2A36A

Solution structure of the n-terminal sh3 domain of drk
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein E(sev)2B
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a36A00
1WIEA 5FWCA 2JM9A 4OMLA 2L3QA 1ABOA 5ECAA 1IO6A 2KEAA 2EPDA 2EGEA 4DEXA 1YCSB 3NMZC 2K3BA 2YUOA 1E7OA 1UG1A 2KE9A 1JO8A 2O31A 2A08A 2ROTA 4X1VA 4AFQC 1HD3A 4AG1C 4RTTA 1Y57A 1X6GA 4F17A 4RTUA 2CREA 4ZNXA 1U06A 1YWPA 2BTTA 2RF0A 5I22A 3IQLA 2FPDA 2SRCA 2EYXA 2DRMA 1AOJA 1OEBA 3I5RA 2EYYA 4LN2A 2L2PA 3VS4A 1U3OA 3VS2A 1PNJA 2K79A 2HEQA 1M3BA 3NGPA 3M0PA 3ZL7C 1BK2A 5L23A 1B3QA 1FMKA 4J9FA 2LJ1A 3VS3A 2ED1A 1ARKA 2HBWA 1SSHA 1K4US 1SHGA 2HDAA 1SPKA 1WDXA 2YUNA 3H0IA 2P4RA 2JXBA 1V1CA 2CDTA 4RUGA 4D8DA 3I5SA 1AD5A 1AEYA 1AWOA 1UECA 2SEMA 2KXCA 2VVKA 2J6KA 2EW3A 1CKAA 4OMMA 4R0KA 2DL5A 2DBMA 4JJDA 2FRWA 2MIOA 2KYBA 2AK5A 3JV3A 1ZX6A 1MV0B 1JU5C 1ZSGA 3C0CA 1LCKA 5EC7A 5FW9A 1AWXA 3PE0A 2DMOA 4WCIA 4AG2C 2A37A 1SEMA 3VRYA 1JXMA 2L3PA 2KR3A 3VS5A 3M0TA 2RQUA 2F2WA 1E6HA 3M0UA 2C0IA 3VS7A 3REAB 3FJ5A 2KGTA 2RN8A 4IIMA 1ZLMA 2CT3A 1M27C 1ZUKA 2X3WD 1M8MA 1H92A 2C0OA 4AFUC 1ZBJA 1NLPC 2RQWA 1RUWA 1SHFA 2GQIA 2D0NA 2AKLA 4HXJA 5I11A 2RNAA 2VWFA 1Z9QA 2KRMA 4OMPA 2DL8A 2EVRA 1AVZC 2J06A 2AZSA 2EBPA 1NLOC 1X2QA 1OPKA 1E6GA 2DF6A 2L3SA 2YUQA 2EGAA 4LUDA 1GFDA 5IHIA 2JM8A 1RLQC 2EQIA 1X2KA 3A98A 1W6XA 2DL3A 2GBQA 4J9IA 2VKNA 2I0NA 2NUZA 2ECZA 2FO0A 2CT4A 5GJVB 4OMOA 1NEGA 3TSWA 4GLMA 1TUDA 2W10A 2LCSA 1B07A 4RTWA 2RMOA 4RTZA 2MCNA 2ABLA 1EFNA 1MV3A 4KRTA 3ULRB 1YNZA 2FPFA 2LP5A 1OOTA 3VS0A 4F14A 1CSKA 4RTVA 1YWOA 1WFWA 1WLPB 2JS0A 2AZVA 2L0AA 1NG2A 1ZUYA 1W70A 2JW4A 1AZGB 2NWMA 4IIOA 3M0RA 3PVQA 1NEBA 3KFVA 2OI3A 5FWBA 1SRMA 2K2MA 2KBTA 3H0FA 4AFSC 4DEYA 1NYGA 1BU1A 3M0QA 4Y92A 2ESWA 3CQTA 4J9DA 1Z9ZA 2DL7A 5IXBA 4JPBW 1M3AA 1K76A 1RLPC 1JQQA 3QWXX 4RTYA 3EG1A 2J05A 2PNIA 2XMFA 1KIKA 2D1XA 1VYVA 2KT8A 2DE0X 3GBQA 2X3XD 1KSWA 1AWJA 5IHKA 4ESRA 3LH5A 4GBQA 1CKBA 4Z89A 1I1JA 1UUEA 2DM1A 2O9SA 1UHCA 2EGCA 2CSIA 4HCKA 2F2VA 1PKTA 1YP5A 2ROLA 2DA9A 1X6BA 2LQNA 4JZ3A 2JMCA 1I07A 1BB9A 1FYNA 5IH2A 1UJ0A 2KROA 1NM7A 4LNPA 2YUPA 1WXTA 2DX1A 3H41A 1T3LA 3REBB 1UHFA 2BZYA 1WXBA 1H3HA 2GNCA 2GTJA 1UTIA 3EHRA 2LQWA 1QCFA 2EYZA 1GRIA 2CUDA 3TVTA 4JJCA 2LNHB 1QLYA 2C0TA 2O88A 2JS2A 1WXUA 1WYXA 3EG0A 1HJDA 1GCQC 1U5SA 2G6FX 2CSQA 1VYTA 2O2OA 2DJQA 2A36A 1ZUUA 1QWEA 3EGUA 2B86A 2BZXA 4Z88A 2YSQA 2KXDA 4J9HA 4OMQA 1GCPA 1OV3A 1X43A 3TSZA 4JZ4A 2K9GA 2RQTA 2KRNA 4HVVA 1Y0MA 2M0YA 4CC2A 1J3TA 1KFZA 4E6RA 2JMAA 2DNUA 2FRYA 2D8JA 4J9EA 3UA7A 1K0SA 1TG0A 1PWTA 1GCQA 3EG3A 1VYUA 1KJWA 2YDLA 2DILA 2HCKA 2ED0A 2O9VA 2D8HA 1GL5A 2J7IA 1N5ZA 1NYFA 2OJ2A 1UE9A 3NHNA 1T0HA 3VRZA 1QKWA 3UA6A 3EG2A 1UFFA 5HCKA 4M4ZA 2EKHA 2QDLA 3M0SA 3R6NA 4F16A 1GFCA 1PRLC 1OPLA 4Z8AA 1WA7A 2KNBB 3SEMA 2V1QA 1UDLA 4J9CA 1K1ZA 4FSSA 1I0CA 2HSPA 1MUZA 2F2XA 5IHNA 4QT7A 2JTEA 2FPEA 2BZ8A 1SRLA 1K0XA 1AZEA 3VS6A 1S1NA 3RBBB 2OAWA 1T0JA 1X69A 1M30A 2FG0A 4LE9A 2AKKA 2LZ6B 3EHQA 2IIMA 4J9BA 1T3SA 1HSQA 1G2BA 2ENMA 1TUCA 2DLPA 1WI7A 2GGRA 2W0ZA 2LJ0A 1H8KA 4D8KA 1GBQA 1A0NB 1PKSA 2LX7A 1JXOA 4RTXA 4A63B 3UATA 2KT1A 4LUEA 4HVUA 3U23A 2RQRA 3RNJA 1WX6A 4ORZA 1W1FA 1AWWA 2DRKA 2J6OA 1PHTA 2RQVA 1RI9A 1BBZA 3I9QA 2A28A 3NPFA 4CC4B 3UF4A 2M51A 2KRSA 1QKXA 1UGVA 5GJWB 1G83A 3THKA 2PZ1A 4JJBA 4EIKA 1QWFA 1X27A 4CC3A 2YT6A 1VA7A 2DL4A 3H0HA 2H8HA 3O5ZA 4OMNA 3PVLA 2PTKA 3VS1A 2CH4A 1GBRA 2LJ3A 2FEIA 2LMJA 1K9AA 2V1RA 4HVWA 1M3CA 2K7AA 1ABQA 2E5KA 4CC7A 2MOXA 2J6FA 2CH4W 2KYMA 3SHWA 2JT4A 1JEGA 4AFZC 3I35A 1YN8A 5IXFA 2GTOA 4J9GA 4K11A 3QWYA 1XOVA 2DBKA 1UJYA 2DYBA 2EYWA 2RPNA 2CUBA 1PRMC 2K6DA 2DVJA
chains in the Genus database with same CATH superfamily
4LDUA 5DY9A 1R8OB 2LDMA 3VV0A 2QQ9A 3EFOA 3CC7T 2EPDA 2YWWA 4DEXA 1D0ZA 4R56A 4JRQA 5C6SA 5LJ3j 2MK5A 2JNGA 2HQHA 3EG9B 1QMCA 4FSXA 1R0CB 1Y57A 4F17A 1YJNA 4RTUA 5CQYA 3OQ5A 2CREA 5GMKh 4KUDK 4ZNXA 4PLLA 5CKBA 2YRCA 2OTJQ 4AMCA 4B6MA 4C92D 5LJ3e 3OYLA 3IQLA 2FPDA 2LRQA 3NTKA 1AOJA 2VASA 3M4GA 1QVGP 3EG9A 3JCMP 1YBYA 2QGFB 4LD9K 4FU6A 1ZSZC 2WSCE 1IHVA 3OW2P 1PNJA 4PJMA 3L2QA 2HEQA 1M3BA 2RI3A 3ZL7C 3L2RA 4M7AD 1ACMB 4GLKA 1K8AC 1RAAB 4OGEA 4C92E 4JJNK 1Q82C 1ARKA 4A4HA 4YTLA 1SHGA 2RO0A 3H0IA 1VQPA 4J7FA 4FYYB 4IUVA 2HKNA 2DO3A 3EH1A 4RMOA 4D8DA 1AD5A 1UECA 3M57A 4BY6C 1M90R 1KK7A 2LCLA 3CD6A 4M77B 2CP3A 4RG8A 4ME7A 1HK9A 1TH7A 3JV3A 1ZX6A 3I56A 4JRKA 2R58A 2QEXT 1FWZA 1LCKA 4GY5A 3AHUA 4XU2A 5FW9A 5KYYA 4AG2C 2E6ZA 1WJQA 2A37A 3VRYA 5AT1B 2KR3A 4O6JA 3VS5A 2RQUA 3CCQQ 4DOWA 5KCHA 3RKXA 1M8VA 3FJ5A 1DJ7B 2RN8A 4IIMA 4EMGA 1YJWA 2FVUA 2RK1A 5FROA 5GAN8 1M27C 1ZUKA 1VQ9A 2L89A 2C0OA 1PD0A 1RUWA 4HKEA 1SHFA 3JSCA 3CMEQ 5A2QE 2RNAA 2VWFA 2K3YA 4M7DB 1VUBA 2YLCA 5CR2A 3I55T 3OYIA 2E64A 1NLOC 1WNLA 1VQ6A 4QQDA 2DAQA 1OPKA 3WVDB 1YJNT 1BKBA 2FHDA 3CC7Q 3JB9I 3D7SB 2O4XA 2L3SA 2EGAA 4M75G 3FJPA 4B9XA 5L8RE 3KBGA 2JM8A 5GAMh 3A98A 3M9QA 3SFMA 3X25B 3JB9F 2VKNA 2I0NA 2NUZA 4BI8B 4BI3A 5CO7A 2HBPA 4OMOA 4NL3A 1NEGA 4Z02A 4GLMA 4FL6A 2W10A 2E70A 2RJEA 1B07A 4MZMA 4KH0B 2MCNA 4PLIA 5LJ5h 1OX8A 2EQUA 4F7UG 3S3NA 2XHCA 1OOTA 3VS0A 3CCRA 1WFWA 3CCET 4M78D 3OY9A 1ZUYA 1NG2A 4XTZA 2NWMA 2Y90A 1K73U 3HFNA 3PIPA 5FLXE 1Q86U 1KD1R 2CP2A 1WHGA 1YI2T 4PJOB 2HD0A 3J7AF 4A4GA 1KQSP 4M77C 4C8QG 4FM4B 3G4SA 1BU1A 2K5LA 1VQ4A 3CC4T 3I56T 3QO3A 5D6XA 1Z9ZA 5IXBA 4M78E 2QK0A 4J6WA 2FB7A 1RAHB 4PJOA 3OYHA 1OU8A 2PVDB 1N9SA 1P92A 4KH1B 1VYVA 3GBQA 5HK3A 3JCMX 2DTOA 2QEXQ 2DZ9A 2XU8A 2P0KA 1YJWT 4ZGEB 2DM1A 2K5FA 2X51A 1UHCA 2DK3A 2COWA 3META 4HCKA 4OB0B 2F2VA 1YP5A 1OQKA 2M9UA 2ROLA 2DA9A 2MWOA 3C94A 1X6BA 3CCJA 4JZ3A 3JCMg 2XK0A 1FYNA 5I2MA 2DEUA 1NM7A 2YUPA 3OSSC 1QVFS 4OMFB 2VV5A 3JAME 3A5ZB 2RD1A 2DJZA 3REBB 1OX9A 3PT9A 2V8JA 2GNCA 4BE0A 2DXCA 3EHRA 3I55Q 3CPWP 1QCFA 1BCMA 4CI0C 5A0GA 3NTHA 2A7YA 3C12A 1BI0A 3OSVA 1YJNQ 1TU0B 4JJCA 1QLYA 1OZ3A 3MEUA 2JS2A 1WXUA 2F5TX 3EG0A 4A54A 5GMKm 1B7TA 4OVAA 4ANJA 2DJQA 3CPFA 3BDLA 4D6WA 2KXDA 1VIEA 4DQ2A 3RESA 3Q1JA 4OMQA 1OV3A 5I2SA 2LX9A 4JZ4A 4RCCA 2K9GA 2KRNA 3NTIA 4HVVA 1BI3A 3RKWA 2E6NA 5D7UA 1WHLA 1M4ZA 4L6V5 1KFZA 4E6RA 3BW1A 4HCCA 2D8JA 2OTLA 4J9EA 3UA7A 1N9RA 1TG0A 3CCVA 1VQPQ 1VQ5A 3CCEQ 1KG1A 2RHYA 3EGDB 2HCKA 3S6WA 3G6EA 2ED0A 2O9VA 1GL5A 4II1A 5KYNA 1NYFA 1G3WA 1UE9A 2K4YA 3NHNA 1KC8C 2ZPBB 5C0MA 1D1BA 1YI2Q 1UFFA 4X34A 1QVGS 2QG9B 2EKHA 2H3JA 4FYXB 3CD6Q 2KSSA 2QDLA 3PFSA 4LDVA 4F16A 3HPWA 4Z8AA 3I56Q 1KD1C 3FC3A 1QP3A 2H3EB 5GMKi 4J9CA 3PTAA 4M75B 2QI2A 3JCMd 4QT7A 2JTEA 3M58A 2F69A 2BZ8A 3VS6A 3RBBB 3LWHA 3FEOA 5GAN3 3OMGA 4C5EA 2LZ6B 2IIMA 4J9BA 1YJWQ 4FYVB 2ENMA 4UC4A 1G8XA 2GGRA 1VQ9Q 2V8KA 4D8KA 1GBQA 4N4HA 2X4YA 1MMDA 3LX7A 1JXOA 2GFUA 4F7UB 2KT1A 2RQRA 4OB2B 3RNJA 1WX6A 4ORZA 2ZAEA 2J6OA 3S3OA 4ELYC 2A28A 3NPFA 1WPYA 4N0AA 2GFAA 3EGXB 1VQ7A 3QDFA 1M1GA 2MF2A 4BD3A 5GJWB 5CKFA 1X27A 3O5ZA 3L2ZA 2DL4A 2HQEA 2PTKA 2RHZA 1GBRA 1Y71A 2LMJA 1UGSB 5GAOp 2V1RA 4C8QB 3QZ9B 1SKUB 3L2VA 3SHWA 2JT4A 1RADB 5DM7R 2E12A 5HY6A 5GAN2 4J8OA 1MGQA 3GF5A 2GCXA 3C95A 5KYWB 3CCQA 3GIBA 3VJPA 2X3XD 2XDBA 2CGHA 2MAMA 2V26A 4J6YA 3G6ET 3GP8A 5FU7C 2KEAA 2X9HA 1UGRB 2K3BA 2YUOA 2YRDA 3VKIA 1UG1A 4M77F 4EMKC 1M5Q1 4X1VA 4AFQC 2DVEA 1M1KC 3VYHB 1X6GA 2AT1B 2ZPHB 1NPRA 2F1LA 5I22A 4IKFA 3CC7A 3P8HA 2SRCA 3KXTA 3M59A 5LL6S 5GAMg 4LN2A 2L2PA 3CCST 4HA8A 1SSFA 2RJCA 3VS2A 3OS1A 2K79A 1BYMA 5GMKl 5M9OA 5D6WA 2LT4A 4XU3A 5L23A 1B3QA 3JCMJ 4M7AC 1K73R 5LJ5g 1Q86R 1XQHA 1ZSZB 2HBWA 4M7DF 3J80E 1KQSS 1K4US 3OYYA 2LT1A 4JS5A 1VQNT 4PJOE 3F70A 2M1HA 2JXBA 2CDTA 2E5QA 2SEMA 2VVKA 4CRIA 2G3RA 3L1AA 4OMMA 2FRWA 2MIOA 2KQWA 2KYBA 5IN1A 4J5YA 1OU9A 3QJ6A 4BY6B 1VQOT 1JB0E 1K9MU 3OYJA 1PM3A 4E7SA 1ZQ1A 2MPXC 1AWXA 3PE0A 2VXEA 5HKCA 3G1JA 3SB2A 3OA6A 4OB3B 3A8GB 2L3PA 2L3RA 4KGXB 3M0TA 1Y7XA 3VS7A 2EWNA 3HTRA 1UGQB 4XU0A 5KYXB 2QEXA 3OMCA 1IRXA 2X3WD 1M8MA 3WXMB 3UDCA 3CCUT 1ZBJA 3X24B 2JVVA 3L42A 1NLPC 1YHQT 2D0NA 3CPWS 2LC4A 3E1SA 4PJOF 3CCVQ 3UT1A 2KRMA 1QW1A 4A4FA 2LVMA 3G6EQ 5GAMd 4BI4A 2YLBA 3N5BB 3CMAT 5CK9A 4E7LA 2XIDA 1E6GA 4XQ3A 2KY9A 1VQKT 4JLIA 2EQIA 4HCZA 3V8LA 4ZTFA 3CXCA 3I55A 5LJ5d 3OB9A 3VYGA 1WHJA 2RK2A 2CT4A 2X35A 3CCSQ 2F5KA 5LJ3f 1EFNA 2DIQA 3OBYA 1MV3A 3ULRB 5A0DA 1YNZA 2E4HA 2EAYA 5IAYA 1WLPB 2JS0A 4ZTJA 2L0AA 3NFCA 1AZGB 4IIOA 2DXUA 1H3ZA 1C0MA 3PVQA 2HSEB 3HL8A 3KFVA 2OI3A 4KT0E 1SRMA 4KBMB 2K2MA 4IUTA 4PL6A 3SWNC 3FDRA 3CCEA 1Q86C 1VQ7Q 3JB9D 1NYGA 3QIIA 3JCMe 4Y92A 3CQTA 2JN0A 2DL7A 4QQGA 1RLPC 1JQQA 2CP0A 4RTYA 3JCMf 2COYA 2J05A 1YI2A 1KIKA 4FW1A 2D1XA 1QVFA 1YCYA 1PCXA 1VQOQ 3CC4A 2PUKB 4LDYA 5J39A 1YITA 4GBQA 5GAN5 4Z89A 2IVWA 4QVZA 4E2FB 4PK4A 1Y07A 4M77A 2EGCA 1N8RU 1IGQA 5KE3A 3VUZA 1PSEA 2LQNA 4E7ZA 3MEAA 5IH2A 4WF2A 1UJ0A 1MMAA 1HYOA 4LNPA 1LVKA 5HK0A 3H41A 1YHQQ 2LQ8A 1T3LA 1VQLT 1UHFA 4FT4A 1V29B 1WXBA 1H3HA 1VQ8T 1D1CA 4BUGA 2X4XA 4IURA 2LQWA 2EYZA 1GRIA 1V76A 2CUDA 3TVTA 1N6AA 2OX7A 2R57A 2CZ6B 3LWIA 2E3HA 4M75F 4C8QE 4KGZB 4C92G 1HJDA 1IGUA 1GCQC 2G6FX 2CSQA 3C4SA 1VYTA 4M7DA 4PFPA 1B34B 1ZUUA 3RUXA 3OYMA 2BZXA 4Z88A 1TXQA 2YSQA 2D9TA 3MHXA 3CC2T 4J9HA 1GCPA 1IREB 1X43A 3V7RA 4J83A 4E7HA 3G71T 1MMGA 4JUVA 3OW2A 4M7AG 4IUPA 3JCMV 2M0YA 4CC2A 4EMHA 3URGA 1J3TA 4F7UF 3JCMW 2JMAA 3HRUA 3OYNA 2FRYA 4JS4A 1K0SA 2OAUA 1QQJA 3JCMc 1R0BG 1VYUA 1X75C 2QTVA 2MI6A 1W2BP 1W4SA 5KCOA 3LGLA 2J7IA 2QASA 5DLQE 4QW2A 1EX4A 2M16A 1I4K1 1QKWA 1G3SA 2NUTB 3EG2A 1U1TA 1TS9A 3R6NA 3UPUA 1Q95G 2RJDA 4C8QF 5FRMA 4QQ6A 1K8AU 1WA7A 3RDVA 1Q82U 1K1ZA 1I0CA 2KVQG 5D6YA 5GANj 4J6XA 5CVIA 1TWBA 1YITT 1Q81U 3KUFA 1BCOA 1AZEA 1K0XA 2KDSA 4MMLA 1T0JA 1X69A 5GANe 4LE9A 4LXCA 1M90C 2D6FA 1ZA1B 3MP8A 2DIGA 4XU1A 1T3SA 1HSQA 4PJLA 5GANf 2W0ZA 2LJ0A 1G3TA 1H8KA 1PKSA 1OI1A 2CZ1B 4HVUA 5FU6B 2PVGB 1W1FA 2DRKA 1XJWB 3MEVA 2QQAA 1RI9A 1XTDA 4PFOA 1VIFA 4XTYA 1VQLQ 3QSUA 4MMKA 1D09B 3E9GA 3THKA 4EIKA 4CC3A 3H0HA 1VA7A 3PVLA 4ATOA 1WQ7A 2RI2A 4N4IA 1WGSA 1M3CA 4RCBA 3JCMb 1UGPB 5CQXA 4CC7A 2L5QA 2P0QA 1JJ2P 3I35A 1X01A 5KH6A 3E9FA 2GTOA 2QA4A 3AT1B 3WVEB 2Z0WA 3P8DA 1WZOA 2DBKA 3J81E 2EYWA 2RPNA 3RR6A 3MCAB 3HSBA 1FMVA 3A8HB 2QQBA 2DVJA 4M78G 3MEWA 1NE8A 5FWCA 1WJSA 3M5AA 5GAOn 1EZZB 4OMLA 3GOXA 2E10A 2L3QA 4J7IA 1ABOA 1IO6A 3R6OA 4XTWA 2EGEA 3NMZC 4OP0A 3QDRB 4FCYA 1E7OA 1JO8A 2LCCA 5KE2A 2A08A 2ROTA 3EFSA 5GAOr 2FZGB 3DB3A 4AG1C 4RTTA 3ZEHA 5FU7B 1YWPA 2BTTA 2WSEE 1KQSA 2O01E 2DD4A 3MP1A 4EMKB 3I5RA 2BE9B 2EYYA 3EGDA 1C1AA 3VS4A 2K2VA 1FXXA 1U3OA 2LQKA 2BIVA 3QXEB 3EH2A 3CC4Q 7AT1B 1YITQ 4C92B 4C5IA 4EMKA 3DKMA 2XKOC 4DA4A 3CCSA 1MHNA 3JB9H 1LJOA 1SSHA 1JBMA 4E7KA 2HDAA 4M77D 5FU6C 4M75A 4HT8A 1IXDA 3H8ZA 4MDXA 4M7AB 2COZA 3X28B 5IT9E 1V1CA 1IZ6A 3I5SA 1YJ9T 4C0GA 3OYKA 4NL2A 2J6KA 2EW3A 1CKAA 1YIJT 2GQVA 4R0KA 3HKSA 2DL5A 1BI2A 4JJDA 1VQNA 2WACA 2AK5A 4C5HA 2L8DA 2Y4YA 4F7UA 4BACA 4M77E 3CPWA 2ZPIB 3PMIA 2ZPEB 2P84A 3QPHA 3A8MB 5EC7A 1XNIA 4WCIA 1N8RR 3HP9A 2QA4T 3FB9A 1SEMA 1JXMA 4E7IA 3EGXA 1E6HA 2F2WA 3M0UA 2C0IA 2ATCB 4M7DD 3JCMQ 1RABB 2KGTA 1VQOA 2CT3A 3OYBA 1NBEB 1FMWA 2KK4A 1D3BB 3CCLT 2RQWA 4C8QA 5I11A 3X20B 1Z9QA 4A4KA 3VU3C 2DL8A 2EVRA 1JRIA 3DB4A 1AVZC 1PG5B 2J06A 2AZSA 2EBPA 1RACB 3CCMT 3LLRA 1X2QA 4M7DE 3CCUA 2NUPB 2QXFA 4RG2A 2YUQA 1YHQA 4LUDA 1GFDA 2EQKA 3ER0A 5IHIA 5KYWA 3QHSA 3TCJA 1KQ1A 1NZ9A 1KHIA 4LD6A 1PC0A 2DTIA 4XTXA 2HMAA 4X9DA 1ZBXA 5AYFA 2FO0A 3CMAA 5I21A 2ZGWA 3TSWA 1TUDA 3P8BB 4RTWA 2RMOA 9ATCB 1VQKA 4C92C 4RTZA 3QYGB 2MWPA 2DERA 4KRTA 4QVCA 1KC8U 2FPFA 2KMTA 2LP5A 1W2BS 4PJOD 2CP6A 4C5GA 1TUGB 2EJFA 4WTOB 1M2VB 1I8FA 2AZVA 5LJ3h 1W70A 2JW4A 3M0RA 3E2UA 2PU9B 2OTJT 1NEBA 2EJ9A 3CXCP 3INZA 6AT1B 4OB1B 4AFSC 4JRPA 3OS2A 4O5VA 4M78B 4RKUE 2HZYA 3EAEA 4ZN3A 1YJ9Q 1Q82R 4C0DB 2ESWA 1TSFA 4ZGJB 3UWNA 1ZSZA 1K76A 1YIJQ 1Y96B 3QWXX 1Q81R 3EG1A 2PNIA 4N0AC 4XAXB 2RJFA 3SWNB 1OZ2A 3PIOA 3ZBDA 2XDPA 3A1PA 3PGGA 4ZN1A 3HRTA 1AWJA 4E7JA 2ZCFB 3LH5A 1G5VA 4B9WA 2QA4Q 5CAIA 1NJIU 1I1JA 1UUEA 3SDZA 4KUIA 2EQJA 2CSIA 2DFUA 5KYUB 5CIUA 1VOMA 5FRNA 2VB6A 2JMCA 2K5IA 3RMSA 3H9NA 1N8RC 3H6ZA 4A4EA 3CCLQ 4Q5WA 5EG2A 5KYUA 2XI9A 1WHHA 2BZYA 2RHUA 3CBMA 3HFOA 5KYXA 1X6OA 1D1AA 1JJ2S 2LNHB 2WSFE 2C0TA 3QKJA 4ELZC 2O88A 1Q7YU 1QCOA 1WYXA 1VQLA 3V8JA 1D0YA 3OBWA 1U5SA 3VUBA 1VQ8A 2A36A 4XTUA 1QWEA 2DXBA 3EGUA 2B86A 2PUOB 3OYAA 3QG1A 3EFOB 3CMET 2JJ9A 4JLGA 3PNWC 3O8VA 2XD0A 2DPPB 3RIRA 2VGMA 2CZ0B 2DNUA 1M1KU 3CC2A 2VUBA 2E3IA 2VYTA 1GCQA 3EG3A 8AT1B 2DILA 2D8HA 4M78C 3G71A 2OJ2A 2E1HA 1T0HA 3VRZA 4C0DC 2EYQA 2PQWA 4OF1A 2IPOB 3UA6A 4M75D 2DETA 4F04B 3G7ZA 3OYCA 3M0SA 1VQNQ 1WHKA 2NYSA 1PRLC 1K73C 1OPLA 4LDXA 3TEEA 2V1QA 4EPCA 1UDLA 4FSSA 4C0ZA 3CBOA 1MUZA 3OYGA 2FPEA 4FW2A 1RI0A 2X4JA 1S1NA 2LTOA 3GPLA 2OAWA 4M75E 1M30A 4DBFA 2FG0A 4Y91A 3LYIA 2AKKA 1S72T 1Q81C 2EIFA 3EHQA 1G2BA 2XG8D 3QZ5B 1TUCA 2DLPA 1IB8A 1WI7A 1MNDA 2DZCA 8ATCB 2KI7A 2RB6A 3GNFB 2LX7A 2RI5A 4M7AE 2M0OA 1MNEA 5GANh 4LUEA 5GAOm 3U23A 5KYYB 4BE2A 1AWWA 4F7UE 2RQVA 1BBZA 3I9QA 4P5NA 2RH2A 3SD4A 4C8QD 3CCUQ 1QKXA 4L59A 1UGVA 2BKDN 3OYFA 2PZ1A 4BB7A 2HKQB 1QWFA 2YT6A 4OMNA 2ZPFB 2H8HA 1SF9A 2QQSA 2CH4A 3M4YA 1O75A 1K9AA 3OS0A 4HVWA 1SG5A 2K7AA 2EFIA 1ABQA 2E5KA 1RAIB 2MOXA 2J6FA 2CH4W 3CMAQ 2KYMA 2DKGA 4C92F 4R55A 4AFZC 1IHWA 1VQKQ 1YN8A 1QVPA 3FIFA 5IXFA 4K11A 2V8IA 3QWYA 4XK8E 2IG0A 2O4XB 1UJYA 4VUBA 2CUBA 3JB9J 5GMKj 4BE1A 1PRMC 4AT1B 2E65A 1QVGA 4M7AF 1WIEA 2JM9A 1B34A 2DD5A 5GMKe 5ECAA 2AIRB 3MKDA 5CKDA 3MPUB 1YCSB 2KE9A 2O31A 4HCBA 3MP6A 2EKOA 1HD3A 4PJNA 3JB9G 4ZGDB 4OGCA 2YRVA 1U06A 1UEBA 2RF0A 4JDSA 3RKYA 1YFNA 2EYXA 2DRMA 1OEBA 3V8KA 2QTXA 2JTMA 1KC8R 2M02A 1VQPT 2NUTA 3NGPA 3M0PA 1BK2A 4PNOA 1FMKA 3CXCS 2FL7A 4J9FA 2LJ1A 3VS3A 2RM4A 2XICA 3EFRA 3TU4K 2ED1A 1S72Q 2BE7D 1M9SA 4KULA 3CD6T 1SPKA 1WDXA 2YUNA 2P4RA 5LJ3g 1OYXA 4RUGA 5J3BA 1ZA2B 1AEYA 1AWOA 2KXCA 2D0QB 1D0XA 1EIFA 2DBMA 3QYHB 1MV0B 4BDZA 1JU5C 3RERA 1YJ9A 2CP5A 1K9MR 1ZSGA 2I2LA 3C0CA 1VQ9T 1NJIR 4DOVA 2A3LA 1YIJA 1VQ8Q 2DMOA 3M56A 4DBQA 3REAB 4M7DC 1ZLMA 5DLOA 2RHIA 4Y28E 1VQ6T 3CEYA 2QYZA 1H92A 5GAMj 3BE3A 4AFUC 4QVDA 3CBPA 1I5OB 1C6VX 2P4TA 1QCNA 3CC2Q 2GQIA 4HXJA 2AKLA 1TTHB 1RAFB 4OMPA 3GLXA 5GAMe 4M78F 2QQRA 4BDYA 3G71Q 4FYWB 3JRZA 2B8AA 5GAMf 1FX7A 2DTHA 5LJ5j 1Q7YR 5GAOl 3CCLA 2DF6A 1GXIE 1W2BA 3OS5A 4PJJA 1RLQC 2P0PA 2EQMA 1X2KA 3DLMA 5LJ5e 1W6XA 2DL3A 1BIAA 4A53A 5GAN7 2HAXA 2GBQA 5CKHA 5GAOq 2FYKA 4J9IA 3CCMA 4MDWA 5LJ5f 3A8OB 2ECZA 3CCRT 5GJVB 3V7SA 2MYSA 2LCSA 2MMPA 5LJ3d 2ABLA 2R5AA 3ME9A 1M1KR 4HT9A 1MMNA 3FRNA 1VQMA 3BY7A 5J26A 4F14A 4PJOC 1CSKA 1HXDA 4RTVA 3QJYA 1YWOA 2Y4XA 3G4ST 3X26B 2VGNA 1VQ4T 2K57A 1AT1B 5FWBA 2NLUA 3OW2S 2KBTA 3H0FA 4JRIA 3OYDA 4DEYA 4C92A 1O9SA 2FZKB 2JUFA 3LGFA 3M0QA 4J9DA 2ZZDA 4JPBW 1M3AA 1U1SA 2OTJA 1M90U 4E47A 4MZTA 2XMFA 2YHTA 2QAZA 2YXYA 2KT8A 1RL2A 2DE0X 4M7AA 2RA2A 2HQXA 3CCJT 3E19A 2AHJB 1KSWA 2CS7A 2DXTA 1KQ2A 5IHKA 3PMTA 4ESRA 4FT2A 2JTFA 1CKBA 4XTVA 4L5GA 5GAN4 1OULA 2O9SA 1JJ2A 1BI1A 1PKTA 1LOJA 2HL5C 3MO8A 1K9MC 1AHJB 1I07A 1BB9A 1NJIC 3A8LB 2KROA 1VQ6Q 2E41A 1TOVA 3ASKA 5CKEA 4FIBA 1NPPA 1WXTA 2DX1A 1R77A 2VXFA 2GF7A 3HRSA 4IUUA 5GANg 3FLGA 2GTJA 1UTIA 2X4WA 3MJXA 2CKKA 2BUDA 4IUQA 2VC8A 4DBRA 2CYZB 1D3BA 2DEQA 3OYEA 4DBHA 3LH0A 3T9NA 3S3MA 2O2OA 3QUIA 4X9CA 2OTLT 1Q7YC 1LPLA 3CCRQ 3CCVT 1VQ5T 1RAEB 3TSZA 2NUPA 1VQMT 1H641 2RQTA 1M1FA 1WQWA 2LNVA 1I5LA 1Y0MA 4MZPA 1UB4A 3TQ7P 1WJRA 3M53A 1U8RA 3TREA 4TVRA 3CMEA 2DYIA 1PWTA 1M2OA 4M77G 2CZ7B 1KJWA 3G4SQ 2QDYB 2YDLA 4KGVB 1VQ4Q 4LDWA 3L2UA 1N5ZA 1I81A 3BFMA 2JOYA 1G3YA 1KHCA 2HNIA 1KD1U 4M75C 5HCKA 4EDUA 4M4ZA 2CP7A 2R5MA 1GFCA 1M2VA 1ZHIA 1K8AR 5CCAA 2JZ2A 4N4GA 2KNBB 3SEMA 2XDDA 5A0LA 3RMQA 2HSPA 5IHNA 2F2XA 1SRLA 4M78A 1BIBA 2PVOB 3CCJQ 4NS5A 2KAFA 3JCMh 2C06A 5GANd 4M7DG 3M55A 1Y96A 1VQ7T 3DLLA 1A0NB 3SWNA 5GAN6 1QP2A 4RTXA 3QBYA 2K3XA 3UATA 4A63B 4NOYA 1PD1A 1S72A 3LW5E 1PHTA 3L2WA 4CC4B 3UF4A 2M51A 4C8QC 2KRSA 4V2SA 2FZCB 1G83A 3V7CA 4JJBA 2A0FB 1QVFP 3ZFJA 3VS1A 4C0FA 3GNGA 2LJ3A 2FEIA 3BDUA 3CCMQ 2RHXA 1N27A 1WHMA 4PKCC 2ZPGB 3CCQT 1JEGA 1PSFA 2QGGA 4J9GA 1XOVA 2EJGA 4PFZA 2OTLQ 4QKUA 3HHTB 2DYBA 1VQ5Q 1RAGB 1VQMQ 2HL3A 4PJOG 1F1BB 2K6DA 1LNXA 3M54A
chains in the Genus database with same CATH topology
1WIEA 5FWCA 2JM9A 4OMLA 2L3QA 1ABOA 5ECAA 1IO6A 2KEAA 2EPDA 2EGEA 4DEXA 1YCSB 3NMZC 2K3BA 2YUOA 1E7OA 1UG1A 2KE9A 1JO8A 2O31A 2A08A 2ROTA 4X1VA 4AFQC 1HD3A 4AG1C 4RTTA 1Y57A 1X6GA 4F17A 4RTUA 2CREA 4ZNXA 1U06A 1YWPA 2BTTA 2RF0A 5I22A 3IQLA 2FPDA 2SRCA 2EYXA 2DRMA 1AOJA 1OEBA 3I5RA 2EYYA 4LN2A 2L2PA 3VS4A 1U3OA 3VS2A 1PNJA 2K79A 2HEQA 1M3BA 3NGPA 3M0PA 3ZL7C 1BK2A 5L23A 1B3QA 1FMKA 4J9FA 2LJ1A 3VS3A 2ED1A 1ARKA 2HBWA 1SSHA 1K4US 1SHGA 2HDAA 1SPKA 1WDXA 2YUNA 3H0IA 2P4RA 2JXBA 1V1CA 2CDTA 4RUGA 4D8DA 3I5SA 1AD5A 1AEYA 1AWOA 1UECA 2SEMA 2KXCA 2VVKA 2J6KA 2EW3A 1CKAA 4OMMA 4R0KA 2DL5A 2DBMA 4JJDA 2FRWA 2MIOA 2KYBA 2AK5A 3JV3A 1ZX6A 1MV0B 1JU5C 1ZSGA 3C0CA 1LCKA 5EC7A 5FW9A 1AWXA 3PE0A 2DMOA 4WCIA 4AG2C 2A37A 1SEMA 3VRYA 1JXMA 2L3PA 2KR3A 3VS5A 3M0TA 2RQUA 2F2WA 1E6HA 3M0UA 2C0IA 3VS7A 3REAB 3FJ5A 2KGTA 2RN8A 4IIMA 1ZLMA 2CT3A 1M27C 1ZUKA 2X3WD 1M8MA 1H92A 2C0OA 4AFUC 1ZBJA 1NLPC 2RQWA 1RUWA 1SHFA 2GQIA 2D0NA 2AKLA 4HXJA 5I11A 2RNAA 2VWFA 1Z9QA 2KRMA 4OMPA 2DL8A 2EVRA 1AVZC 2J06A 2AZSA 2EBPA 1NLOC 1X2QA 1OPKA 1E6GA 2DF6A 2L3SA 2YUQA 2EGAA 4LUDA 1GFDA 5IHIA 2JM8A 1RLQC 2EQIA 1X2KA 3A98A 1W6XA 2DL3A 2GBQA 4J9IA 2VKNA 2I0NA 2NUZA 2ECZA 2FO0A 2CT4A 5GJVB 4OMOA 1NEGA 3TSWA 4GLMA 1TUDA 2W10A 2LCSA 1B07A 4RTWA 2RMOA 4RTZA 2MCNA 2ABLA 1EFNA 1MV3A 4KRTA 3ULRB 1YNZA 2FPFA 2LP5A 1OOTA 3VS0A 4F14A 1CSKA 4RTVA 1YWOA 1WFWA 1WLPB 2JS0A 2AZVA 2L0AA 1NG2A 1ZUYA 1W70A 2JW4A 1AZGB 2NWMA 4IIOA 3M0RA 3PVQA 1NEBA 3KFVA 2OI3A 5FWBA 1SRMA 2K2MA 2KBTA 3H0FA 4AFSC 4DEYA 1NYGA 1BU1A 3M0QA 4Y92A 2ESWA 3CQTA 4J9DA 1Z9ZA 2DL7A 5IXBA 4JPBW 1M3AA 1K76A 1RLPC 1JQQA 3QWXX 4RTYA 3EG1A 2J05A 2PNIA 2XMFA 1KIKA 2D1XA 1VYVA 2KT8A 2DE0X 3GBQA 2X3XD 1KSWA 1AWJA 5IHKA 4ESRA 3LH5A 4GBQA 1CKBA 4Z89A 1I1JA 1UUEA 2DM1A 2O9SA 1UHCA 2EGCA 2CSIA 4HCKA 2F2VA 1PKTA 1YP5A 2ROLA 2DA9A 1X6BA 2LQNA 4JZ3A 2JMCA 1I07A 1BB9A 1FYNA 5IH2A 1UJ0A 2KROA 1NM7A 4LNPA 2YUPA 1WXTA 2DX1A 3H41A 1T3LA 3REBB 1UHFA 2BZYA 1WXBA 1H3HA 2GNCA 2GTJA 1UTIA 3EHRA 2LQWA 1QCFA 2EYZA 1GRIA 2CUDA 3TVTA 4JJCA 2LNHB 1QLYA 2C0TA 2O88A 2JS2A 1WXUA 1WYXA 3EG0A 1HJDA 1GCQC 1U5SA 2G6FX 2CSQA 1VYTA 2O2OA 2DJQA 2A36A 1ZUUA 1QWEA 3EGUA 2B86A 2BZXA 4Z88A 2YSQA 2KXDA 4J9HA 4OMQA 1GCPA 1OV3A 1X43A 3TSZA 4JZ4A 2K9GA 2RQTA 2KRNA 4HVVA 1Y0MA 2M0YA 4CC2A 1J3TA 1KFZA 4E6RA 2JMAA 2DNUA 2FRYA 2D8JA 4J9EA 3UA7A 1K0SA 1TG0A 1PWTA 1GCQA 3EG3A 1VYUA 1KJWA 2YDLA 2DILA 2HCKA 2ED0A 2O9VA 2D8HA 1GL5A 2J7IA 1N5ZA 1NYFA 2OJ2A 1UE9A 3NHNA 1T0HA 3VRZA 1QKWA 3UA6A 3EG2A 1UFFA 5HCKA 4M4ZA 2EKHA 2QDLA 3M0SA 3R6NA 4F16A 1GFCA 1PRLC 1OPLA 4Z8AA 1WA7A 2KNBB 3SEMA 2V1QA 1UDLA 4J9CA 1K1ZA 4FSSA 1I0CA 2HSPA 1MUZA 2F2XA 5IHNA 4QT7A 2JTEA 2FPEA 2BZ8A 1SRLA 1K0XA 1AZEA 3VS6A 1S1NA 3RBBB 2OAWA 1T0JA 1X69A 1M30A 2FG0A 4LE9A 2AKKA 2LZ6B 3EHQA 2IIMA 4J9BA 1T3SA 1HSQA 1G2BA 2ENMA 1TUCA 2DLPA 1WI7A 2GGRA 2W0ZA 2LJ0A 1H8KA 4D8KA 1GBQA 1A0NB 1PKSA 2LX7A 1JXOA 4RTXA 4A63B 3UATA 2KT1A 4LUEA 4HVUA 3U23A 2RQRA 3RNJA 1WX6A 4ORZA 1W1FA 1AWWA 2DRKA 2J6OA 1PHTA 2RQVA 1RI9A 1BBZA 3I9QA 2A28A 3NPFA 4CC4B 3UF4A 2M51A 2KRSA 1QKXA 1UGVA 5GJWB 1G83A 3THKA 2PZ1A 4JJBA 4EIKA 1QWFA 1X27A 4CC3A 2YT6A 1VA7A 2DL4A 3H0HA 2H8HA 3O5ZA 4OMNA 3PVLA 2PTKA 3VS1A 2CH4A 1GBRA 2LJ3A 2FEIA 2LMJA 1K9AA 2V1RA 4HVWA 1M3CA 2K7AA 1ABQA 2E5KA 4CC7A 2MOXA 2J6FA 2CH4W 2KYMA 3SHWA 2JT4A 1JEGA 4AFZC 3I35A 1YN8A 5IXFA 2GTOA 4J9GA 4K11A 3QWYA 1XOVA 2DBKA 1UJYA 2DYBA 2EYWA 2RPNA 2CUBA 1PRMC 2K6DA 2DVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIE A;  5FWC A;  2JM9 A;  4OML A;  2L3Q A;  1ABO A;  5ECA A;  1IO6 A;  2KEA A;  2EPD A;  2EGE A;  4DEX A;  1YCS B;  3NMZ C;  2K3B A;  2YUO A;  1E7O A;  1UG1 A;  2KE9 A;  1JO8 A;  2O31 A;  2A08 A;  2ROT A;  4X1V A;  4AFQ C;  1HD3 A;  4AG1 C;  4RTT A;  1Y57 A;  1X6G A;  4F17 A;  4RTU A;  2CRE A;  4ZNX A;  1U06 A;  1YWP A;  2BTT A;  2RF0 A;  5I22 A;  3IQL A;  2FPD A;  2SRC A;  2EYX A;  2DRM A;  1AOJ A;  1OEB A;  3I5R A;  2EYY A;  4LN2 A;  2L2P A;  3VS4 A;  1U3O A;  3VS2 A;  1PNJ A;  2K79 A;  2HEQ A;  1M3B A;  3NGP A;  3M0P A;  3ZL7 C;  1BK2 A;  5L23 A;  1B3Q A;  1FMK A;  4J9F A;  2LJ1 A;  3VS3 A;  2ED1 A;  1ARK A;  2HBW A;  1SSH A;  1K4U S;  1SHG A;  2HDA A;  1SPK A;  1WDX A;  2YUN A;  3H0I A;  2P4R A;  2JXB A;  1V1C A;  2CDT A;  4RUG A;  4D8D A;  3I5S A;  1AD5 A;  1AEY A;  1AWO A;  1UEC A;  2SEM A;  2KXC A;  2VVK A;  2J6K A;  2EW3 A;  1CKA A;  4OMM A;  4R0K A;  2DL5 A;  2DBM A;  4JJD A;  2FRW A;  2MIO A;  2KYB A;  2AK5 A;  3JV3 A;  1ZX6 A;  1MV0 B;  1JU5 C;  1ZSG A;  3C0C A;  1LCK A;  5EC7 A;  5FW9 A;  1AWX A;  3PE0 A;  2DMO A;  4WCI A;  4AG2 C;  2A37 A;  1SEM A;  3VRY A;  1JXM A;  2L3P A;  2KR3 A;  3VS5 A;  3M0T A;  2RQU A;  2F2W A;  1E6H A;  3M0U A;  2C0I A;  3VS7 A;  3REA B;  3FJ5 A;  2KGT A;  2RN8 A;  4IIM A;  1ZLM A;  2CT3 A;  1M27 C;  1ZUK A;  2X3W D;  1M8M A;  1H92 A;  2C0O A;  4AFU C;  1ZBJ A;  1NLP C;  2RQW A;  1RUW A;  1SHF A;  2GQI A;  2D0N A;  2AKL A;  4HXJ A;  5I11 A;  2RNA A;  2VWF A;  1Z9Q A;  2KRM A;  4OMP A;  2DL8 A;  2EVR A;  1AVZ C;  2J06 A;  2AZS A;  2EBP A;  1NLO C;  1X2Q A;  1OPK A;  1E6G A;  2DF6 A;  2L3S A;  2YUQ A;  2EGA A;  4LUD A;  1GFD A;  5IHI A;  2JM8 A;  1RLQ C;  2EQI A;  1X2K A;  3A98 A;  1W6X A;  2DL3 A;  2GBQ A;  4J9I A;  2VKN A;  2I0N A;  2NUZ A;  2ECZ A;  2FO0 A;  2CT4 A;  5GJV B;  4OMO A;  1NEG A;  3TSW A;  4GLM A;  1TUD A;  2W10 A;  2LCS A;  1B07 A;  4RTW A;  2RMO A;  4RTZ A;  2MCN A;  2ABL A;  1EFN A;  1MV3 A;  4KRT A;  3ULR B;  1YNZ A;  2FPF A;  2LP5 A;  1OOT A;  3VS0 A;  4F14 A;  1CSK A;  4RTV A;  1YWO A;  1WFW A;  1WLP B;  2JS0 A;  2AZV A;  2L0A A;  1NG2 A;  1ZUY A;  1W70 A;  2JW4 A;  1AZG B;  2NWM A;  4IIO A;  3M0R A;  3PVQ A;  1NEB A;  3KFV A;  2OI3 A;  5FWB A;  1SRM A;  2K2M A;  2KBT A;  3H0F A;  4AFS C;  4DEY A;  1NYG A;  1BU1 A;  3M0Q A;  4Y92 A;  2ESW A;  3CQT A;  4J9D A;  1Z9Z A;  2DL7 A;  5IXB A;  4JPB W;  1M3A A;  1K76 A;  1RLP C;  1JQQ A;  3QWX X;  4RTY A;  3EG1 A;  2J05 A;  2PNI A;  2XMF A;  1KIK A;  2D1X A;  1VYV A;  2KT8 A;  2DE0 X;  3GBQ A;  2X3X D;  1KSW A;  1AWJ A;  5IHK A;  4ESR A;  3LH5 A;  4GBQ A;  1CKB A;  4Z89 A;  1I1J A;  1UUE A;  2DM1 A;  2O9S A;  1UHC A;  2EGC A;  2CSI A;  4HCK A;  2F2V A;  1PKT A;  1YP5 A;  2ROL A;  2DA9 A;  1X6B A;  2LQN A;  4JZ3 A;  2JMC A;  1I07 A;  1BB9 A;  1FYN A;  5IH2 A;  1UJ0 A;  2KRO A;  1NM7 A;  4LNP A;  2YUP A;  1WXT A;  2DX1 A;  3H41 A;  1T3L A;  3REB B;  1UHF A;  2BZY A;  1WXB A;  1H3H A;  2GNC A;  2GTJ A;  1UTI A;  3EHR A;  2LQW A;  1QCF A;  2EYZ A;  1GRI A;  2CUD A;  3TVT A;  4JJC A;  2LNH B;  1QLY A;  2C0T A;  2O88 A;  2JS2 A;  1WXU A;  1WYX A;  3EG0 A;  1HJD A;  1GCQ C;  1U5S A;  2G6F X;  2CSQ A;  1VYT A;  2O2O A;  2DJQ A;  2A36 A;  1ZUU A;  1QWE A;  3EGU A;  2B86 A;  2BZX A;  4Z88 A;  2YSQ A;  2KXD A;  4J9H A;  4OMQ A;  1GCP A;  1OV3 A;  1X43 A;  3TSZ A;  4JZ4 A;  2K9G A;  2RQT A;  2KRN A;  4HVV A;  1Y0M A;  2M0Y A;  4CC2 A;  1J3T A;  1KFZ A;  4E6R A;  2JMA A;  2DNU A;  2FRY A;  2D8J A;  4J9E A;  3UA7 A;  1K0S A;  1TG0 A;  1PWT A;  1GCQ A;  3EG3 A;  1VYU A;  1KJW A;  2YDL A;  2DIL A;  2HCK A;  2ED0 A;  2O9V A;  2D8H A;  1GL5 A;  2J7I A;  1N5Z A;  1NYF A;  2OJ2 A;  1UE9 A;  3NHN A;  1T0H A;  3VRZ A;  1QKW A;  3UA6 A;  3EG2 A;  1UFF A;  5HCK A;  4M4Z A;  2EKH A;  2QDL A;  3M0S A;  3R6N A;  4F16 A;  1GFC A;  1PRL C;  1OPL A;  4Z8A A;  1WA7 A;  2KNB B;  3SEM A;  2V1Q A;  1UDL A;  4J9C A;  1K1Z A;  4FSS A;  1I0C A;  2HSP A;  1MUZ A;  2F2X A;  5IHN A;  4QT7 A;  2JTE A;  2FPE A;  2BZ8 A;  1SRL A;  1K0X A;  1AZE A;  3VS6 A;  1S1N A;  3RBB B;  2OAW A;  1T0J A;  1X69 A;  1M30 A;  2FG0 A;  4LE9 A;  2AKK A;  2LZ6 B;  3EHQ A;  2IIM A;  4J9B A;  1T3S A;  1HSQ A;  1G2B A;  2ENM A;  1TUC A;  2DLP A;  1WI7 A;  2GGR A;  2W0Z A;  2LJ0 A;  1H8K A;  4D8K A;  1GBQ A;  1A0N B;  1PKS A;  2LX7 A;  1JXO A;  4RTX A;  4A63 B;  3UAT A;  2KT1 A;  4LUE A;  4HVU A;  3U23 A;  2RQR A;  3RNJ A;  1WX6 A;  4ORZ A;  1W1F A;  1AWW A;  2DRK A;  2J6O A;  1PHT A;  2RQV A;  1RI9 A;  1BBZ A;  3I9Q A;  2A28 A;  3NPF A;  4CC4 B;  3UF4 A;  2M51 A;  2KRS A;  1QKX A;  1UGV A;  5GJW B;  1G83 A;  3THK A;  2PZ1 A;  4JJB A;  4EIK A;  1QWF A;  1X27 A;  4CC3 A;  2YT6 A;  1VA7 A;  2DL4 A;  3H0H A;  2H8H A;  3O5Z A;  4OMN A;  3PVL A;  2PTK A;  3VS1 A;  2CH4 A;  1GBR A;  2LJ3 A;  2FEI A;  2LMJ A;  1K9A A;  2V1R A;  4HVW A;  1M3C A;  2K7A A;  1ABQ A;  2E5K A;  4CC7 A;  2MOX A;  2J6F A;  2CH4 W;  2KYM A;  3SHW A;  2JT4 A;  1JEG A;  4AFZ C;  3I35 A;  1YN8 A;  5IXF A;  2GTO A;  4J9G A;  4K11 A;  3QWY A;  1XOV A;  2DBK A;  1UJY A;  2DYB A;  2EYW A;  2RPN A;  2CUB A;  1PRM C;  2K6D A;  2DVJ A; 
#chains in the Genus database with same CATH topology
 4LDU A;  5DY9 A;  1R8O B;  2LDM A;  3VV0 A;  2QQ9 A;  3EFO A;  3CC7 T;  2EPD A;  2YWW A;  4DEX A;  1D0Z A;  4R56 A;  4JRQ A;  5C6S A;  5LJ3 j;  2MK5 A;  2JNG A;  2HQH A;  3EG9 B;  1QMC A;  4FSX A;  1R0C B;  1Y57 A;  4F17 A;  1YJN A;  4RTU A;  5CQY A;  3OQ5 A;  2CRE A;  5GMK h;  4KUD K;  4ZNX A;  4PLL A;  5CKB A;  2YRC A;  2OTJ Q;  4AMC A;  4B6M A;  4C92 D;  5LJ3 e;  3OYL A;  3IQL A;  2FPD A;  2LRQ A;  3NTK A;  1AOJ A;  2VAS A;  3M4G A;  1QVG P;  3EG9 A;  3JCM P;  1YBY A;  2QGF B;  4LD9 K;  4FU6 A;  1ZSZ C;  2WSC E;  1IHV A;  3OW2 P;  1PNJ A;  4PJM A;  3L2Q A;  2HEQ A;  1M3B A;  2RI3 A;  3ZL7 C;  3L2R A;  4M7A D;  1ACM B;  4GLK A;  1K8A C;  1RAA B;  4OGE A;  4C92 E;  4JJN K;  1Q82 C;  1ARK A;  4A4H A;  4YTL A;  1SHG A;  2RO0 A;  3H0I A;  1VQP A;  4J7F A;  4FYY B;  4IUV A;  2HKN A;  2DO3 A;  3EH1 A;  4RMO A;  4D8D A;  1AD5 A;  1UEC A;  3M57 A;  4BY6 C;  1M90 R;  1KK7 A;  2LCL A;  3CD6 A;  4M77 B;  2CP3 A;  4RG8 A;  4ME7 A;  1HK9 A;  1TH7 A;  3JV3 A;  1ZX6 A;  3I56 A;  4JRK A;  2R58 A;  2QEX T;  1FWZ A;  1LCK A;  4GY5 A;  3AHU A;  4XU2 A;  5FW9 A;  5KYY A;  4AG2 C;  2E6Z A;  1WJQ A;  2A37 A;  3VRY A;  5AT1 B;  2KR3 A;  4O6J A;  3VS5 A;  2RQU A;  3CCQ Q;  4DOW A;  5KCH A;  3RKX A;  1M8V A;  3FJ5 A;  1DJ7 B;  2RN8 A;  4IIM A;  4EMG A;  1YJW A;  2FVU A;  2RK1 A;  5FRO A;  5GAN 8;  1M27 C;  1ZUK A;  1VQ9 A;  2L89 A;  2C0O A;  1PD0 A;  1RUW A;  4HKE A;  1SHF A;  3JSC A;  3CME Q;  5A2Q E;  2RNA A;  2VWF A;  2K3Y A;  4M7D B;  1VUB A;  2YLC A;  5CR2 A;  3I55 T;  3OYI A;  2E64 A;  1NLO C;  1WNL A;  1VQ6 A;  4QQD A;  2DAQ A;  1OPK A;  3WVD B;  1YJN T;  1BKB A;  2FHD A;  3CC7 Q;  3JB9 I;  3D7S B;  2O4X A;  2L3S A;  2EGA A;  4M75 G;  3FJP A;  4B9X A;  5L8R E;  3KBG A;  2JM8 A;  5GAM h;  3A98 A;  3M9Q A;  3SFM A;  3X25 B;  3JB9 F;  2VKN A;  2I0N A;  2NUZ A;  4BI8 B;  4BI3 A;  5CO7 A;  2HBP A;  4OMO A;  4NL3 A;  1NEG A;  4Z02 A;  4GLM A;  4FL6 A;  2W10 A;  2E70 A;  2RJE A;  1B07 A;  4MZM A;  4KH0 B;  2MCN A;  4PLI A;  5LJ5 h;  1OX8 A;  2EQU A;  4F7U G;  3S3N A;  2XHC A;  1OOT A;  3VS0 A;  3CCR A;  1WFW A;  3CCE T;  4M78 D;  3OY9 A;  1ZUY A;  1NG2 A;  4XTZ A;  2NWM A;  2Y90 A;  1K73 U;  3HFN A;  3PIP A;  5FLX E;  1Q86 U;  1KD1 R;  2CP2 A;  1WHG A;  1YI2 T;  4PJO B;  2HD0 A;  3J7A F;  4A4G A;  1KQS P;  4M77 C;  4C8Q G;  4FM4 B;  3G4S A;  1BU1 A;  2K5L A;  1VQ4 A;  3CC4 T;  3I56 T;  3QO3 A;  5D6X A;  1Z9Z A;  5IXB A;  4M78 E;  2QK0 A;  4J6W A;  2FB7 A;  1RAH B;  4PJO A;  3OYH A;  1OU8 A;  2PVD B;  1N9S A;  1P92 A;  4KH1 B;  1VYV A;  3GBQ A;  5HK3 A;  3JCM X;  2DTO A;  2QEX Q;  2DZ9 A;  2XU8 A;  2P0K A;  1YJW T;  4ZGE B;  2DM1 A;  2K5F A;  2X51 A;  1UHC A;  2DK3 A;  2COW A;  3MET A;  4HCK A;  4OB0 B;  2F2V A;  1YP5 A;  1OQK A;  2M9U A;  2ROL A;  2DA9 A;  2MWO A;  3C94 A;  1X6B A;  3CCJ A;  4JZ3 A;  3JCM g;  2XK0 A;  1FYN A;  5I2M A;  2DEU A;  1NM7 A;  2YUP A;  3OSS C;  1QVF S;  4OMF B;  2VV5 A;  3JAM E;  3A5Z B;  2RD1 A;  2DJZ A;  3REB B;  1OX9 A;  3PT9 A;  2V8J A;  2GNC A;  4BE0 A;  2DXC A;  3EHR A;  3I55 Q;  3CPW P;  1QCF A;  1BCM A;  4CI0 C;  5A0G A;  3NTH A;  2A7Y A;  3C12 A;  1BI0 A;  3OSV A;  1YJN Q;  1TU0 B;  4JJC A;  1QLY A;  1OZ3 A;  3MEU A;  2JS2 A;  1WXU A;  2F5T X;  3EG0 A;  4A54 A;  5GMK m;  1B7T A;  4OVA A;  4ANJ A;  2DJQ A;  3CPF A;  3BDL A;  4D6W A;  2KXD A;  1VIE A;  4DQ2 A;  3RES A;  3Q1J A;  4OMQ A;  1OV3 A;  5I2S A;  2LX9 A;  4JZ4 A;  4RCC A;  2K9G A;  2KRN A;  3NTI A;  4HVV A;  1BI3 A;  3RKW A;  2E6N A;  5D7U A;  1WHL A;  1M4Z A;  4L6V 5;  1KFZ A;  4E6R A;  3BW1 A;  4HCC A;  2D8J A;  2OTL A;  4J9E A;  3UA7 A;  1N9R A;  1TG0 A;  3CCV A;  1VQP Q;  1VQ5 A;  3CCE Q;  1KG1 A;  2RHY A;  3EGD B;  2HCK A;  3S6W A;  3G6E A;  2ED0 A;  2O9V A;  1GL5 A;  4II1 A;  5KYN A;  1NYF A;  1G3W A;  1UE9 A;  2K4Y A;  3NHN A;  1KC8 C;  2ZPB B;  5C0M A;  1D1B A;  1YI2 Q;  1UFF A;  4X34 A;  1QVG S;  2QG9 B;  2EKH A;  2H3J A;  4FYX B;  3CD6 Q;  2KSS A;  2QDL A;  3PFS A;  4LDV A;  4F16 A;  3HPW A;  4Z8A A;  3I56 Q;  1KD1 C;  3FC3 A;  1QP3 A;  2H3E B;  5GMK i;  4J9C A;  3PTA A;  4M75 B;  2QI2 A;  3JCM d;  4QT7 A;  2JTE A;  3M58 A;  2F69 A;  2BZ8 A;  3VS6 A;  3RBB B;  3LWH A;  3FEO A;  5GAN 3;  3OMG A;  4C5E A;  2LZ6 B;  2IIM A;  4J9B A;  1YJW Q;  4FYV B;  2ENM A;  4UC4 A;  1G8X A;  2GGR A;  1VQ9 Q;  2V8K A;  4D8K A;  1GBQ A;  4N4H A;  2X4Y A;  1MMD A;  3LX7 A;  1JXO A;  2GFU A;  4F7U B;  2KT1 A;  2RQR A;  4OB2 B;  3RNJ A;  1WX6 A;  4ORZ A;  2ZAE A;  2J6O A;  3S3O A;  4ELY C;  2A28 A;  3NPF A;  1WPY A;  4N0A A;  2GFA A;  3EGX B;  1VQ7 A;  3QDF A;  1M1G A;  2MF2 A;  4BD3 A;  5GJW B;  5CKF A;  1X27 A;  3O5Z A;  3L2Z A;  2DL4 A;  2HQE A;  2PTK A;  2RHZ A;  1GBR A;  1Y71 A;  2LMJ A;  1UGS B;  5GAO p;  2V1R A;  4C8Q B;  3QZ9 B;  1SKU B;  3L2V A;  3SHW A;  2JT4 A;  1RAD B;  5DM7 R;  2E12 A;  5HY6 A;  5GAN 2;  4J8O A;  1MGQ A;  3GF5 A;  2GCX A;  3C95 A;  5KYW B;  3CCQ A;  3GIB A;  3VJP A;  2X3X D;  2XDB A;  2CGH A;  2MAM A;  2V26 A;  4J6Y A;  3G6E T;  3GP8 A;  5FU7 C;  2KEA A;  2X9H A;  1UGR B;  2K3B A;  2YUO A;  2YRD A;  3VKI A;  1UG1 A;  4M77 F;  4EMK C;  1M5Q 1;  4X1V A;  4AFQ C;  2DVE A;  1M1K C;  3VYH B;  1X6G A;  2AT1 B;  2ZPH B;  1NPR A;  2F1L A;  5I22 A;  4IKF A;  3CC7 A;  3P8H A;  2SRC A;  3KXT A;  3M59 A;  5LL6 S;  5GAM g;  4LN2 A;  2L2P A;  3CCS T;  4HA8 A;  1SSF A;  2RJC A;  3VS2 A;  3OS1 A;  2K79 A;  1BYM A;  5GMK l;  5M9O A;  5D6W A;  2LT4 A;  4XU3 A;  5L23 A;  1B3Q A;  3JCM J;  4M7A C;  1K73 R;  5LJ5 g;  1Q86 R;  1XQH A;  1ZSZ B;  2HBW A;  4M7D F;  3J80 E;  1KQS S;  1K4U S;  3OYY A;  2LT1 A;  4JS5 A;  1VQN T;  4PJO E;  3F70 A;  2M1H A;  2JXB A;  2CDT A;  2E5Q A;  2SEM A;  2VVK A;  4CRI A;  2G3R A;  3L1A A;  4OMM A;  2FRW A;  2MIO A;  2KQW A;  2KYB A;  5IN1 A;  4J5Y A;  1OU9 A;  3QJ6 A;  4BY6 B;  1VQO T;  1JB0 E;  1K9M U;  3OYJ A;  1PM3 A;  4E7S A;  1ZQ1 A;  2MPX C;  1AWX A;  3PE0 A;  2VXE A;  5HKC A;  3G1J A;  3SB2 A;  3OA6 A;  4OB3 B;  3A8G B;  2L3P A;  2L3R A;  4KGX B;  3M0T A;  1Y7X A;  3VS7 A;  2EWN A;  3HTR A;  1UGQ B;  4XU0 A;  5KYX B;  2QEX A;  3OMC A;  1IRX A;  2X3W D;  1M8M A;  3WXM B;  3UDC A;  3CCU T;  1ZBJ A;  3X24 B;  2JVV A;  3L42 A;  1NLP C;  1YHQ T;  2D0N A;  3CPW S;  2LC4 A;  3E1S A;  4PJO F;  3CCV Q;  3UT1 A;  2KRM A;  1QW1 A;  4A4F A;  2LVM A;  3G6E Q;  5GAM d;  4BI4 A;  2YLB A;  3N5B B;  3CMA T;  5CK9 A;  4E7L A;  2XID A;  1E6G A;  4XQ3 A;  2KY9 A;  1VQK T;  4JLI A;  2EQI A;  4HCZ A;  3V8L A;  4ZTF A;  3CXC A;  3I55 A;  5LJ5 d;  3OB9 A;  3VYG A;  1WHJ A;  2RK2 A;  2CT4 A;  2X35 A;  3CCS Q;  2F5K A;  5LJ3 f;  1EFN A;  2DIQ A;  3OBY A;  1MV3 A;  3ULR B;  5A0D A;  1YNZ A;  2E4H A;  2EAY A;  5IAY A;  1WLP B;  2JS0 A;  4ZTJ A;  2L0A A;  3NFC A;  1AZG B;  4IIO A;  2DXU A;  1H3Z A;  1C0M A;  3PVQ A;  2HSE B;  3HL8 A;  3KFV A;  2OI3 A;  4KT0 E;  1SRM A;  4KBM B;  2K2M A;  4IUT A;  4PL6 A;  3SWN C;  3FDR A;  3CCE A;  1Q86 C;  1VQ7 Q;  3JB9 D;  1NYG A;  3QII A;  3JCM e;  4Y92 A;  3CQT A;  2JN0 A;  2DL7 A;  4QQG A;  1RLP C;  1JQQ A;  2CP0 A;  4RTY A;  3JCM f;  2COY A;  2J05 A;  1YI2 A;  1KIK A;  4FW1 A;  2D1X A;  1QVF A;  1YCY A;  1PCX A;  1VQO Q;  3CC4 A;  2PUK B;  4LDY A;  5J39 A;  1YIT A;  4GBQ A;  5GAN 5;  4Z89 A;  2IVW A;  4QVZ A;  4E2F B;  4PK4 A;  1Y07 A;  4M77 A;  2EGC A;  1N8R U;  1IGQ A;  5KE3 A;  3VUZ A;  1PSE A;  2LQN A;  4E7Z A;  3MEA A;  5IH2 A;  4WF2 A;  1UJ0 A;  1MMA A;  1HYO A;  4LNP A;  1LVK A;  5HK0 A;  3H41 A;  1YHQ Q;  2LQ8 A;  1T3L A;  1VQL T;  1UHF A;  4FT4 A;  1V29 B;  1WXB A;  1H3H A;  1VQ8 T;  1D1C A;  4BUG A;  2X4X A;  4IUR A;  2LQW A;  2EYZ A;  1GRI A;  1V76 A;  2CUD A;  3TVT A;  1N6A A;  2OX7 A;  2R57 A;  2CZ6 B;  3LWI A;  2E3H A;  4M75 F;  4C8Q E;  4KGZ B;  4C92 G;  1HJD A;  1IGU A;  1GCQ C;  2G6F X;  2CSQ A;  3C4S A;  1VYT A;  4M7D A;  4PFP A;  1B34 B;  1ZUU A;  3RUX A;  3OYM A;  2BZX A;  4Z88 A;  1TXQ A;  2YSQ A;  2D9T A;  3MHX A;  3CC2 T;  4J9H A;  1GCP A;  1IRE B;  1X43 A;  3V7R A;  4J83 A;  4E7H A;  3G71 T;  1MMG A;  4JUV A;  3OW2 A;  4M7A G;  4IUP A;  3JCM V;  2M0Y A;  4CC2 A;  4EMH A;  3URG A;  1J3T A;  4F7U F;  3JCM W;  2JMA A;  3HRU A;  3OYN A;  2FRY A;  4JS4 A;  1K0S A;  2OAU A;  1QQJ A;  3JCM c;  1R0B G;  1VYU A;  1X75 C;  2QTV A;  2MI6 A;  1W2B P;  1W4S A;  5KCO A;  3LGL A;  2J7I A;  2QAS A;  5DLQ E;  4QW2 A;  1EX4 A;  2M16 A;  1I4K 1;  1QKW A;  1G3S A;  2NUT B;  3EG2 A;  1U1T A;  1TS9 A;  3R6N A;  3UPU A;  1Q95 G;  2RJD A;  4C8Q F;  5FRM A;  4QQ6 A;  1K8A U;  1WA7 A;  3RDV A;  1Q82 U;  1K1Z A;  1I0C A;  2KVQ G;  5D6Y A;  5GAN j;  4J6X A;  5CVI A;  1TWB A;  1YIT T;  1Q81 U;  3KUF A;  1BCO A;  1AZE A;  1K0X A;  2KDS A;  4MML A;  1T0J A;  1X69 A;  5GAN e;  4LE9 A;  4LXC A;  1M90 C;  2D6F A;  1ZA1 B;  3MP8 A;  2DIG A;  4XU1 A;  1T3S A;  1HSQ A;  4PJL A;  5GAN f;  2W0Z A;  2LJ0 A;  1G3T A;  1H8K A;  1PKS A;  1OI1 A;  2CZ1 B;  4HVU A;  5FU6 B;  2PVG B;  1W1F A;  2DRK A;  1XJW B;  3MEV A;  2QQA A;  1RI9 A;  1XTD A;  4PFO A;  1VIF A;  4XTY A;  1VQL Q;  3QSU A;  4MMK A;  1D09 B;  3E9G A;  3THK A;  4EIK A;  4CC3 A;  3H0H A;  1VA7 A;  3PVL A;  4ATO A;  1WQ7 A;  2RI2 A;  4N4I A;  1WGS A;  1M3C A;  4RCB A;  3JCM b;  1UGP B;  5CQX A;  4CC7 A;  2L5Q A;  2P0Q A;  1JJ2 P;  3I35 A;  1X01 A;  5KH6 A;  3E9F A;  2GTO A;  2QA4 A;  3AT1 B;  3WVE B;  2Z0W A;  3P8D A;  1WZO A;  2DBK A;  3J81 E;  2EYW A;  2RPN A;  3RR6 A;  3MCA B;  3HSB A;  1FMV A;  3A8H B;  2QQB A;  2DVJ A;  4M78 G;  3MEW A;  1NE8 A;  5FWC A;  1WJS A;  3M5A A;  5GAO n;  1EZZ B;  4OML A;  3GOX A;  2E10 A;  2L3Q A;  4J7I A;  1ABO A;  1IO6 A;  3R6O A;  4XTW A;  2EGE A;  3NMZ C;  4OP0 A;  3QDR B;  4FCY A;  1E7O A;  1JO8 A;  2LCC A;  5KE2 A;  2A08 A;  2ROT A;  3EFS A;  5GAO r;  2FZG B;  3DB3 A;  4AG1 C;  4RTT A;  3ZEH A;  5FU7 B;  1YWP A;  2BTT A;  2WSE E;  1KQS A;  2O01 E;  2DD4 A;  3MP1 A;  4EMK B;  3I5R A;  2BE9 B;  2EYY A;  3EGD A;  1C1A A;  3VS4 A;  2K2V A;  1FXX A;  1U3O A;  2LQK A;  2BIV A;  3QXE B;  3EH2 A;  3CC4 Q;  7AT1 B;  1YIT Q;  4C92 B;  4C5I A;  4EMK A;  3DKM A;  2XKO C;  4DA4 A;  3CCS A;  1MHN A;  3JB9 H;  1LJO A;  1SSH A;  1JBM A;  4E7K A;  2HDA A;  4M77 D;  5FU6 C;  4M75 A;  4HT8 A;  1IXD A;  3H8Z A;  4MDX A;  4M7A B;  2COZ A;  3X28 B;  5IT9 E;  1V1C A;  1IZ6 A;  3I5S A;  1YJ9 T;  4C0G A;  3OYK A;  4NL2 A;  2J6K A;  2EW3 A;  1CKA A;  1YIJ T;  2GQV A;  4R0K A;  3HKS A;  2DL5 A;  1BI2 A;  4JJD A;  1VQN A;  2WAC A;  2AK5 A;  4C5H A;  2L8D A;  2Y4Y A;  4F7U A;  4BAC A;  4M77 E;  3CPW A;  2ZPI B;  3PMI A;  2ZPE B;  2P84 A;  3QPH A;  3A8M B;  5EC7 A;  1XNI A;  4WCI A;  1N8R R;  3HP9 A;  2QA4 T;  3FB9 A;  1SEM A;  1JXM A;  4E7I A;  3EGX A;  1E6H A;  2F2W A;  3M0U A;  2C0I A;  2ATC B;  4M7D D;  3JCM Q;  1RAB B;  2KGT A;  1VQO A;  2CT3 A;  3OYB A;  1NBE B;  1FMW A;  2KK4 A;  1D3B B;  3CCL T;  2RQW A;  4C8Q A;  5I11 A;  3X20 B;  1Z9Q A;  4A4K A;  3VU3 C;  2DL8 A;  2EVR A;  1JRI A;  3DB4 A;  1AVZ C;  1PG5 B;  2J06 A;  2AZS A;  2EBP A;  1RAC B;  3CCM T;  3LLR A;  1X2Q A;  4M7D E;  3CCU A;  2NUP B;  2QXF A;  4RG2 A;  2YUQ A;  1YHQ A;  4LUD A;  1GFD A;  2EQK A;  3ER0 A;  5IHI A;  5KYW A;  3QHS A;  3TCJ A;  1KQ1 A;  1NZ9 A;  1KHI A;  4LD6 A;  1PC0 A;  2DTI A;  4XTX A;  2HMA A;  4X9D A;  1ZBX A;  5AYF A;  2FO0 A;  3CMA A;  5I21 A;  2ZGW A;  3TSW A;  1TUD A;  3P8B B;  4RTW A;  2RMO A;  9ATC B;  1VQK A;  4C92 C;  4RTZ A;  3QYG B;  2MWP A;  2DER A;  4KRT A;  4QVC A;  1KC8 U;  2FPF A;  2KMT A;  2LP5 A;  1W2B S;  4PJO D;  2CP6 A;  4C5G A;  1TUG B;  2EJF A;  4WTO B;  1M2V B;  1I8F A;  2AZV A;  5LJ3 h;  1W70 A;  2JW4 A;  3M0R A;  3E2U A;  2PU9 B;  2OTJ T;  1NEB A;  2EJ9 A;  3CXC P;  3INZ A;  6AT1 B;  4OB1 B;  4AFS C;  4JRP A;  3OS2 A;  4O5V A;  4M78 B;  4RKU E;  2HZY A;  3EAE A;  4ZN3 A;  1YJ9 Q;  1Q82 R;  4C0D B;  2ESW A;  1TSF A;  4ZGJ B;  3UWN A;  1ZSZ A;  1K76 A;  1YIJ Q;  1Y96 B;  3QWX X;  1Q81 R;  3EG1 A;  2PNI A;  4N0A C;  4XAX B;  2RJF A;  3SWN B;  1OZ2 A;  3PIO A;  3ZBD A;  2XDP A;  3A1P A;  3PGG A;  4ZN1 A;  3HRT A;  1AWJ A;  4E7J A;  2ZCF B;  3LH5 A;  1G5V A;  4B9W A;  2QA4 Q;  5CAI A;  1NJI U;  1I1J A;  1UUE A;  3SDZ A;  4KUI A;  2EQJ A;  2CSI A;  2DFU A;  5KYU B;  5CIU A;  1VOM A;  5FRN A;  2VB6 A;  2JMC A;  2K5I A;  3RMS A;  3H9N A;  1N8R C;  3H6Z A;  4A4E A;  3CCL Q;  4Q5W A;  5EG2 A;  5KYU A;  2XI9 A;  1WHH A;  2BZY A;  2RHU A;  3CBM A;  3HFO A;  5KYX A;  1X6O A;  1D1A A;  1JJ2 S;  2LNH B;  2WSF E;  2C0T A;  3QKJ A;  4ELZ C;  2O88 A;  1Q7Y U;  1QCO A;  1WYX A;  1VQL A;  3V8J A;  1D0Y A;  3OBW A;  1U5S A;  3VUB A;  1VQ8 A;  2A36 A;  4XTU A;  1QWE A;  2DXB A;  3EGU A;  2B86 A;  2PUO B;  3OYA A;  3QG1 A;  3EFO B;  3CME T;  2JJ9 A;  4JLG A;  3PNW C;  3O8V A;  2XD0 A;  2DPP B;  3RIR A;  2VGM A;  2CZ0 B;  2DNU A;  1M1K U;  3CC2 A;  2VUB A;  2E3I A;  2VYT A;  1GCQ A;  3EG3 A;  8AT1 B;  2DIL A;  2D8H A;  4M78 C;  3G71 A;  2OJ2 A;  2E1H A;  1T0H A;  3VRZ A;  4C0D C;  2EYQ A;  2PQW A;  4OF1 A;  2IPO B;  3UA6 A;  4M75 D;  2DET A;  4F04 B;  3G7Z A;  3OYC A;  3M0S A;  1VQN Q;  1WHK A;  2NYS A;  1PRL C;  1K73 C;  1OPL A;  4LDX A;  3TEE A;  2V1Q A;  4EPC A;  1UDL A;  4FSS A;  4C0Z A;  3CBO A;  1MUZ A;  3OYG A;  2FPE A;  4FW2 A;  1RI0 A;  2X4J A;  1S1N A;  2LTO A;  3GPL A;  2OAW A;  4M75 E;  1M30 A;  4DBF A;  2FG0 A;  4Y91 A;  3LYI A;  2AKK A;  1S72 T;  1Q81 C;  2EIF A;  3EHQ A;  1G2B A;  2XG8 D;  3QZ5 B;  1TUC A;  2DLP A;  1IB8 A;  1WI7 A;  1MND A;  2DZC A;  8ATC B;  2KI7 A;  2RB6 A;  3GNF B;  2LX7 A;  2RI5 A;  4M7A E;  2M0O A;  1MNE A;  5GAN h;  4LUE A;  5GAO m;  3U23 A;  5KYY B;  4BE2 A;  1AWW A;  4F7U E;  2RQV A;  1BBZ A;  3I9Q A;  4P5N A;  2RH2 A;  3SD4 A;  4C8Q D;  3CCU Q;  1QKX A;  4L59 A;  1UGV A;  2BKD N;  3OYF A;  2PZ1 A;  4BB7 A;  2HKQ B;  1QWF A;  2YT6 A;  4OMN A;  2ZPF B;  2H8H A;  1SF9 A;  2QQS A;  2CH4 A;  3M4Y A;  1O75 A;  1K9A A;  3OS0 A;  4HVW A;  1SG5 A;  2K7A A;  2EFI A;  1ABQ A;  2E5K A;  1RAI B;  2MOX A;  2J6F A;  2CH4 W;  3CMA Q;  2KYM A;  2DKG A;  4C92 F;  4R55 A;  4AFZ C;  1IHW A;  1VQK Q;  1YN8 A;  1QVP A;  3FIF A;  5IXF A;  4K11 A;  2V8I A;  3QWY A;  4XK8 E;  2IG0 A;  2O4X B;  1UJY A;  4VUB A;  2CUB A;  3JB9 J;  5GMK j;  4BE1 A;  1PRM C;  4AT1 B;  2E65 A;  1QVG A;  4M7A F;  1WIE A;  2JM9 A;  1B34 A;  2DD5 A;  5GMK e;  5ECA A;  2AIR B;  3MKD A;  5CKD A;  3MPU B;  1YCS B;  2KE9 A;  2O31 A;  4HCB A;  3MP6 A;  2EKO A;  1HD3 A;  4PJN A;  3JB9 G;  4ZGD B;  4OGC A;  2YRV A;  1U06 A;  1UEB A;  2RF0 A;  4JDS A;  3RKY A;  1YFN A;  2EYX A;  2DRM A;  1OEB A;  3V8K A;  2QTX A;  2JTM A;  1KC8 R;  2M02 A;  1VQP T;  2NUT A;  3NGP A;  3M0P A;  1BK2 A;  4PNO A;  1FMK A;  3CXC S;  2FL7 A;  4J9F A;  2LJ1 A;  3VS3 A;  2RM4 A;  2XIC A;  3EFR A;  3TU4 K;  2ED1 A;  1S72 Q;  2BE7 D;  1M9S A;  4KUL A;  3CD6 T;  1SPK A;  1WDX A;  2YUN A;  2P4R A;  5LJ3 g;  1OYX A;  4RUG A;  5J3B A;  1ZA2 B;  1AEY A;  1AWO A;  2KXC A;  2D0Q B;  1D0X A;  1EIF A;  2DBM A;  3QYH B;  1MV0 B;  4BDZ A;  1JU5 C;  3RER A;  1YJ9 A;  2CP5 A;  1K9M R;  1ZSG A;  2I2L A;  3C0C A;  1VQ9 T;  1NJI R;  4DOV A;  2A3L A;  1YIJ A;  1VQ8 Q;  2DMO A;  3M56 A;  4DBQ A;  3REA B;  4M7D C;  1ZLM A;  5DLO A;  2RHI A;  4Y28 E;  1VQ6 T;  3CEY A;  2QYZ A;  1H92 A;  5GAM j;  3BE3 A;  4AFU C;  4QVD A;  3CBP A;  1I5O B;  1C6V X;  2P4T A;  1QCN A;  3CC2 Q;  2GQI A;  4HXJ A;  2AKL A;  1TTH B;  1RAF B;  4OMP A;  3GLX A;  5GAM e;  4M78 F;  2QQR A;  4BDY A;  3G71 Q;  4FYW B;  3JRZ A;  2B8A A;  5GAM f;  1FX7 A;  2DTH A;  5LJ5 j;  1Q7Y R;  5GAO l;  3CCL A;  2DF6 A;  1GXI E;  1W2B A;  3OS5 A;  4PJJ A;  1RLQ C;  2P0P A;  2EQM A;  1X2K A;  3DLM A;  5LJ5 e;  1W6X A;  2DL3 A;  1BIA A;  4A53 A;  5GAN 7;  2HAX A;  2GBQ A;  5CKH A;  5GAO q;  2FYK A;  4J9I A;  3CCM A;  4MDW A;  5LJ5 f;  3A8O B;  2ECZ A;  3CCR T;  5GJV B;  3V7S A;  2MYS A;  2LCS A;  2MMP A;  5LJ3 d;  2ABL A;  2R5A A;  3ME9 A;  1M1K R;  4HT9 A;  1MMN A;  3FRN A;  1VQM A;  3BY7 A;  5J26 A;  4F14 A;  4PJO C;  1CSK A;  1HXD A;  4RTV A;  3QJY A;  1YWO A;  2Y4X A;  3G4S T;  3X26 B;  2VGN A;  1VQ4 T;  2K57 A;  1AT1 B;  5FWB A;  2NLU A;  3OW2 S;  2KBT A;  3H0F A;  4JRI A;  3OYD A;  4DEY A;  4C92 A;  1O9S A;  2FZK B;  2JUF A;  3LGF A;  3M0Q A;  4J9D A;  2ZZD A;  4JPB W;  1M3A A;  1U1S A;  2OTJ A;  1M90 U;  4E47 A;  4MZT A;  2XMF A;  2YHT A;  2QAZ A;  2YXY A;  2KT8 A;  1RL2 A;  2DE0 X;  4M7A A;  2RA2 A;  2HQX A;  3CCJ T;  3E19 A;  2AHJ B;  1KSW A;  2CS7 A;  2DXT A;  1KQ2 A;  5IHK A;  3PMT A;  4ESR A;  4FT2 A;  2JTF A;  1CKB A;  4XTV A;  4L5G A;  5GAN 4;  1OUL A;  2O9S A;  1JJ2 A;  1BI1 A;  1PKT A;  1LOJ A;  2HL5 C;  3MO8 A;  1K9M C;  1AHJ B;  1I07 A;  1BB9 A;  1NJI C;  3A8L B;  2KRO A;  1VQ6 Q;  2E41 A;  1TOV A;  3ASK A;  5CKE A;  4FIB A;  1NPP A;  1WXT A;  2DX1 A;  1R77 A;  2VXF A;  2GF7 A;  3HRS A;  4IUU A;  5GAN g;  3FLG A;  2GTJ A;  1UTI A;  2X4W A;  3MJX A;  2CKK A;  2BUD A;  4IUQ A;  2VC8 A;  4DBR A;  2CYZ B;  1D3B A;  2DEQ A;  3OYE A;  4DBH A;  3LH0 A;  3T9N A;  3S3M A;  2O2O A;  3QUI A;  4X9C A;  2OTL T;  1Q7Y C;  1LPL A;  3CCR Q;  3CCV T;  1VQ5 T;  1RAE B;  3TSZ A;  2NUP A;  1VQM T;  1H64 1;  2RQT A;  1M1F A;  1WQW A;  2LNV A;  1I5L A;  1Y0M A;  4MZP A;  1UB4 A;  3TQ7 P;  1WJR A;  3M53 A;  1U8R A;  3TRE A;  4TVR A;  3CME A;  2DYI A;  1PWT A;  1M2O A;  4M77 G;  2CZ7 B;  1KJW A;  3G4S Q;  2QDY B;  2YDL A;  4KGV B;  1VQ4 Q;  4LDW A;  3L2U A;  1N5Z A;  1I81 A;  3BFM A;  2JOY A;  1G3Y A;  1KHC A;  2HNI A;  1KD1 U;  4M75 C;  5HCK A;  4EDU A;  4M4Z A;  2CP7 A;  2R5M A;  1GFC A;  1M2V A;  1ZHI A;  1K8A R;  5CCA A;  2JZ2 A;  4N4G A;  2KNB B;  3SEM A;  2XDD A;  5A0L A;  3RMQ A;  2HSP A;  5IHN A;  2F2X A;  1SRL A;  4M78 A;  1BIB A;  2PVO B;  3CCJ Q;  4NS5 A;  2KAF A;  3JCM h;  2C06 A;  5GAN d;  4M7D G;  3M55 A;  1Y96 A;  1VQ7 T;  3DLL A;  1A0N B;  3SWN A;  5GAN 6;  1QP2 A;  4RTX A;  3QBY A;  2K3X A;  3UAT A;  4A63 B;  4NOY A;  1PD1 A;  1S72 A;  3LW5 E;  1PHT A;  3L2W A;  4CC4 B;  3UF4 A;  2M51 A;  4C8Q C;  2KRS A;  4V2S A;  2FZC B;  1G83 A;  3V7C A;  4JJB A;  2A0F B;  1QVF P;  3ZFJ A;  3VS1 A;  4C0F A;  3GNG A;  2LJ3 A;  2FEI A;  3BDU A;  3CCM Q;  2RHX A;  1N27 A;  1WHM A;  4PKC C;  2ZPG B;  3CCQ T;  1JEG A;  1PSF A;  2QGG A;  4J9G A;  1XOV A;  2EJG A;  4PFZ A;  2OTL Q;  4QKU A;  3HHT B;  2DYB A;  1VQ5 Q;  1RAG B;  1VQM Q;  2HL3 A;  4PJO G;  1F1B B;  2K6D A;  1LNX A;  3M54 A; 
#chains in the Genus database with same CATH homology
 1WIE A;  5FWC A;  2JM9 A;  4OML A;  2L3Q A;  1ABO A;  5ECA A;  1IO6 A;  2KEA A;  2EPD A;  2EGE A;  4DEX A;  1YCS B;  3NMZ C;  2K3B A;  2YUO A;  1E7O A;  1UG1 A;  2KE9 A;  1JO8 A;  2O31 A;  2A08 A;  2ROT A;  4X1V A;  4AFQ C;  1HD3 A;  4AG1 C;  4RTT A;  1Y57 A;  1X6G A;  4F17 A;  4RTU A;  2CRE A;  4ZNX A;  1U06 A;  1YWP A;  2BTT A;  2RF0 A;  5I22 A;  3IQL A;  2FPD A;  2SRC A;  2EYX A;  2DRM A;  1AOJ A;  1OEB A;  3I5R A;  2EYY A;  4LN2 A;  2L2P A;  3VS4 A;  1U3O A;  3VS2 A;  1PNJ A;  2K79 A;  2HEQ A;  1M3B A;  3NGP A;  3M0P A;  3ZL7 C;  1BK2 A;  5L23 A;  1B3Q A;  1FMK A;  4J9F A;  2LJ1 A;  3VS3 A;  2ED1 A;  1ARK A;  2HBW A;  1SSH A;  1K4U S;  1SHG A;  2HDA A;  1SPK A;  1WDX A;  2YUN A;  3H0I A;  2P4R A;  2JXB A;  1V1C A;  2CDT A;  4RUG A;  4D8D A;  3I5S A;  1AD5 A;  1AEY A;  1AWO A;  1UEC A;  2SEM A;  2KXC A;  2VVK A;  2J6K A;  2EW3 A;  1CKA A;  4OMM A;  4R0K A;  2DL5 A;  2DBM A;  4JJD A;  2FRW A;  2MIO A;  2KYB A;  2AK5 A;  3JV3 A;  1ZX6 A;  1MV0 B;  1JU5 C;  1ZSG A;  3C0C A;  1LCK A;  5EC7 A;  5FW9 A;  1AWX A;  3PE0 A;  2DMO A;  4WCI A;  4AG2 C;  2A37 A;  1SEM A;  3VRY A;  1JXM A;  2L3P A;  2KR3 A;  3VS5 A;  3M0T A;  2RQU A;  2F2W A;  1E6H A;  3M0U A;  2C0I A;  3VS7 A;  3REA B;  3FJ5 A;  2KGT A;  2RN8 A;  4IIM A;  1ZLM A;  2CT3 A;  1M27 C;  1ZUK A;  2X3W D;  1M8M A;  1H92 A;  2C0O A;  4AFU C;  1ZBJ A;  1NLP C;  2RQW A;  1RUW A;  1SHF A;  2GQI A;  2D0N A;  2AKL A;  4HXJ A;  5I11 A;  2RNA A;  2VWF A;  1Z9Q A;  2KRM A;  4OMP A;  2DL8 A;  2EVR A;  1AVZ C;  2J06 A;  2AZS A;  2EBP A;  1NLO C;  1X2Q A;  1OPK A;  1E6G A;  2DF6 A;  2L3S A;  2YUQ A;  2EGA A;  4LUD A;  1GFD A;  5IHI A;  2JM8 A;  1RLQ C;  2EQI A;  1X2K A;  3A98 A;  1W6X A;  2DL3 A;  2GBQ A;  4J9I A;  2VKN A;  2I0N A;  2NUZ A;  2ECZ A;  2FO0 A;  2CT4 A;  5GJV B;  4OMO A;  1NEG A;  3TSW A;  4GLM A;  1TUD A;  2W10 A;  2LCS A;  1B07 A;  4RTW A;  2RMO A;  4RTZ A;  2MCN A;  2ABL A;  1EFN A;  1MV3 A;  4KRT A;  3ULR B;  1YNZ A;  2FPF A;  2LP5 A;  1OOT A;  3VS0 A;  4F14 A;  1CSK A;  4RTV A;  1YWO A;  1WFW A;  1WLP B;  2JS0 A;  2AZV A;  2L0A A;  1NG2 A;  1ZUY A;  1W70 A;  2JW4 A;  1AZG B;  2NWM A;  4IIO A;  3M0R A;  3PVQ A;  1NEB A;  3KFV A;  2OI3 A;  5FWB A;  1SRM A;  2K2M A;  2KBT A;  3H0F A;  4AFS C;  4DEY A;  1NYG A;  1BU1 A;  3M0Q A;  4Y92 A;  2ESW A;  3CQT A;  4J9D A;  1Z9Z A;  2DL7 A;  5IXB A;  4JPB W;  1M3A A;  1K76 A;  1RLP C;  1JQQ A;  3QWX X;  4RTY A;  3EG1 A;  2J05 A;  2PNI A;  2XMF A;  1KIK A;  2D1X A;  1VYV A;  2KT8 A;  2DE0 X;  3GBQ A;  2X3X D;  1KSW A;  1AWJ A;  5IHK A;  4ESR A;  3LH5 A;  4GBQ A;  1CKB A;  4Z89 A;  1I1J A;  1UUE A;  2DM1 A;  2O9S A;  1UHC A;  2EGC A;  2CSI A;  4HCK A;  2F2V A;  1PKT A;  1YP5 A;  2ROL A;  2DA9 A;  1X6B A;  2LQN A;  4JZ3 A;  2JMC A;  1I07 A;  1BB9 A;  1FYN A;  5IH2 A;  1UJ0 A;  2KRO A;  1NM7 A;  4LNP A;  2YUP A;  1WXT A;  2DX1 A;  3H41 A;  1T3L A;  3REB B;  1UHF A;  2BZY A;  1WXB A;  1H3H A;  2GNC A;  2GTJ A;  1UTI A;  3EHR A;  2LQW A;  1QCF A;  2EYZ A;  1GRI A;  2CUD A;  3TVT A;  4JJC A;  2LNH B;  1QLY A;  2C0T A;  2O88 A;  2JS2 A;  1WXU A;  1WYX A;  3EG0 A;  1HJD A;  1GCQ C;  1U5S A;  2G6F X;  2CSQ A;  1VYT A;  2O2O A;  2DJQ A;  2A36 A;  1ZUU A;  1QWE A;  3EGU A;  2B86 A;  2BZX A;  4Z88 A;  2YSQ A;  2KXD A;  4J9H A;  4OMQ A;  1GCP A;  1OV3 A;  1X43 A;  3TSZ A;  4JZ4 A;  2K9G A;  2RQT A;  2KRN A;  4HVV A;  1Y0M A;  2M0Y A;  4CC2 A;  1J3T A;  1KFZ A;  4E6R A;  2JMA A;  2DNU A;  2FRY A;  2D8J A;  4J9E A;  3UA7 A;  1K0S A;  1TG0 A;  1PWT A;  1GCQ A;  3EG3 A;  1VYU A;  1KJW A;  2YDL A;  2DIL A;  2HCK A;  2ED0 A;  2O9V A;  2D8H A;  1GL5 A;  2J7I A;  1N5Z A;  1NYF A;  2OJ2 A;  1UE9 A;  3NHN A;  1T0H A;  3VRZ A;  1QKW A;  3UA6 A;  3EG2 A;  1UFF A;  5HCK A;  4M4Z A;  2EKH A;  2QDL A;  3M0S A;  3R6N A;  4F16 A;  1GFC A;  1PRL C;  1OPL A;  4Z8A A;  1WA7 A;  2KNB B;  3SEM A;  2V1Q A;  1UDL A;  4J9C A;  1K1Z A;  4FSS A;  1I0C A;  2HSP A;  1MUZ A;  2F2X A;  5IHN A;  4QT7 A;  2JTE A;  2FPE A;  2BZ8 A;  1SRL A;  1K0X A;  1AZE A;  3VS6 A;  1S1N A;  3RBB B;  2OAW A;  1T0J A;  1X69 A;  1M30 A;  2FG0 A;  4LE9 A;  2AKK A;  2LZ6 B;  3EHQ A;  2IIM A;  4J9B A;  1T3S A;  1HSQ A;  1G2B A;  2ENM A;  1TUC A;  2DLP A;  1WI7 A;  2GGR A;  2W0Z A;  2LJ0 A;  1H8K A;  4D8K A;  1GBQ A;  1A0N B;  1PKS A;  2LX7 A;  1JXO A;  4RTX A;  4A63 B;  3UAT A;  2KT1 A;  4LUE A;  4HVU A;  3U23 A;  2RQR A;  3RNJ A;  1WX6 A;  4ORZ A;  1W1F A;  1AWW A;  2DRK A;  2J6O A;  1PHT A;  2RQV A;  1RI9 A;  1BBZ A;  3I9Q A;  2A28 A;  3NPF A;  4CC4 B;  3UF4 A;  2M51 A;  2KRS A;  1QKX A;  1UGV A;  5GJW B;  1G83 A;  3THK A;  2PZ1 A;  4JJB A;  4EIK A;  1QWF A;  1X27 A;  4CC3 A;  2YT6 A;  1VA7 A;  2DL4 A;  3H0H A;  2H8H A;  3O5Z A;  4OMN A;  3PVL A;  2PTK A;  3VS1 A;  2CH4 A;  1GBR A;  2LJ3 A;  2FEI A;  2LMJ A;  1K9A A;  2V1R A;  4HVW A;  1M3C A;  2K7A A;  1ABQ A;  2E5K A;  4CC7 A;  2MOX A;  2J6F A;  2CH4 W;  2KYM A;  3SHW A;  2JT4 A;  1JEG A;  4AFZ C;  3I35 A;  1YN8 A;  5IXF A;  2GTO A;  4J9G A;  4K11 A;  3QWY A;  1XOV A;  2DBK A;  1UJY A;  2DYB A;  2EYW A;  2RPN A;  2CUB A;  1PRM C;  2K6D A;  2DVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...