OOT A;  3VS7 A;  4GY5 A;  4C92 G;  2DPP B;  3VUB A;  3OYH A;  3C0C A;  1G3S A;  5D6X A;  2F5K A;  2NUP A;  4DOW A;  1X2Q A;  4LNP A;  2OTL Q;  1WJS A;  4AG2 C;  1TSF A;  3OYL A;  3CCM T;  1D1C A;  1VYT A;  1N8R C;  1M1K U;  3QJ6 A;  3S6W A;  1YIT T;  4A4F A;  1WX6 A;  3CCR Q;  2GF7 A;  2RJC A;  1Y57 A;  1KQS A;  4ESR A;  4XAX B;  3FJP A;  1PKS A;  5CQX A;  1EX4 A;  2DM1 A;  1AD5 A;  2NWM A;  3OYM A;  4C0G A;  4JRP A;  1BI2 A;  2Y4Y A;  4F17 A;  1VQK T;  1YFN A;  2E3H A;  1H3Z A;  3NTK A;  1I1J A;  2ENM A;  3OYB A;  4OGC A;  4ZNX A;  1D09 B;  2C0I A;  2KT8 A;  2VV5 A;  1B3Q A;  4E7H A;  1GRI A;  3SWN C;  1M27 C;  5GAM f;  5J26 A;  3NHN A;  1Q82 C;  4HVW A;  1U5S A;  3HRS A;  2AK5 A;  2QQR A;  4NL2 A;  3I56 A;  2LRQ A;  3JB9 H;  2EYW A;  1VQ4 Q;  1K73 R;  4M7D C;  2CS7 A;  1VQ5 A;  1QCF A;  4OP0 A;  4JS5 A;  2D8J A;  4RUG A;  1G3Y A;  3RDV A;  2K5L A;  3OS1 A;  2YT6 A;  1ARK A;  1YJ9 A;  1CKA A;  2QQA A;  1ABO A;  2HSE B;  2DJZ A;  4RTY A;  5CKE A;  3QSU A;  2AIR B;  3G4S A;  2BTT A;  4IUT A;  1M30 A;  1PD1 A;  5KYX B;  1V1C A;  5CK9 A;  3CCS T;  1WYX A;  3QZ9 B;  5FRO A;  1N8R R;  3JCM e;  2MI6 A;  1TWB A;  4M75 A;  4A63 B;  1AWX A;  1VOM A;  3RUX A;  3CC7 A;  3BDU A;  3E19 A;  4M7A G;  5FWB A;  2EBP A;  4N4H A;  4N4I A;  1GFD A;  1G5V A;  1NYF A;  5DLO A;  2QQS A;  2EQJ A;  2HQX A;  4M75 D;  1NZ9 A;  1WHJ A;  3CC4 T;  2YUO A;  3VS5 A;  1KD1 C;  2ED0 A;  2DXB A;  1ZSZ A;  2KEA A;  3GIB A;  5GJV B;  2LJ1 A;  5LJ5 d;  4M75 C;  2YXY A;  2DTH A;  5I11 A;  3EG2 A;  1QP3 A;  1OPK A;  2JVV A;  4A4E A;  2M51 A;  3OYC A;  4RTU A;  4J6W A;  1UJY A;  4CC2 A;  4JDS A;  2ZZD A;  4FIB A;  1XQH A;  3NPF A;  1IHV A;  4M4Z A;  3SD4 A;  4IUP A;  1M3B A;  1YWP A;  1SG5 A;  2D6F A;  4M78 A;  1WGS A;  3NTH A;  4M77 F;  1VQ7 A;  4CC7 A;  2RQU A;  1HK9 A;  3A5Z B;  3REB B;  4MML A;  1N9R A;  3A8G B;  3TEE A;  2JW4 A;  2FPF A;  1QW1 A;  1RUW A;  3G1J A;  1K8A C;  2DXT A;  1ZUK A;  4D8D A;  2HD0 A;  3Q1J A;  3CPF A;  1K0X A;  2XIC A;  4JZ4 A;  3HKS A;  1ZSZ C;  2LC4 A;  2YLB A;  4AMC A;  5C0M A;  2RM4 A;  2K5F A;  1XOV A;  4OMO A;  2YRC A;  1KQS P;  2IG0 A;  2CZ0 B;  1VQO Q;  3JSC A;  3FEO A;  3RER A;  2BE7 D;  3VS1 A;  4MDW A;  3CCU A;  1M90 R;  2QA4 A;  1SKU B;  2D9T A;  1WHM A;  4DQ2 A;  2A7Y A;  2E10 A;  3E9G A;  1Q86 C;  1Q81 U;  1WXB A;  2L0A A;  3VRZ A;  4C92 B;  4RG8 A;  2MWP A;  1T3L A;  2RHZ A;  2HSP A;  2MYS A;  4XTX A;  2HDA A;  4RTZ A;  1M9S A;  1X6G A;  2QEX T;  1YIT Q;  4RMO A;  1M5Q 1;  3FIF A;  3MEU A;  2DNU A;  2KI7 A;  4RTV A;  5GAO p;  4X34 A;  3GF5 A;  4PJO G;  2BUD A;  3EG9 B;  1PCX A;  4PFP A;  2FB7 A;  3DB4 A;  2D0N A;  2FHD A;  3JCM Q;  2RQW A;  1HJD A;  2CP2 A;  5KYW A;  1XNI A;  1X2K A;  3EGX B;  4HCC A;  3I55 Q;  3QUI A;  2RJE A;  2JNG A;  1YJW T;  2ZPI B;  4PJN A;  3QII A;  4LDV A;  4HT9 A;  2HAX A;  3KXT A;  3OYA A;  1KC8 U;  1JEG A;  3HPW A;  3KFV A;  1O75 A;  1VQP Q;  4WF2 A;  2QK0 A;  3L2V A;  5KYX A;  5LJ3 h;  4OMQ A;  2ZPB B;  1K4U S;  3CQT A;  2E5Q A;  1R0B G;  2QQB A;  5GAN 7;  1UEB A;  1GL5 A;  2HNI A;  2CZ1 B;  4ZGJ B;  4JS4 A;  3HFO A;  1C1A A;  2K2V A;  1Y96 A;  2BZ8 A;  4M7A D;  2VUB A;  1PWT A;  2OJ2 A;  3PE0 A;  1WHH A;  4PFZ A;  2CP0 A;  4E7S A;  1X75 C;  3HL8 A;  3T9N A;  1WNL A;  3JCM b;  2LQW A;  1VQ6 T;  2CKK A;  5GAN 6;  3PIP A;  3M0P A;  2P0K A;  3CC2 Q;  2EJF A;  4LDU A;  4LD6 A;  5CKF A;  2EIF A;  4AFQ C;  3CMA A;  4PL6 A;  2ZCF B;  1M90 U;  1OZ2 A;  2FRY A;  1VQ9 Q;  1ABQ A;  4ME7 A;  2E41 A;  2HMA A;  1EZZ B;  3OW2 S;  5GAO n;  4M7A F;  4J9H A;  2KE9 A;  3RES A;  3MP8 A;  5A0L A;  2VVK A;  2PVD B;  3EG0 A;  5LJ3 d;  3N5B B;  2FRW A;  3JCM f;  3CD6 A;  1KQ2 A;  3JB9 I;  1BU1 A;  4BDY A;  1W6X A;  2NUT A;  2CP5 A;  1FMW A;  4PFO A;  2L2P A;  2DXU A;  5GAN g;  3MP1 A;  4QW2 A;  4J6X A;  1OQK A;  2EYZ A;  2KXD A;  4Y92 A;  2DKG A;  4XU2 A;  3HP9 A;  1MV0 B;  1NEG A;  5A0D A;  3LLR A;  1S72 T;  3OY9 A;  5GAN h;  3FRN A;  3JCM X;  4KRT A;  1K8A U;  4J6Y A;  3RMS A;  2DTI A;  4PJO C;  3EGD A;  1ACM B;  1UGP B;  1UHF A;  1YI2 A;  2ROT A;  4XTZ A;  1JJ2 S;  3IQL A;  2YDL A;  3OYF A;  4IIO A;  3VUZ A;  1N9S A;  2LMJ A;  4QVD A;  2KRO A;  4BI4 A;  1YJN T;  2RQV A;  1GCP A;  1RI0 A;  3UF4 A;  4AFS C;  2RF0 A;  3OMG A;  3A8H B;  1UG1 A;  4MZT A;  1NPP A;  1LPL A;  4M75 E;  2GGR A;  5HK0 A;  4EDU A;  3M9Q A;  3HSB A;  1Y96 B;  2O4X B;  3THK A;  2EWN A;  4X9D A;  1WXU A;  1WHL A;  4A4H A;  5EG2 A;  3CCJ A;  2EQU A;  1VQO T;  1FX7 A;  2NLU A;  3KUF A;  3V8J A;  2DX1 A;  1PRL C;  4O5V A;  4J9G A;  2WSF E;  5D7U A;  2QTV A;  4CI0 C;  3P8B B;  2VYT A;  5GAN 4;  5HY6 A;  5HCK A;  4NOY A;  3EFR A;  3EGX A;  3RKY A;  5LJ3 f;  2AZS A;  2QQ9 A;  2RI2 A;  4XTW A;  1X69 A;  2CP3 A;  4A4G A;  1Q7Y R;  5EC7 A;  2M1H A;  1Q86 U;  2CZ7 B;  5HK3 A;  2HL5 C;  3UDC A;  1N27 A;  1TUG B;  4J9B A;  5FU6 C;  4JLG A;  3J81 E;  2JT4 A;  4E47 A;  2RH2 A;  2LCL A;  3MEV A;  1B34 B;  4FT4 A;  1D1B A;  1YCS B;  5A2Q E;  1KIK A;  1YIJ Q;  2X4W A;  5AYF A;  3BW1 A;  2RK2 A;  4XK8 E;  3VYG A;  2KRS A;  3SFM A;  1BCM A;  3CC2 T;  2LDM A;  3UPU A;  1BI3 A;  4WCI A;  4DEY A;  4BE1 A;  2LCC A;  1MV3 A;  5KCH A;  2BZX A;  5GAM g;  1PSF A;  2RO0 A;  3CBO A;  1VQ4 T;  4M77 C;  4EMH A;  4KGZ B;  4BY6 C;  2AT1 B;  1VIF A;  2DD4 A;  1VQN Q;  2DL5 A;  1G83 A;  1IZ6 A;  4QT7 A;  5IXB A;  5DLQ E;  2V1R A;  4IUV A;  1RAH B;  2DFU A;  5GAN e;  2A37 A;  2HQH A;  4GLK A;  2K3B A;  1B34 A;  3SWN A;  5GAN 8;  1PSE A;  3CCS Q;  1IXD A;  4ZGE B;  4LDX A;  4ZN3 A;  1P92 A;  4Z88 A;  4E6R A;  4BI3 A;  1YI2 Q;  1H8K A;  1OI1 A;  1AWO A;  1YBY A;  2YLC A;  3EHR A;  4DBF A;  1MMD A;  2L5Q A;  3VV0 A;  3MCA B;  4NL3 A;  2D0Q B;  2QTX A;  1JBM A;  5GAN 2;  1I5L A;  4C8Q B;  2ZPG B;  4J9I A;  2J6O A;  1AT1 B;  2G3R A;  4PJO F;  1JXM A;  2W0Z A;  4TVR A;  3M55 A;  1M2V B;  2JN0 A;  4KUD K;  3OS5 A;  3CC4 Q;  5AT1 B;  2E70 A;  1OYX A;  2KRM A;  1K9M C;  2FZK B;  1X43 A;  2E6N A;  4F14 A;  4OMN A;  1VQL Q;  4C0D B;  2DE0 X;  2M02 A;  1YJN A;  3OYG A;  3CD6 Q;  3VKI A;  4EMK C;  3G4S T;  3CBM A;  3M0T A;  4E7I A;  3MJX A;  2RQT A;  1VQ4 A;  2JM8 A;  4E7Z A;  3LX7 A;  2HL3 A;  5J3B A;  4VUB A;  1Z9Q A;  4M77 B;  3H0H A;  4A4K A;  2MIO A;  3P8H A;  3V7C A;  2CH4 W;  3OW2 P;  2DBM A;  2DRM A;  1QVG A;  2KRN A;  4HVU A;  1R8O B;  3JCM J;  3O8V A;  1I8F A;  1IGQ A;  3URG A;  1YJN Q;  4E7L A;  1M8V A;  5I2M A;  4DBQ A;  2K9G A;  1UB4 A;  1M90 C;  2DJQ A;  1GBQ A;  3TVT A;  1VQP T;  2JMC A;  1TUD A;  2K4Y A;  3QPH A;  1M2O A;  2QDL A;  1RAI B;  1GCQ C;  2JTF A;  2P0Q A;  1BIB A;  3DLL A;  1PC0 A;  3CMA T;  2M0O A;  4IUQ A;  2OI3 A;  2V26 A;  1ZA1 B;  3NTI A;  2DYI A;  3TU4 K;  1AHJ B;  3CXC P;  1N5Z A;  3G6E A;  2VB6 A;  2KYM A;  2FZC B;  4D6W A;  1D0X A;  1LCK A;  1VQ6 Q;  4JUV A;  3JCM W;  1GCQ A;  3CCM Q;  4DA4 A;  1RAC B;  5LJ3 g;  2PUO B;  1A0N B;  2A3L A;  3CC2 A;  3V7S A;  3TSW A;  3EG9 A;  2QEX Q;  3OSV A;  3LWH A;  1PG5 B;  3C95 A;  2DO3 A;  4LN2 A;  5IHK A;  4HT8 A;  4IKF A;  2X51 A;  3NGP A;  5GAO q;  4Z02 A;  1Q7Y C;  2GFA A;  1CKB A;  3OA6 A;  1VUB A;  3U23 A;  4EPC A;  3FLG A;  1YHQ A;  4PJJ A;  1Q95 G;  5GAN 5;  4OB1 B;  3A8M B;  3VS2 A;  3G71 T;  1W1F A;  1WLP B;  3C12 A;  1M1F A;  2DZ9 A;  1E6H A;  2CRE A;  5LL6 S;  1W4S A;  2ESW A;  2LQK A;  3LGL A;  4Y91 A;  3SWN B;  2BKD N;  2B8A A;  1NYG A;  3GBQ A;  2EJG A;  4KT0 E;  2RN8 A;  3JB9 G;  2LP5 A;  2PU9 B;  3QWY A;  5GAO m;  3OYK A;  1QVF A;  2L3R A;  1VQ6 A;  1BCO A;  1ZUY A;  3VS4 A;  2O88 A;  2LZ6 B;  1FXX A;  4M7D B;  2V8K A;  1SPK A;  2OAU A;  5GMK l;  4E7J A;  1K8A R;  1QWF A;  3OYY A;  4J9E A;  4F16 A;  3QDF A;  5KYW B;  1YJW A;  2FEI A;  2JTM A;  2LQ8 A;  2O2O A;  4KH1 B;  5LJ5 e;  1G8X A;  4IIM A;  2GTO A;  4LDY A;  2DEU A;  4EMK A;  1KHI A;  4QKU A;  4OMP A;  3TCJ A;  4FYY B;  3A8O B;  3UWN A;  2DRK A;  4HVV A;  1K73 C;  1PHT A;  2RD1 A;  2YUQ A;  2MWO A;  2WSC E;  3D7S B;  4PJL A;  4UC4 A;  2DTO A;  2DXC A;  5GJW B;  1UUE A;  2XKO C;  2HZY A;  1AZG B;  2F2V A;  3JCM g;  2YSQ A;  3WXM B;  2IIM A;  1LVK A;  1FMK A;  1QWE A;  2A0F B;  3C94 A;  4KBM B;  3S3N A;  1N6A A;  3RR6 A;  1W2B A;  4KH0 B;  2EYQ A;  2HCK A;  4FW1 A;  2CP7 A;  5CQY A;  1K73 U;  3L2W A;  2XD0 A;  3O5Z A;  1VQL T;  2WAC A;  3LWI A;  5FU6 B;  3ME9 A;  2VXF A;  1KFZ A;  4BY6 B;  1Q81 C;  2SEM A;  2QA4 T;  2A36 A;  1EFN A;  2COY A;  2L3S A;  1WIE A;  3EG1 A;  2PQW A;  3OSS C;  3REA B;  4M77 G;  5GMK m;  2EKO A;  4ELZ C;  3CC7 Q;  2L89 A;  4J8O A;  2EKH A;  4AT1 B;  1VIE A;  1F1B B;  1D3B B;  1W70 A;  1R0C B;  4AG1 C;  1K76 A;  1MND A;  2XDP A;  1UGQ B;  4KGX B;  5ECA A;  3OS0 A;  2CSQ A;  2EGE A;  2EQI A;  4K11 A;  2R57 A;  3CME T;  1D3B A;  4C5G A;  3OYD A;  3M53 A;  3VJP A;  2C0O A;  2CT3 A;  5LJ5 h;  2I2L A;  4JJD A;  1NJI C;  1VQ5 Q;  5I22 A;  4PJO A;  1XJW B;  1X01 A;  2DVE A;  4M7A B;  3DB3 A;  5CIU A;  3CCS A;  1VYU A;  2CP6 A;  2D1X A;  2DAQ A;  3CC7 T;  1NE8 A;  1OV3 A;  2PVG B;  4MZM A;  1GBR A;  1GXI E;  1NEB A;  3CMA Q;  2PNI A;  3EGD B;  2K6D A;  3ZEH A;  2DL7 A;  2NYS A;  3OYN A;  4JRK A;  4HCK A;  2B86 A;  3JCM V;  3MET A;  5GAM h;  3CXC S;  1TS9 A;  2CSI A;  4C0F A;  3LGF A;  4M77 D;  3V7R A;  3G4S Q;  2RJF A;  4PJO E;  2KYB A;  2RNA A;  5CKH A;  1EIF A;  1JJ2 A;  4RTT A;  4CC3 A;  1VQ5 T;  1SSH A;  1KK7 A;  3M0Q A;  2GNC A;  3JCM P;  2CYZ B;  4C5H A;  4RCB A;  4GBQ A;  4QQ6 A;  5HKC A;  3MEA A;  4EMK B;  3G6E T;  3JB9 D;  1ZA2 B;  1YIJ A;  3E9F A;  3G7Z A;  5KYN A;  5GAN 3;  4M7A E;  1YJ9 T;  4JRQ A;  4LD9 K;  4OML A;  1TUC A;  1VQ7 T;  4JJB A;  2HBP A;  3ER0 A;  1M1K R;  2OTL T;  2V1Q A;  3M0U A;  2CH4 A;  4FW2 A;  4PJO D;  3I9Q A;  1M4Z A;  2JOY A;  1X6O A;  3BE3 A;  4M75 F;  4FYW B;  3BDL A;  2DET A;  2M0Y A;  2DK3 A;  3SEM A;  2EVR A;  4FSX A;  5IXF A;  1OUL A;  2VAS A;  1KG1 A;  3CCM A;  1JO8 A; 
#chains in the Genus database with same CATH homology
 2ECZ A;  2AK5 A;  2AKL A;  1Z9Z A;  2EYW A;  2DL8 A;  1T0H A;  1QCF A;  4GLM A;  1PNJ A;  2D8J A;  1YP5 A;  3M0R A;  4RUG A;  2DL5 A;  1G83 A;  3H0I A;  1GFC A;  1AVZ C;  4QT7 A;  3VRY A;  5IXB A;  1SHF A;  2YT6 A;  1ARK A;  1CKA A;  2V1R A;  1B07 A;  1WI7 A;  2MOX A;  2A37 A;  3UAT A;  1J3T A;  2JXB A;  2K3B A;  4CC4 B;  1AWJ A;  1ABO A;  2GQI A;  4RTY A;  2A28 A;  2BTT A;  4OMM A;  1M30 A;  2K2M A;  1V1C A;  2FPE A;  1WYX A;  2JM9 A;  2RQR A;  2J7I A;  1JU5 C;  4Z88 A;  2CT4 A;  4E6R A;  1HSQ A;  1H8K A;  1JQQ A;  1AWX A;  2EGC A;  4LUD A;  4A63 B;  1AWO A;  1H92 A;  3EHR A;  3EG3 A;  1PKT A;  5FWB A;  2EBP A;  1SEM A;  1UHC A;  1GFD A;  1I07 A;  1AEY A;  4JJC A;  1RI9 A;  1NYF A;  4J9I A;  2J6O A;  2KGT A;  1JXM A;  2W0Z A;  4EIK A;  2RPN A;  3TSZ A;  1QKW A;  1T0J A;  4D8K A;  2YUO A;  3VS5 A;  5L23 A;  1T3S A;  2ED0 A;  2HEQ A;  2KEA A;  5GJV B;  2LJ1 A;  4AFU C;  2KRM A;  1M3A A;  1X43 A;  5I11 A;  4F14 A;  3EG2 A;  4OMN A;  1OPK A;  1K9A A;  2DE0 X;  2M51 A;  4RTU A;  2EGA A;  1UJY A;  4CC2 A;  4Z8A A;  1UGV A;  2A08 A;  1G2B A;  2DF6 A;  3NPF A;  3M0T A;  2RQT A;  4M4Z A;  1M3B A;  2JM8 A;  1YWP A;  2DVJ A;  1RLP C;  1Z9Q A;  3H0H A;  2MIO A;  2CH4 W;  1QKX A;  2BZY A;  1WA7 A;  2DBM A;  4CC7 A;  2NUZ A;  2RQU A;  2DRM A;  2LNH B;  3REB B;  1YWO A;  2KRN A;  4HVU A;  1NLO C;  2JW4 A;  1BB9 A;  2FPF A;  2KT1 A;  2JS0 A;  2ROL A;  1RUW A;  4AFZ C;  2YUN A;  1S1N A;  2FPD A;  1YNZ A;  1ZUK A;  4D8D A;  1AZE A;  1K0X A;  2J05 A;  4JZ4 A;  3EHQ A;  3ULR B;  2K9G A;  2DJQ A;  1GBQ A;  2AKK A;  3TVT A;  2CDT A;  2JMC A;  2G6F X;  1TUD A;  1UJ0 A;  2QDL A;  2XMF A;  3H41 A;  1GCQ C;  1XOV A;  2X3W D;  4OMO A;  2DL4 A;  2ABL A;  2LX7 A;  1AWW A;  2F2X A;  1BK2 A;  2OI3 A;  3VS1 A;  1VA7 A;  4R0K A;  5IHN A;  1N5Z A;  1X6B A;  1WXB A;  2L0A A;  2KYM A;  2EPD A;  2LCS A;  3VRZ A;  1LCK A;  1E7O A;  1GCQ A;  2RMO A;  2O31 A;  2O9S A;  2KNB B;  1M3C A;  1SRL A;  1E6G A;  1A0N B;  4J9D A;  3I5R A;  1T3L A;  2PZ1 A;  4DEX A;  2HSP A;  3TSW A;  2HDA A;  3JV3 A;  2L3Q A;  4LN2 A;  4RTZ A;  5IHK A;  3VS0 A;  2J06 A;  1X6G A;  2DA9 A;  3NGP A;  2DNU A;  1CKB A;  1ZLM A;  2DIL A;  4RTV A;  1MUZ A;  3U23 A;  2FO0 A;  2DL3 A;  2LJ0 A;  3FJ5 A;  1UFF A;  2D0N A;  1WFW A;  2RQW A;  5IHI A;  5FWC A;  1M8M A;  1HJD A;  1NG2 A;  2EYX A;  3VS2 A;  1W1F A;  1WLP B;  1X2K A;  1ZSG A;  2LJ3 A;  1E6H A;  2CRE A;  2KBT A;  3ZL7 C;  2ESW A;  4ORZ A;  1JEG A;  3KFV A;  3QWX X;  2F2W A;  3EGU A;  1NYG A;  3GBQ A;  3VS6 A;  3M0S A;  2RN8 A;  4OMQ A;  1K4U S;  2LP5 A;  3CQT A;  5FW9 A;  2GTJ A;  3QWY A;  1GL5 A;  2BZ8 A;  2FG0 A;  1ZUY A;  3VS4 A;  1PWT A;  2OJ2 A;  3H0F A;  3PE0 A;  2O88 A;  2LZ6 B;  2CUD A;  2ED1 A;  1SPK A;  1QWF A;  1WXT A;  2LQW A;  1VYV A;  4J9E A;  4HXJ A;  4F16 A;  3M0P A;  1FYN A;  2CUB A;  2FEI A;  2H8H A;  3I35 A;  2O2O A;  2D8H A;  3RNJ A;  4IIM A;  2GTO A;  4LE9 A;  3R6N A;  2KXC A;  4AFQ C;  4OMP A;  2FRY A;  2K7A A;  1ABQ A;  1KJW A;  2J6F A;  2JS2 A;  2OAW A;  1HD3 A;  1UTI A;  2DRK A;  4HVV A;  1PHT A;  2YUQ A;  1OEB A;  2E5K A;  5GJW B;  4J9H A;  2KE9 A;  1TG0 A;  1UUE A;  1PRM C;  1AZG B;  2F2V A;  2VVK A;  2YSQ A;  2IIM A;  2JMA A;  3EG0 A;  1K0S A;  2P4R A;  1FMK A;  2FRW A;  1QWE A;  2LQN A;  4J9C A;  2EYY A;  2YUP A;  1BU1 A;  1W6X A;  1H3H A;  1X27 A;  2GBQ A;  2HCK A;  2L2P A;  4RTW A;  2VKN A;  3O5Z A;  2EYZ A;  2VWF A;  2KXD A;  2KR3 A;  4Y92 A;  1UE9 A;  1OPL A;  1KFZ A;  1MV0 B;  1NEG A;  5IH2 A;  3SHW A;  2SEM A;  2A36 A;  1EFN A;  1U06 A;  2L3S A;  1WIE A;  3EG1 A;  3UA6 A;  2EW3 A;  2I0N A;  3REA B;  4KRT A;  2SRC A;  2W10 A;  1UHF A;  1ZX6 A;  2DYB A;  2EKH A;  2ROT A;  2J6K A;  2L3P A;  3IQL A;  2YDL A;  1JXO A;  4IIO A;  1W70 A;  1QLY A;  2LMJ A;  3A98 A;  3NMZ C;  2KRO A;  4AG1 C;  1K76 A;  1Y0M A;  2DMO A;  2RQV A;  1GCP A;  2X3X D;  3UF4 A;  1NLP C;  5ECA A;  4AFS C;  2CSQ A;  2RF0 A;  1SHG A;  2HBW A;  3UA7 A;  2EGE A;  2EQI A;  4K11 A;  4FSS A;  1UG1 A;  4X1V A;  1K1Z A;  4Z89 A;  2O9V A;  1UDL A;  2GGR A;  2C0O A;  2CT3 A;  4JJD A;  3THK A;  5I22 A;  2K79 A;  4JPB W;  3VS3 A;  1VYU A;  1AOJ A;  1WXU A;  3RBB B;  2D1X A;  3PVQ A;  1NM7 A;  1OV3 A;  1CSK A;  2JTE A;  1GBR A;  2PTK A;  2DBK A;  1NEB A;  4LUE A;  1KSW A;  2DX1 A;  2PNI A;  3PVL A;  1PRL C;  4J9G A;  2K6D A;  2DL7 A;  1OOT A;  3VS7 A;  4HCK A;  2B86 A;  3C0C A;  5HCK A;  1X2Q A;  4LNP A;  1IO6 A;  2CSI A;  4AG2 C;  4J9F A;  1VYT A;  2AZS A;  2KYB A;  1U3O A;  2RNA A;  1SRM A;  1X69 A;  1ZUU A;  4RTT A;  4CC3 A;  5EC7 A;  1WX6 A;  1SSH A;  4JZ3 A;  3M0Q A;  2GNC A;  1Y57 A;  4ESR A;  4GBQ A;  1PKS A;  2DM1 A;  1UEC A;  2MCN A;  1BBZ A;  1AD5 A;  1RLQ C;  2NWM A;  4J9B A;  4RTX A;  3LH5 A;  1ZBJ A;  4OML A;  1TUC A;  2JT4 A;  4F17 A;  4JJB A;  1I0C A;  1KIK A;  1YCS B;  1I1J A;  2ENM A;  4ZNX A;  2DLP A;  2V1Q A;  2KT8 A;  2C0I A;  2KRS A;  3M0U A;  2CH4 A;  1YN8 A;  1B3Q A;  3I9Q A;  2AZV A;  2C0T A;  1GRI A;  4WCI A;  2M0Y A;  4DEY A;  1WDX A;  1MV3 A;  1M27 C;  3SEM A;  3NHN A;  2EVR A;  3I5S A;  5IXF A;  4HVW A;  1U5S A;  2BZX A;  1JO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...