2A36A

Solution structure of the n-terminal sh3 domain of drk
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein E(sev)2B
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a36A00
2CH4A 2AKKA 3VRYA 2RNAA 1M3CA 2LJ0A 3M0PA 1NM7A 1W6XA 3I5SA 3VS5A 2XMFA 4HCKA 2RPNA 4CC3A 1BK2A 1YCSB 2BTTA 2O2OA 4CC2A 2E5KA 1OV3A 1BB9A 3LH5A 2GQIA 1GBRA 2SRCA 2DYBA 1WX6A 5I22A 1ZUKA 1PHTA 2HDAA 2NWMA 3A98A 4AFUC 1JU5C 5EC7A 2DL4A 2SEMA 1YN8A 1K76A 3R6NA 2V1RA 2EPDA 2OJ2A 2A28A 1AD5A 1W70A 1ABQA 4HVUA 4LN2A 2DBKA 4LE9A 2VWFA 4DEXA 1GBQA 2YDLA 1GRIA 2L3SA 2JW4A 3NHNA 1KFZA 5IHNA 2HBWA 5IXBA 1SRLA 1NLOC 1NEBA 2CT3A 2DL5A 1NEGA 1TG0A 5IHKA 2LQWA 4Z88A 2YUOA 3TVTA 1AWOA 2F2XA 2KT8A 1AZGB 2EKHA 1JXMA 4OMQA 2HEQA 2RQWA 2J06A 1NG2A 2M51A 2K7AA 1YNZA 2A36A 2X3WD 2AZSA 3FJ5A 1X43A 2PTKA 3EG2A 4IIMA 3NGPA 2GBQA 3EG3A 4HVWA 4JJDA 1CSKA 2DNUA 1K4US 4RTXA 4LUEA 1J3TA 3VS1A 2YUPA 3TSZA 4JZ3A 1WFWA 2EW3A 1H3HA 1AZEA 3C0CA 2D8HA 3VS6A 3REBB 1GCQC 1PRLC 2KE9A 2H8HA 2EGAA 2LCSA 1W1FA 1E7OA 2EYZA 2LX7A 2L0AA 2NUZA 1HJDA 2AKLA 4AG1C 1A0NB 2RQVA 4D8DA 2DM1A 2FRYA 4OMLA 1K9AA 2V1QA 2PZ1A 3VS7A 2JTEA 1T3SA 2DRKA 1SRMA 1I1JA 4OMMA 3PE0A 4OMNA 1VYTA 2MOXA 2DA9A 1ZUYA 1B3QA 1MV0B 2FRWA 3UATA 2GNCA 3SEMA 2LMJA 4RTWA 3VS3A 4ESRA 1BU1A 1UUEA 2J05A 3RNJA 1KIKA 2KNBB 5FWCA 1RUWA 2OI3A 1WA7A 1TUCA 1GL5A 2KEAA 5GJVB 1UTIA 3M0TA 3H0IA 4FSSA 2P4RA 2ECZA 1XOVA 1K0XA 2HSPA 3O5ZA 2DILA 3M0UA 2CDTA 1ARKA 3PVQA 4AG2C 1UGVA 3I5RA 2L3PA 1Y0MA 2K3BA 4HXJA 1SEMA 1SPKA 3CQTA 1ABOA 5IHIA 1M30A 1Z9ZA 1QKWA 2KYBA 2ED0A 4F17A 2CREA 2VKNA 1JQQA 2O9VA 1N5ZA 3TSWA 2OAWA 1JO8A 4J9DA 4J9FA 2AZVA 2KR3A 1VYVA 1H8KA 3VRZA 4R0KA 4JJBA 1LCKA 1TUDA 1GCPA 2J7IA 2DL7A 5GJWB 2LNHB 1G83A 1NYFA 1I0CA 1OPKA 4Y92A 4ZNXA 1PWTA 4J9EA 2KBTA 4LUDA 1T0JA 1RLQC 2ROTA 2RF0A 3EGUA 4J9GA 2M0YA 1AWWA 1FYNA 1MV3A 3SHWA 2KXDA 1I07A 1X6BA 1HSQA 2A08A 1UE9A 5IXFA 3M0SA 2FPFA 4RUGA 4EIKA 3UA7A 2DL8A 1UHFA 2DVJA 2KRSA 5I11A 1YWOA 3EHQA 2B86A 1OOTA 1BBZA 2HCKA 2K2MA 3U23A 2W0ZA 5FWBA 2DF6A 4CC4B 2YSQA 2YT6A 1QKXA 2LJ1A 3ZL7C 2EQIA 1WYXA 2D0NA 2RQTA 2RQUA 4QT7A 4A63B 4JJCA 3UA6A 2BZXA 2FPEA 3JV3A 4RTVA 2D1XA 2KRMA 5L23A 1U06A 1HD3A 1Z9QA 2LZ6B 2LP5A 1X2KA 3M0RA 2GGRA 2DL3A 4M4ZA 1KJWA 1CKAA 2EBPA 1WXTA 4RTYA 4J9BA 2JXBA 2MIOA 4AFSC 2LQNA 1UG1A 1ZBJA 2JT4A 1H92A 1B07A 1FMKA 2KT1A 1QLYA 1E6GA 1U3OA 3UF4A 1PKSA 2DMOA 1AEYA 1SSHA 2L3QA 1MUZA 2K6DA 1X27A 2KYMA 4HVVA 1AOJA 2JM8A 1K0SA 3IQLA 1PNJA 2ROLA 1UHCA 1WLPB 1AWXA 1YWPA 3H41A 2JMAA 1Y57A 2DRMA 4J9HA 2I0NA 1PKTA 3REAB 1UDLA 2EVRA 3PVLA 4OMOA 1WI7A 2JS0A 2BZYA 1SHFA 1UJ0A 1JEGA 4F14A 2CUBA 3THKA 1T0HA 2EYWA 2K9GA 4F16A 3H0HA 1PRMC 2FPDA 2F2VA 2J6KA 1KSWA 2X3XD 5ECAA 2D8JA 4J9CA 2KRNA 2GTJA 4KRTA 1GFDA 2JS2A 2FG0A 4CC7A 4GLMA 1EFNA 2L2PA 5FW9A 1M27C 4ORZA 4K11A 1M8MA 2J6OA 1VA7A 2CSQA 1WIEA 2IIMA 3NPFA 4JPBW 2QDLA 4Z89A 2JMCA 2DJQA 4J9IA 1SHGA 1ZSGA 1QWEA 1IO6A 3QWYA 1WXBA 2PNIA 2C0OA 2EGEA 2DBMA 3EG1A 1E6HA 1RI9A 2JM9A 2RN8A 2EGCA 2O9SA 3VS0A 4E6RA 1K1ZA 4RTUA 1UECA 1U5SA 4WCIA 4JZ4A 2ABLA 2LJ3A 3H0FA 3KFVA 4D8KA 2J6FA 1NLPC 4OMPA 2CH4W 2A37A 1X2QA 3EG0A 1GCQA 3GBQA 1VYUA 2K79A 1JXOA 2CSIA 2KROA 1CKBA 2VVKA 2GTOA 2RMOA 1UFFA 4DEYA 1NYGA 1X6GA 1ZUUA 4X1VA 2ESWA 2G6FX 2CT4A 1G2BA 1UJYA 1GFCA 1M3BA 4GBQA 1QCFA 2DLPA 5HCKA 2DE0X 2RQRA 3RBBB 1S1NA 2C0TA 3NMZC 1T3LA 4LNPA 2ED1A 3I35A 2FO0A 4AFQC 5IH2A 1WXUA 2F2WA 3VS4A 2O31A 2W10A 2CUDA 2BZ8A 4Z8AA 2EYXA 1ZX6A 1OPLA 2YUQA 1AWJA 1ZLMA 2EYYA 1X69A 1RLPC 1OEBA 2AK5A 3VS2A 2FEIA 2ENMA 1WDXA 3M0QA 1AVZC 2MCNA 3EHRA 3I9QA 1V1CA 1YP5A 2KGTA 1M3AA 1QWFA 4AFZC 2C0IA 2DX1A 4IIOA 4RTZA 3ULRB 2KXCA 3QWXX 2O88A 4RTTA 2YUNA
chains in the Genus database with same CATH superfamily
1EZZB 4KUIA 4XU3A 4ZN3A 2RNAA 3E9FA 3I5SA 4PJOF 4MMKA 2K5FA 5GAMe 4L6V5 3QZ5B 2K57A 2RO0A 4NL3A 1HK9A 3CCSQ 1SF9A 4IUUA 5GAMj 3JSCA 3MPUB 2DYBA 3BE3A 5I22A 1ZUKA 3G71A 2FZGB 1PHTA 2NWMA 1ZSZC 3M59A 1KQ2A 4QKUA 5EC7A 2DL4A 3PIPA 3R6NA 2V1RA 3VU3C 1AD5A 5KE3A 4LN2A 1BYMA 2DBKA 1D0ZA 4DEXA 2YDLA 1IRXA 1GRIA 4A4FA 2DIGA 4LDWA 2NUPA 4M78E 5IXBA 2LT1A 3PNWC 3CMEA 5IHKA 5KYYB 2CKKA 1VQ7Q 1N9SA 2V8JA 3CCQQ 1QCNA 1RABB 2RQWA 4HKEA 2J06A 1V29B 3EFOA 4LDVA 4M7DA 2A36A 2EQKA 4M75G 3FJ5A 1VUBA 2PTKA 1NBEB 4KGZB 4IIMA 1QVFA 3J80E 2DXCA 3DB3A 3L2WA 1YHQT 2DTHA 2DNUA 4C8QF 4BDYA 1OU9A 4DBQA 4RTXA 3BDUA 3VS1A 3QZ9B 4B6MA 2EQJA 1VQNT 2EW3A 5GMKh 3M4YA 4MZTA 3I56T 1Q7YC 1NE8A 4EMKC 1PRLC 3H6ZA 3MJXA 3J81E 4LDUA 5EG2A 2EYZA 2LX7A 1VIFA 1IHVA 2K5LA 2O4XB 2NUZA 4F7UB 4PJJA 1HJDA 2AKLA 2M16A 2DAQA 3SFMA 4C5GA 4HCZA 1T3SA 4L59A 5GANd 1SRMA 3WVDB 3QXEB 2KY9A 4OMMA 4OMNA 1WJQA 2MOXA 3KBGA 2FRWA 2GNCA 3SEMA 2LMJA 4ESRA 1Y07A 2J05A 4BUGA 1B7TA 1KIKA 3C95A 3OYJA 5HK3A 5CKBA 4M77C 1UTIA 2VASA 3H0IA 2VGNA 3HRSA 1XOVA 2HSPA 6AT1B 2E3HA 3PVQA 5CKHA 1VQ9A 1Y0MA 3TQ7P 3TU4K 3META 2E4HA 4DA4A 5GANh 3URGA 1RACB 1ABOA 5LJ5g 2QGFB 1G5VA 5FLXE 2DIQA 1OZ2A 3I56Q 4HCBA 2MK5A 1C0MA 3VJPA 5CK9A 1S72Q 3LW5E 1YJ9T 1YBYA 3ZBDA 3M54A 2MMPA 2QEXT 3TSWA 1JO8A 2RHZA 4J9FA 2AZVA 4C92G 2KR3A 4R0KA 1LCKA 4QQDA 3OYNA 2K3XA 2CP3A 5I2SA 3E1SA 3SWNC 4J9EA 3MP6A 2X35A 3EGUA 3M5AA 2JTMA 3EGXB 2A08A 4RUGA 3CEYA 1TXQA 1TTHB 1VQ8A 2DVJA 4M7AA 4M78A 5I11A 1YWOA 4M75B 3U23A 3EGDA 5I2MA 3OS2A 2XK0A 5FWBA 1NPPA 1RAGB 3CMAQ 2YT6A 4ZGEB 2LJ1A 5GANf 1EX4A 3ZL7C 1W2BP 1WHKA 3CCJQ 4M7DC 3L2RA 3CC4A 4R55A 1YIJA 4A4HA 2D0NA 1QCOA 1YJWQ 2RQTA 1OQKA 5KH6A 4QT7A 3JV3A 2OX7A 1Y96A 4J5YA 1Z9QA 1VQKT 3EFSA 2HAXA 1X2KA 3M0RA 2ZPHB 2DL3A 1VQPA 2IPOB 5CKDA 4JRKA 4OB0B 4RTYA 4IURA 2LQNA 1UG1A 2FZCB 1FMKA 1WHJA 3MEVA 1D3BA 1YJNQ 1VQMA 4XTUA 5CKFA 1AEYA 3CBPA 1X27A 4FYWB 1RAEB 3I55T 1VQ6T 3LYIA 1K0SA 3IQLA 1PNJA 3CC7A 4BB7A 1O9SA 1WLPB 1YWPA 4J9HA 3BFMA 4AMCA 1R8OB 4OB3B 3CCRT 4J6YA 2QTVA 5LJ5e 4N4IA 4R56A 1YI2T 3LWIA 2BIVA 2BZYA 1KQSP 4PJOG 1UJ0A 2PU9B 4F14A 3OS1A 2DYIA 5LJ5j 3THKA 4F16A 1PRMC 2YLCA 2FPDA 3JCMQ 2X3XD 2ZZDA 3QDFA 5ECAA 5C6SA 4KRTA 3FDRA 2X4YA 1MMNA 1K8AR 1UGRB 5DY9A 1LPLA 1M27C 4RG2A 2DXTA 4JPBW 2QDLA 3SDZA 4C92B 2GCXA 2IG0A 4X34A 4C5IA 4J6XA 2B8AA 3PTAA 2MAMA 1IO6A 3QHSA 2PNIA 2RJDA 2DBMA 1NJIR 2O9SA 4E6RA 3WVEB 2F69A 1K1ZA 1G3TA 2LJ3A 5GAOm 4D8KA 2J6FA 2XDPA 2CH4W 1X2QA 3DLLA 4MMLA 1GCQA 4MZPA 1W2BA 2K79A 4NL2A 2KROA 4N0AA 2DFUA 1RAFB 1EIFA 1M4ZA 4LDYA 5CAIA 2RJCA 1ZUUA 2JUFA 4FYXB 2HKNA 2A3LA 1V76A 3AT1B 2QQ9A 1W2BS 2HQXA 3A5ZB 3QYHB 4GBQA 1UGQB 2DLPA 2YRDA 2RQRA 3G71Q 1YHQA 2H3EB 4M77F 2C0TA 3NMZC 4M78C 2MYSA 4LNPA 3SD4A 3OW2P 1VQNA 5HK0A 2F2WA 3VS4A 3QKJA 1VOMA 3GNGA 3OYDA 2DK3A 3CMEQ 2BE9B 2YUQA 5KYNA 2E5QA 1MNDA 2EYYA 4BY6B 3CPFA 4FSXA 1I5LA 1G3WA 3VUBA 3X20B 1RLPC 2ENMA 1K8AU 1AVZC 3EHRA 1G8XA 4XQ3A 3G4ST 2HQEA 2KGTA 1VQ9T 4KGVB 4OF1A 3CPWP 1M3AA 1QWFA 4AFZC 2C0IA 2VYTA 3X26B 5KYWB 1KQSA 3X25B 3OYBA 3E2UA 2O88A 4RTTA 5KCOA 3CCVT 2KQWA 1NJIU 3VRYA 3A8HB 2PQWA 2LJ0A 2XMFA 3OYFA 1Q95G 3HRUA 2CP5A 5LL6S 5GAN4 2RPNA 4CC3A 4PJOB 2K2VA 2DO3A 1Q7YR 4PJNA 3JB9D 2BTTA 2O2OA 4CC2A 4JRQA 1OV3A 3JCMg 1BB9A 3LH5A 2GQIA 1HXDA 3ER0A 3QG1A 3OYHA 1KD1C 4IUPA 4ELYC 3A98A 5FU6C 2L8DA 4Y91A 2SEMA 5J39A 1K76A 2LVMA 2EPDA 1KK7A 2A28A 1ZA2B 4HVUA 2CP2A 4XTYA 1D1AA 2WACA 4CI0C 1YJ9A 2QEXA 2VXFA 3C4SA 2HBWA 4M7DF 2RJFA 1NLOC 2L3RA 2DL5A 1WHHA 1WGSA 2YUOA 4B9XA 2DPPB 2FZKB 2LQKA 3CCMT 3PGGA 1Q81R 1AZGB 2AIRB 1PG5B 4OMQA 2HEQA 3FC3A 2DEUA 3RESA 3QO3A 2HKQB 2AZSA 3EG2A 2E6NA 3NGPA 2H3JA 1GXIE 3EG3A 5KYUB 3OW2A 5A0GA 2RHIA 1QVPA 2YUPA 5LJ5d 1H641 1U1TA 4C8QB 4II1A 2F5KA 3RKWA 2L5QA 1H3HA 1D1BA 2D8HA 1VQPT 4FU6A 2F1LA 1GCQC 4EPCA 2FB7A 1IREB 2JTFA 2KE9A 3OYLA 2EGAA 2LCSA 4LXCA 1W1FA 1E7OA 1K8AC 1SG5A 3V7RA 1Q7YU 1IZ6A 3ZEHA 3P8BB 2PVDB 1TS9A 3M53A 4OMLA 3WXMB 4MDXA 4FT4A 3QBYA 3VS7A 3L2UA 3A1PA 2OTJQ 3VUZA 5LJ5h 3CCET 1ZUYA 2QDYB 4E7IA 1VQ8Q 2YWWA 4RTWA 3MEWA 4V2SA 2ZPBB 2DD4A 5FU7B 3RNJA 4M7AD 2KNBB 4DBRA 2OI3A 4JDSA 1WQ7A 3RERA 2KEAA 5GJVB 4ANJA 2CP0A 3OBWA 3CBOA 3JRZA 1QW1A 4PFZA 3EH2A 2DILA 3KUFA 2CDTA 1M1KC 3I55A 1VQ6A 3OSVA 1Q81U 3KXTA 3CC4Q 1TU0B 1ACMB 4J7FA 1TH7A 1YIJQ 2JZ2A 3G6EQ 1SEMA 5CQYA 1WPYA 2R58A 3JCMe 4JS4A 3CCRA 4XTWA 1QKWA 1D1CA 1YI2A 2ED0A 1XTDA 2A7YA 2QYZA 2CREA 4KULA 3TEEA 2LC4A 2O9VA 1U1SA 2RI2A 1Q86R 3CXCP 3QYGB 2OAWA 5LJ3g 1VQMQ 4RCCA 1VYVA 1X01A 2COZA 2QQRA 4M7AE 1R0BG 2COYA 2J7IA 2E41A 2LNHB 1I0CA 1OPKA 3CC7Q 2CP6A 1PWTA 2EJGA 1T0JA 5LJ5f 2ROTA 4M78F 2A0FB 2E10A 3INZA 2M0YA 1MV3A 4C92A 2I2LA 3LLRA 2KXDA 1UEBA 5CVIA 3QSUA 1UE9A 4VUBA 2M02A 3HKSA 3M0SA 2FPFA 4FIBA 3V8JA 1U8RA 3EG9B 2M1HA 1WNLA 1Y7XA 2HCKA 2K2MA 2W0ZA 4TVRA 2D9TA 5J26A 2DF6A 3MKDA 4JLIA 4CC4B 3OYIA 3OYAA 2E64A 2YSQA 1LOJA 1QVFS 5KYXA 4DBFA 4GY5A 3S3OA 1X75C 4M77G 4B9WA 2RI3A 2WSFE 3LGFA 4Y28E 4JJCA 2BZXA 4D6WA 2FPEA 4RTVA 2D1XA 3OYEA 4XTVA 1UGSB 3T9NA 1KJWA 4C0DC 5GMKm 1WXTA 2CGHA 4EMGA 3C94A 2MIOA 4AFSC 3GOXA 4KUDK 2RK2A 1H92A 3DLMA 4HT9A 5D6WA 3A8MB 5D7UA 1QLYA 3JB9H 1PKSA 2DMOA 4ZGDB 2L3QA 1Q81C 3L2QA 2QQSA 3VKIA 2JM8A 3PMTA 3FEOA 2XICA 3V8LA 1MNEA 2ROLA 1UHCA 2WSEE 4RMOA 2BUDA 3H41A 4E7HA 3G4SA 2JMAA 1Y57A 2DRMA 2HZYA 4E7SA 2I0NA 3REAB 1ZSZB 1KC8C 3QDRB 1YHQQ 4EMHA 2E12A 1M2OA 2R5MA 1WI7A 5GAN2 2OAUA 1WZOA 3CCVA 2ZGWA 1VQNQ 2CS7A 4ZGJB 2RJEA 1T0HA 1FMWA 3CXCA 3FRNA 3S3MA 1YFNA 4IUVA 2MI6A 1KSWA 1VQLA 3PT9A 1KHIA 5LJ3e 1MMGA 5DM7R 2JJ9A 3OBYA 1JRIA 1EFNA 5FRMA 3JAME 4PJOA 5LJ3j 5CO7A 1M8MA 2QQAA 3H9NA 2IIMA 4C0GA 3J7AF 4JS5A 2Y90A 4E7ZA 4A4EA 1SHGA 5A0DA 3NTIA 1ZSGA 2EIFA 2FVUA 2LQ8A 4M7DG 1WXBA 3VYGA 1E6HA 2QGGA 2RN8A 2EGCA 4BACA 4EMKB 1QVGP 1UECA 2D0QB 4JZ4A 1G3YA 1OX8A 2FHDA 2G3RA 2A37A 3M56A 1ZBXA 3CCMA 5DLQE 1AHJB 4OB1B 1VQ5T 2GTOA 4ZTFA 4J6WA 3CCUT 1UFFA 4DEYA 1NYGA 4DQ2A 2V26A 1RAAB 4X9DA 1K9MC 4XAXB 1O75A 5GAMd 1GFCA 2P4TA 3G1JA 5HCKA 2DE0X 2QG9B 4XU0A 1B34A 4O6JA 3RBBB 4F7UE 1XNIA 1T3LA 2OTLT 2ED1A 3I35A 1BCOA 2VV5A 3MEAA 5IH2A 4M77B 3HTRA 2BE7D 1KD1R 1YJ9Q 4C8QA 1Q86C 2CUDA 3O8VA 1QP2A 4Z8AA 2QEXQ 1SSFA 2LNVA 1BI2A 4C5HA 1OPLA 1Q82C 2AK5A 2M0OA 7AT1B 1WDXA 3DB4A 3CCLT 2MCNA 4N4HA 3I9QA 4JLGA 4KH1B 5GAMh 2XHCA 2KAFA 3JCMJ 4KT0E 2XIDA 4IIOA 2GFAA 4YTLA 2EQMA 3CCEA 4HCCA 3QJ6A 4QQGA 3OMGA 3UDCA 2YUNA 1XQHA 2XU8A 4BI4A 3HFOA 1LJOA 3TREA 4NS5A 3M55A 3OA6A 1M3CA 2P0QA 3M0PA 1NM7A 2XD0A 1W6XA 3VS5A 2HNIA 2AT1B 1WQWA 3CBMA 2F5TX 3SWNB 4N4GA 3OYMA 4O5VA 1YCSB 4OB2B 4ELZC 1FXXA 1TUGB 2Y4YA 4Q5WA 1KG1A 1WX6A 4EDUA 1VQKQ 4AFUC 1YN8A 2NUPB 1QVGA 3TCJA 2OJ2A 1ABQA 1W4SA 1N8RC 4L5GA 4PFPA 1KD1U 2VWFA 1LNXA 1GBQA 2JNGA 2L3SA 1KFZA 5IHNA 1SRLA 1NEGA 1TG0A 4Z88A 5KE2A 4M7DB 3TVTA 5GMKi 5L8RE 4M78G 3I55Q 1VQ6Q 1FMVA 1P92A 5GAMf 3FB9A 1JXMA 2DXBA 1NG2A 5KYYA 2K7AA 1JJ2P 1YNZA 1M1KR 3CCRQ 2RHYA 2XKOC 5GAOr 1YI2Q 8ATCB 3C12A 3EH1A 4QQ6A 3FIFA 3TSZA 2EYQA 2LDMA 1WFWA 5GAOn 4M7AC 5GAOl 3VS6A 4DOVA 3REBB 5CQXA 3R6OA 3CD6T 1N9RA 2DZ9A 1PSFA 5IN1A 5LJ3d 4FYYB 2X4JA 3A8LB 1BIBA 2RQVA 4PJMA 2FRYA 4PFOA 2V1QA 2PZ1A 1PCXA 2JTEA 2DETA 2O4XA 4F7UA 5DLOA 1I1JA 3PE0A 4C92D 1PD0A 1B3QA 1MV0B 3JB9J 5GAN7 2NYSA 3N5BB 1QQJA 1BU1A 1UUEA 3GLXA 1X6OA 5FWCA 1RUWA 1WA7A 2E70A 2PVGB 3M0TA 4FSSA 2P4RA 1JB0E 1K0XA 3O5ZA 3GF5A 5LJ3h 1KQSS 5GAOq 1R77A 3M0UA 1VQLT 3GP8A 1ARKA 4A54A 2QI2A 1FX7A 4AG2C 2L3PA 3EAEA 3BW1A 3A8OB 2K3BA 3OS5A 3V7CA 1SPKA 3QUIA 3UT1A 5J3BA 1M1KU 3CC2T 3QPHA 1VQOT 5IHIA 1M30A 1I5OB 4UC4A 4PLIA 1ZQ1A 1RI0A 2RHXA 1M1GA 8AT1B 4F17A 3BDLA 1ZA1B 4C92E 5GAN5 2VKNA 1JQQA 1YITT 1N5ZA 3CMAA 1H8KA 3VRZA 2QA4A 1K73R 1TUDA 2QQBA 3MP8A 1GCPA 4BI8B 2DL7A 5GJWB 1G83A 2RD1A 1JJ2A 4FW1A 2MPXC 3HPWA 3G4SQ 1VQ9Q 3M4GA 1RLQC 2RF0A 1FYNA 1WJSA 2RM4A 3SHWA 2MF2A 4M78B 3S3NA 3HRTA 1X6BA 3VYHB 1JJ2S 5IXFA 3OYKA 1VQ4T 2YLBA 3CCVQ 4E7KA 3UA7A 1KC8R 4QVCA 2JOYA 4Z02A 3EGXA 3EHQA 2B86A 1OOTA 1MGQA 1NZ9A 5LJ3f 4EMKA 3PMIA 3MHXA 3SB2A 4OGEA 4KGXB 4WF2A 3JB9F 1IGQA 2XDDA 1OZ3A 2Y4XA 4M75A 3RKXA 3OW2S 1OX9A 3ASKA 4N0AC 2YRVA 4RKUE 1VQ5A 2O01E 3CCUA 5A0LA 4JRIA 4PJOD 3NFCA 4OGCA 2HMAA 3X24B 3CCST 1BCMA 1WYXA 3E19A 4IUQA 2RQUA 4PLLA 2K5IA 3CPWA 3OQ5A 1H3ZA 2KRMA 5L23A 1U06A 1HD3A 2VB6A 2LCLA 2OTLA 3BY7A 2GGRA 4M4ZA 1CKAA 4PK4A 2JXBA 3V8KA 1ZBJA 3CPWS 1B07A 2KT1A 4XU1A 1E6GA 4XTZA 2FYKA 2HL5C 1U3OA 2EJ9A 3UF4A 2QK0A 3CCMQ 2XI9A 5CCAA 1MUZA 3V7SA 2K6DA 4HVVA 1VQ7T 5D6XA 4FCYA 1MMAA 1BI3A 3CCLA 2EKOA 3L42A 1AWXA 1PKTA 4JUVA 5FU6B 2KSSA 1NPRA 3GNFB 4PJOE 2V8KA 1K9MR 4OMOA 4NOYA 2LTOA 2KK4A 3D7SB 1KC8U 2CUBA 2NUTB 2QAZA 2EYWA 3E9GA 2K9GA 3OSSC 1YCYA 3H0HA 1VQPQ 1M90C 1QMCA 2DKGA 4C8QD 2F2VA 2J6KA 3GPLA 2D8JA 5AT1B 1M5Q1 1M9SA 3AHUA 2FG0A 4KBMB 3FJPA 2KVQG 3SWNA 4ORZA 4K11A 1Q82R 2J6OA 1VA7A 2CSQA 1WIEA 3NPFA 3JCMb 4Z89A 1M2VB 2EJFA 2RK1A 4LDXA 2GQVA 3CCEQ 2XG8D 4M7AF 1KHCA 2PUOB 2IVWA 3NTKA 2EGEA 2P0KA 1RI9A 1U5SA 4WCIA 2ABLA 2AHJB 1NLPC 2L89A 3EG0A 3PFSA 1BIAA 3GBQA 2DVEA 1JXOA 2K4YA 4C8QE 2VVKA 2RMOA 4X1VA 2DJZA 2ESWA 2CT4A 2G6FX 1G2BA 1UJYA 4PNOA 1M3BA 1QCFA 2EAYA 1K9MU 4LD6A 5C0MA 2FO0A 3MEUA 2HQHA 3LH0A 1SKUB 5IAYA 2DTOA 2E65A 1S72T 4CRIA 2CZ7B 3CD6A 1K73C 4M75C 2GF7A 1N8RR 3L1AA 1ZLMA 3FLGA 1Q86U 3VS2A 3JCMX 2FEIA 4QVDA 2KDSA 1Q82U 4ME7A 4XU2A 1V1CA 3M58A 4XK8E 4C5EA 2X4XA 1N27A 4A4GA 2RA2A 2YRCA 4RTZA 3ULRB 5A2QE 3UWNA 2KXCA 4GLKA 4A4KA 1RAHB 1DJ7B 3RDVA 5GMKl 3PIOA 2CH4A 5KYWA 2AKKA 1BI1A 3GIBA 5CKEA 2D6FA 4HCKA 2ZPEB 3CMAT 2KMTA 4KH0B 1BK2A 2QA4T 2E3IA 3HFNA 3CCJT 2E5KA 3CXCS 3JCMW 3CC2A 2CP7A 1TSFA 3M57A 1GBRA 1YJWT 1UB4A 2SRCA 1VQOA 4QW2A 1M8VA 2PUKB 2HDAA 1JU5C 2GFUA 2CZ0B 4OP0A 3RKYA 4BE1A 4PL6A 1W70A 2YXYA 4LE9A 1YITA 4MDWA 2JW4A 3NHNA 4DOWA 1OULA 1NEBA 2CT3A 3OB9A 1YJNT 1N8RU 2C06A 2LQWA 2HSEB 1AWOA 2F2XA 2XDBA 2DZCA 2KT8A 2EKHA 1LVKA 2HL3A 2KI7A 1IXDA 1D0XA 5HKCA 1PSEA 2M51A 1OI1A 3JCMc 2X3WD 2VGMA 4E2FB 4FT2A 2M9UA 2OTJA 1X43A 1RADB 1OYXA 4BDZA 2GBQA 2QTXA 4C0DB 4C92C 4HVWA 4JJDA 1VQ4A 1CSKA 2LCCA 1PM3A 1K4US 4LUEA 1J3TA 3JB9G 4JZ3A 3JCMd 1BI0A 2Z0WA 5KYUA 1AZEA 3C0CA 4FW2A 1C1AA 5D6YA 3LX7A 2QA4Q 2H8HA 1RL2A 3A8GB 1WHLA 1G3SA 4F7UF 5KCHA 4E7LA 2ZPGB 3G6EA 2L0AA 4AG1C 2CZ6B 3CCSA 3DKMA 4D8DA 2DM1A 3ME9A 4E7JA 1A0NB 2RI5A 1K9AA 2DRKA 3MCAB 3S6WA 4FL6A 1VYTA 5GAN8 2DA9A 2QXFA 1Y71A 3JCMh 3UATA 3VS3A 3HHTB 5FRNA 3QJYA 3OY9A 3EFRA 1TUCA 1GL5A 2DERA 1FWZA 2ECZA 1VQ7A 4M75D 2K3YA 1VQ5Q 3VV0A 2COWA 3CCUQ 1R0CB 1UGVA 3I5RA 3CCQA 2P84A 3MO8A 2ZPFB 4BY6C 3OYGA 4HXJA 1PC0A 3CQTA 3RIRA 2LRQA 4BE0A 1Z9ZA 4IUTA 2KYBA 2VUBA 2VC8A 3G71T 2OTLQ 3RR6A 2E1HA 4A53A 3HL8A 2X4WA 3JCMV 2NUTA 1JBMA 4M77D 4J9DA 3OMCA 1WHGA 3CMET 4JJBA 2EQUA 4JRPA 1C6VX 5M9OA 1RAIB 1I8FA 4PKCC 2MWPA 1NYFA 3EFOB 3CCLQ 1QVGS 5GANg 1IB8A 4M7AG 4Y92A 4ZNXA 4PJOC 4OVAA 4BD3A 2KBTA 4LUDA 4M75E 2ZPIB 4J9GA 5GAN3 1AWWA 3JCMf 1M2VA 5HY6A 3P8DA 1I07A 1HSQA 2FL7A 4EIKA 3H8ZA 1OU8A 2DL8A 1UHFA 4M75F 2KRSA 4J8OA 3ZFJA 4J7IA 2R57A 1BBZA 2HD0A 1ZHIA 4HA8A 5KYXB 3EG9A 1QP3A 4ATOA 5CIUA 2EWNA 1M90R 1QKXA 4RG8A 4C8QG 4M77E 2ATCB 1WJRA 2EQIA 2DD5A 1KQ1A 2NLUA 1HYOA 2RH2A 4A63B 3UA6A 1UGPB 2LZ6B 2LP5A 2LX9A 2JN0A 4C0FA 4QVZA 2LT4A 2CZ1B 5GMKe 2EBPA 3I56A 4AT1B 1F1BB 4J9BA 3L2ZA 2JT4A 1S72A 4C8QC 1PD1A 5GMKj 2CYZB 1SSHA 4FM4B 3JCMP 2KYMA 1AOJA 5AYFA 4DBHA 2VXEA 3L2VA 4M7DD 4IKFA 4LD9K 1IGUA 3Q1JA 1UDLA 1N6AA 2V8IA 2EVRA 4BI3A 3PVLA 2JS0A 1ZSZA 1SHFA 1JEGA 1I81A 2E6ZA 4WTOB 5GAOp 2RHUA 5IT9E 3CD6Q 3HSBA 5FU7C 1BKBA 4J9CA 2KRNA 5GAMg 2GTJA 1GFDA 3LWHA 2JS2A 4CC7A 1M90U 4GLMA 4PJLA 3HP9A 2L2PA 5FW9A 4OMFB 3OS0A 3CCJA 4ZTJA 5GANe 2P0PA 4JJNK 4C92F 1YJWA 3M9QA 4M7DE 2JVVA 2JMCA 9ATCB 3MP1A 2DJQA 3NTHA 2MWOA 4J9IA 3G7ZA 5GANj 2ZCFB 1QWEA 2OTJT 3QWYA 4M7AB 2C0OA 3EG1A 4J83A 1VQ8T 4F04B 1I4K1 2JM9A 3VS0A 3EGDB 3X28B 4RTUA 4RCBA 3H0FA 3KFVA 4BE2A 4OMPA 1IHWA 3P8HA 1YJNA 3LGLA 4XTXA 3JB9I 4ZN1A 3F70A 1VYUA 1VQLQ 4MZMA 2CSIA 3QIIA 4FYVB 1CKBA 2HBPA 3OYYA 3OYCA 3CC4T 1MHNA 1YIJT 3CC2Q 1X6GA 4E47A 1B34B 3G6ET 2X51A 1VQOQ 1Y96B 5CR2A 2WSCE 2DEQA 3UPUA 1TWBA 2EFIA 2BKDN 4C0ZA 1S1NA 1QVFP 2DXUA 1XJWB 4HT8A 4AFQC 4X9CA 1WXUA 1YITQ 2O31A 2W10A 4F7UG 1D09B 2BZ8A 2QASA 1D3BB 2EYXA 1ZX6A 1VQMT 4M77A 2DTIA 2X9HA 1AWJA 1X69A 3RUXA 5FROA 1VIEA 1M1FA 5I21A 1OEBA 1MMDA 1K73U 4P5NA 3RMSA 3M0QA 3CC7T 3RMQA 2RB6A 2R5AA 2ZAEA 3CCQT 1AT1B 1YP5A 1VQKA 1NJIC 2DX1A 2PVOB 1VQ4Q 5GAN6 2YHTA 1TOVA 3QWXX 4M78D 1WHMA 1D0YA
chains in the Genus database with same CATH topology
2CH4A 2AKKA 3VRYA 2RNAA 1M3CA 2LJ0A 3M0PA 1NM7A 1W6XA 3I5SA 3VS5A 2XMFA 4HCKA 2RPNA 4CC3A 1BK2A 1YCSB 2BTTA 2O2OA 4CC2A 2E5KA 1OV3A 1BB9A 3LH5A 2GQIA 1GBRA 2SRCA 2DYBA 1WX6A 5I22A 1ZUKA 1PHTA 2HDAA 2NWMA 3A98A 4AFUC 1JU5C 5EC7A 2DL4A 2SEMA 1YN8A 1K76A 3R6NA 2V1RA 2EPDA 2OJ2A 2A28A 1AD5A 1W70A 1ABQA 4HVUA 4LN2A 2DBKA 4LE9A 2VWFA 4DEXA 1GBQA 2YDLA 1GRIA 2L3SA 2JW4A 3NHNA 1KFZA 5IHNA 2HBWA 5IXBA 1SRLA 1NLOC 1NEBA 2CT3A 2DL5A 1NEGA 1TG0A 5IHKA 2LQWA 4Z88A 2YUOA 3TVTA 1AWOA 2F2XA 2KT8A 1AZGB 2EKHA 1JXMA 4OMQA 2HEQA 2RQWA 2J06A 1NG2A 2M51A 2K7AA 1YNZA 2A36A 2X3WD 2AZSA 3FJ5A 1X43A 2PTKA 3EG2A 4IIMA 3NGPA 2GBQA 3EG3A 4HVWA 4JJDA 1CSKA 2DNUA 1K4US 4RTXA 4LUEA 1J3TA 3VS1A 2YUPA 3TSZA 4JZ3A 1WFWA 2EW3A 1H3HA 1AZEA 3C0CA 2D8HA 3VS6A 3REBB 1GCQC 1PRLC 2KE9A 2H8HA 2EGAA 2LCSA 1W1FA 1E7OA 2EYZA 2LX7A 2L0AA 2NUZA 1HJDA 2AKLA 4AG1C 1A0NB 2RQVA 4D8DA 2DM1A 2FRYA 4OMLA 1K9AA 2V1QA 2PZ1A 3VS7A 2JTEA 1T3SA 2DRKA 1SRMA 1I1JA 4OMMA 3PE0A 4OMNA 1VYTA 2MOXA 2DA9A 1ZUYA 1B3QA 1MV0B 2FRWA 3UATA 2GNCA 3SEMA 2LMJA 4RTWA 3VS3A 4ESRA 1BU1A 1UUEA 2J05A 3RNJA 1KIKA 2KNBB 5FWCA 1RUWA 2OI3A 1WA7A 1TUCA 1GL5A 2KEAA 5GJVB 1UTIA 3M0TA 3H0IA 4FSSA 2P4RA 2ECZA 1XOVA 1K0XA 2HSPA 3O5ZA 2DILA 3M0UA 2CDTA 1ARKA 3PVQA 4AG2C 1UGVA 3I5RA 2L3PA 1Y0MA 2K3BA 4HXJA 1SEMA 1SPKA 3CQTA 1ABOA 5IHIA 1M30A 1Z9ZA 1QKWA 2KYBA 2ED0A 4F17A 2CREA 2VKNA 1JQQA 2O9VA 1N5ZA 3TSWA 2OAWA 1JO8A 4J9DA 4J9FA 2AZVA 2KR3A 1VYVA 1H8KA 3VRZA 4R0KA 4JJBA 1LCKA 1TUDA 1GCPA 2J7IA 2DL7A 5GJWB 2LNHB 1G83A 1NYFA 1I0CA 1OPKA 4Y92A 4ZNXA 1PWTA 4J9EA 2KBTA 4LUDA 1T0JA 1RLQC 2ROTA 2RF0A 3EGUA 4J9GA 2M0YA 1AWWA 1FYNA 1MV3A 3SHWA 2KXDA 1I07A 1X6BA 1HSQA 2A08A 1UE9A 5IXFA 3M0SA 2FPFA 4RUGA 4EIKA 3UA7A 2DL8A 1UHFA 2DVJA 2KRSA 5I11A 1YWOA 3EHQA 2B86A 1OOTA 1BBZA 2HCKA 2K2MA 3U23A 2W0ZA 5FWBA 2DF6A 4CC4B 2YSQA 2YT6A 1QKXA 2LJ1A 3ZL7C 2EQIA 1WYXA 2D0NA 2RQTA 2RQUA 4QT7A 4A63B 4JJCA 3UA6A 2BZXA 2FPEA 3JV3A 4RTVA 2D1XA 2KRMA 5L23A 1U06A 1HD3A 1Z9QA 2LZ6B 2LP5A 1X2KA 3M0RA 2GGRA 2DL3A 4M4ZA 1KJWA 1CKAA 2EBPA 1WXTA 4RTYA 4J9BA 2JXBA 2MIOA 4AFSC 2LQNA 1UG1A 1ZBJA 2JT4A 1H92A 1B07A 1FMKA 2KT1A 1QLYA 1E6GA 1U3OA 3UF4A 1PKSA 2DMOA 1AEYA 1SSHA 2L3QA 1MUZA 2K6DA 1X27A 2KYMA 4HVVA 1AOJA 2JM8A 1K0SA 3IQLA 1PNJA 2ROLA 1UHCA 1WLPB 1AWXA 1YWPA 3H41A 2JMAA 1Y57A 2DRMA 4J9HA 2I0NA 1PKTA 3REAB 1UDLA 2EVRA 3PVLA 4OMOA 1WI7A 2JS0A 2BZYA 1SHFA 1UJ0A 1JEGA 4F14A 2CUBA 3THKA 1T0HA 2EYWA 2K9GA 4F16A 3H0HA 1PRMC 2FPDA 2F2VA 2J6KA 1KSWA 2X3XD 5ECAA 2D8JA 4J9CA 2KRNA 2GTJA 4KRTA 1GFDA 2JS2A 2FG0A 4CC7A 4GLMA 1EFNA 2L2PA 5FW9A 1M27C 4ORZA 4K11A 1M8MA 2J6OA 1VA7A 2CSQA 1WIEA 2IIMA 3NPFA 4JPBW 2QDLA 4Z89A 2JMCA 2DJQA 4J9IA 1SHGA 1ZSGA 1QWEA 1IO6A 3QWYA 1WXBA 2PNIA 2C0OA 2EGEA 2DBMA 3EG1A 1E6HA 1RI9A 2JM9A 2RN8A 2EGCA 2O9SA 3VS0A 4E6RA 1K1ZA 4RTUA 1UECA 1U5SA 4WCIA 4JZ4A 2ABLA 2LJ3A 3H0FA 3KFVA 4D8KA 2J6FA 1NLPC 4OMPA 2CH4W 2A37A 1X2QA 3EG0A 1GCQA 3GBQA 1VYUA 2K79A 1JXOA 2CSIA 2KROA 1CKBA 2VVKA 2GTOA 2RMOA 1UFFA 4DEYA 1NYGA 1X6GA 1ZUUA 4X1VA 2ESWA 2G6FX 2CT4A 1G2BA 1UJYA 1GFCA 1M3BA 4GBQA 1QCFA 2DLPA 5HCKA 2DE0X 2RQRA 3RBBB 1S1NA 2C0TA 3NMZC 1T3LA 4LNPA 2ED1A 3I35A 2FO0A 4AFQC 5IH2A 1WXUA 2F2WA 3VS4A 2O31A 2W10A 2CUDA 2BZ8A 4Z8AA 2EYXA 1ZX6A 1OPLA 2YUQA 1AWJA 1ZLMA 2EYYA 1X69A 1RLPC 1OEBA 2AK5A 3VS2A 2FEIA 2ENMA 1WDXA 3M0QA 1AVZC 2MCNA 3EHRA 3I9QA 1V1CA 1YP5A 2KGTA 1M3AA 1QWFA 4AFZC 2C0IA 2DX1A 4IIOA 4RTZA 3ULRB 2KXCA 3QWXX 2O88A 4RTTA 2YUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CH4 A;  2AKK A;  3VRY A;  2RNA A;  1M3C A;  2LJ0 A;  3M0P A;  1NM7 A;  1W6X A;  3I5S A;  3VS5 A;  2XMF A;  4HCK A;  2RPN A;  4CC3 A;  1BK2 A;  1YCS B;  2BTT A;  2O2O A;  4CC2 A;  2E5K A;  1OV3 A;  1BB9 A;  3LH5 A;  2GQI A;  1GBR A;  2SRC A;  2DYB A;  1WX6 A;  5I22 A;  1ZUK A;  1PHT A;  2HDA A;  2NWM A;  3A98 A;  4AFU C;  1JU5 C;  5EC7 A;  2DL4 A;  2SEM A;  1YN8 A;  1K76 A;  3R6N A;  2V1R A;  2EPD A;  2OJ2 A;  2A28 A;  1AD5 A;  1W70 A;  1ABQ A;  4HVU A;  4LN2 A;  2DBK A;  4LE9 A;  2VWF A;  4DEX A;  1GBQ A;  2YDL A;  1GRI A;  2L3S A;  2JW4 A;  3NHN A;  1KFZ A;  5IHN A;  2HBW A;  5IXB A;  1SRL A;  1NLO C;  1NEB A;  2CT3 A;  2DL5 A;  1NEG A;  1TG0 A;  5IHK A;  2LQW A;  4Z88 A;  2YUO A;  3TVT A;  1AWO A;  2F2X A;  2KT8 A;  1AZG B;  2EKH A;  1JXM A;  4OMQ A;  2HEQ A;  2RQW A;  2J06 A;  1NG2 A;  2M51 A;  2K7A A;  1YNZ A;  2A36 A;  2X3W D;  2AZS A;  3FJ5 A;  1X43 A;  2PTK A;  3EG2 A;  4IIM A;  3NGP A;  2GBQ A;  3EG3 A;  4HVW A;  4JJD A;  1CSK A;  2DNU A;  1K4U S;  4RTX A;  4LUE A;  1J3T A;  3VS1 A;  2YUP A;  3TSZ A;  4JZ3 A;  1WFW A;  2EW3 A;  1H3H A;  1AZE A;  3C0C A;  2D8H A;  3VS6 A;  3REB B;  1GCQ C;  1PRL C;  2KE9 A;  2H8H A;  2EGA A;  2LCS A;  1W1F A;  1E7O A;  2EYZ A;  2LX7 A;  2L0A A;  2NUZ A;  1HJD A;  2AKL A;  4AG1 C;  1A0N B;  2RQV A;  4D8D A;  2DM1 A;  2FRY A;  4OML A;  1K9A A;  2V1Q A;  2PZ1 A;  3VS7 A;  2JTE A;  1T3S A;  2DRK A;  1SRM A;  1I1J A;  4OMM A;  3PE0 A;  4OMN A;  1VYT A;  2MOX A;  2DA9 A;  1ZUY A;  1B3Q A;  1MV0 B;  2FRW A;  3UAT A;  2GNC A;  3SEM A;  2LMJ A;  4RTW A;  3VS3 A;  4ESR A;  1BU1 A;  1UUE A;  2J05 A;  3RNJ A;  1KIK A;  2KNB B;  5FWC A;  1RUW A;  2OI3 A;  1WA7 A;  1TUC A;  1GL5 A;  2KEA A;  5GJV B;  1UTI A;  3M0T A;  3H0I A;  4FSS A;  2P4R A;  2ECZ A;  1XOV A;  1K0X A;  2HSP A;  3O5Z A;  2DIL A;  3M0U A;  2CDT A;  1ARK A;  3PVQ A;  4AG2 C;  1UGV A;  3I5R A;  2L3P A;  1Y0M A;  2K3B A;  4HXJ A;  1SEM A;  1SPK A;  3CQT A;  1ABO A;  5IHI A;  1M30 A;  1Z9Z A;  1QKW A;  2KYB A;  2ED0 A;  4F17 A;  2CRE A;  2VKN A;  1JQQ A;  2O9V A;  1N5Z A;  3TSW A;  2OAW A;  1JO8 A;  4J9D A;  4J9F A;  2AZV A;  2KR3 A;  1VYV A;  1H8K A;  3VRZ A;  4R0K A;  4JJB A;  1LCK A;  1TUD A;  1GCP A;  2J7I A;  2DL7 A;  5GJW B;  2LNH B;  1G83 A;  1NYF A;  1I0C A;  1OPK A;  4Y92 A;  4ZNX A;  1PWT A;  4J9E A;  2KBT A;  4LUD A;  1T0J A;  1RLQ C;  2ROT A;  2RF0 A;  3EGU A;  4J9G A;  2M0Y A;  1AWW A;  1FYN A;  1MV3 A;  3SHW A;  2KXD A;  1I07 A;  1X6B A;  1HSQ A;  2A08 A;  1UE9 A;  5IXF A;  3M0S A;  2FPF A;  4RUG A;  4EIK A;  3UA7 A;  2DL8 A;  1UHF A;  2DVJ A;  2KRS A;  5I11 A;  1YWO A;  3EHQ A;  2B86 A;  1OOT A;  1BBZ A;  2HCK A;  2K2M A;  3U23 A;  2W0Z A;  5FWB A;  2DF6 A;  4CC4 B;  2YSQ A;  2YT6 A;  1QKX A;  2LJ1 A;  3ZL7 C;  2EQI A;  1WYX A;  2D0N A;  2RQT A;  2RQU A;  4QT7 A;  4A63 B;  4JJC A;  3UA6 A;  2BZX A;  2FPE A;  3JV3 A;  4RTV A;  2D1X A;  2KRM A;  5L23 A;  1U06 A;  1HD3 A;  1Z9Q A;  2LZ6 B;  2LP5 A;  1X2K A;  3M0R A;  2GGR A;  2DL3 A;  4M4Z A;  1KJW A;  1CKA A;  2EBP A;  1WXT A;  4RTY A;  4J9B A;  2JXB A;  2MIO A;  4AFS C;  2LQN A;  1UG1 A;  1ZBJ A;  2JT4 A;  1H92 A;  1B07 A;  1FMK A;  2KT1 A;  1QLY A;  1E6G A;  1U3O A;  3UF4 A;  1PKS A;  2DMO A;  1AEY A;  1SSH A;  2L3Q A;  1MUZ A;  2K6D A;  1X27 A;  2KYM A;  4HVV A;  1AOJ A;  2JM8 A;  1K0S A;  3IQL A;  1PNJ A;  2ROL A;  1UHC A;  1WLP B;  1AWX A;  1YWP A;  3H41 A;  2JMA A;  1Y57 A;  2DRM A;  4J9H A;  2I0N A;  1PKT A;  3REA B;  1UDL A;  2EVR A;  3PVL A;  4OMO A;  1WI7 A;  2JS0 A;  2BZY A;  1SHF A;  1UJ0 A;  1JEG A;  4F14 A;  2CUB A;  3THK A;  1T0H A;  2EYW A;  2K9G A;  4F16 A;  3H0H A;  1PRM C;  2FPD A;  2F2V A;  2J6K A;  1KSW A;  2X3X D;  5ECA A;  2D8J A;  4J9C A;  2KRN A;  2GTJ A;  4KRT A;  1GFD A;  2JS2 A;  2FG0 A;  4CC7 A;  4GLM A;  1EFN A;  2L2P A;  5FW9 A;  1M27 C;  4ORZ A;  4K11 A;  1M8M A;  2J6O A;  1VA7 A;  2CSQ A;  1WIE A;  2IIM A;  3NPF A;  4JPB W;  2QDL A;  4Z89 A;  2JMC A;  2DJQ A;  4J9I A;  1SHG A;  1ZSG A;  1QWE A;  1IO6 A;  3QWY A;  1WXB A;  2PNI A;  2C0O A;  2EGE A;  2DBM A;  3EG1 A;  1E6H A;  1RI9 A;  2JM9 A;  2RN8 A;  2EGC A;  2O9S A;  3VS0 A;  4E6R A;  1K1Z A;  4RTU A;  1UEC A;  1U5S A;  4WCI A;  4JZ4 A;  2ABL A;  2LJ3 A;  3H0F A;  3KFV A;  4D8K A;  2J6F A;  1NLP C;  4OMP A;  2CH4 W;  2A37 A;  1X2Q A;  3EG0 A;  1GCQ A;  3GBQ A;  1VYU A;  2K79 A;  1JXO A;  2CSI A;  2KRO A;  1CKB A;  2VVK A;  2GTO A;  2RMO A;  1UFF A;  4DEY A;  1NYG A;  1X6G A;  1ZUU A;  4X1V A;  2ESW A;  2G6F X;  2CT4 A;  1G2B A;  1UJY A;  1GFC A;  1M3B A;  4GBQ A;  1QCF A;  2DLP A;  5HCK A;  2DE0 X;  2RQR A;  3RBB B;  1S1N A;  2C0T A;  3NMZ C;  1T3L A;  4LNP A;  2ED1 A;  3I35 A;  2FO0 A;  4AFQ C;  5IH2 A;  1WXU A;  2F2W A;  3VS4 A;  2O31 A;  2W10 A;  2CUD A;  2BZ8 A;  4Z8A A;  2EYX A;  1ZX6 A;  1OPL A;  2YUQ A;  1AWJ A;  1ZLM A;  2EYY A;  1X69 A;  1RLP C;  1OEB A;  2AK5 A;  3VS2 A;  2FEI A;  2ENM A;  1WDX A;  3M0Q A;  1AVZ C;  2MCN A;  3EHR A;  3I9Q A;  1V1C A;  1YP5 A;  2KGT A;  1M3A A;  1QWF A;  4AFZ C;  2C0I A;  2DX1 A;  4IIO A;  4RTZ A;  3ULR B;  2KXC A;  3QWX X;  2O88 A;  4RTT A;  2YUN A; 
#chains in the Genus database with same CATH topology
 1EZZ B;  4KUI A;  4XU3 A;  4ZN3 A;  2RNA A;  3E9F A;  3I5S A;  4PJO F;  4MMK A;  2K5F A;  5GAM e;  4L6V 5;  3QZ5 B;  2K57 A;  2RO0 A;  4NL3 A;  1HK9 A;  3CCS Q;  1SF9 A;  4IUU A;  5GAM j;  3JSC A;  3MPU B;  2DYB A;  3BE3 A;  5I22 A;  1ZUK A;  3G71 A;  2FZG B;  1PHT A;  2NWM A;  1ZSZ C;  3M59 A;  1KQ2 A;  4QKU A;  5EC7 A;  2DL4 A;  3PIP A;  3R6N A;  2V1R A;  3VU3 C;  1AD5 A;  5KE3 A;  4LN2 A;  1BYM A;  2DBK A;  1D0Z A;  4DEX A;  2YDL A;  1IRX A;  1GRI A;  4A4F A;  2DIG A;  4LDW A;  2NUP A;  4M78 E;  5IXB A;  2LT1 A;  3PNW C;  3CME A;  5IHK A;  5KYY B;  2CKK A;  1VQ7 Q;  1N9S A;  2V8J A;  3CCQ Q;  1QCN A;  1RAB B;  2RQW A;  4HKE A;  2J06 A;  1V29 B;  3EFO A;  4LDV A;  4M7D A;  2A36 A;  2EQK A;  4M75 G;  3FJ5 A;  1VUB A;  2PTK A;  1NBE B;  4KGZ B;  4IIM A;  1QVF A;  3J80 E;  2DXC A;  3DB3 A;  3L2W A;  1YHQ T;  2DTH A;  2DNU A;  4C8Q F;  4BDY A;  1OU9 A;  4DBQ A;  4RTX A;  3BDU A;  3VS1 A;  3QZ9 B;  4B6M A;  2EQJ A;  1VQN T;  2EW3 A;  5GMK h;  3M4Y A;  4MZT A;  3I56 T;  1Q7Y C;  1NE8 A;  4EMK C;  1PRL C;  3H6Z A;  3MJX A;  3J81 E;  4LDU A;  5EG2 A;  2EYZ A;  2LX7 A;  1VIF A;  1IHV A;  2K5L A;  2O4X B;  2NUZ A;  4F7U B;  4PJJ A;  1HJD A;  2AKL A;  2M16 A;  2DAQ A;  3SFM A;  4C5G A;  4HCZ A;  1T3S A;  4L59 A;  5GAN d;  1SRM A;  3WVD B;  3QXE B;  2KY9 A;  4OMM A;  4OMN A;  1WJQ A;  2MOX A;  3KBG A;  2FRW A;  2GNC A;  3SEM A;  2LMJ A;  4ESR A;  1Y07 A;  2J05 A;  4BUG A;  1B7T A;  1KIK A;  3C95 A;  3OYJ A;  5HK3 A;  5CKB A;  4M77 C;  1UTI A;  2VAS A;  3H0I A;  2VGN A;  3HRS A;  1XOV A;  2HSP A;  6AT1 B;  2E3H A;  3PVQ A;  5CKH A;  1VQ9 A;  1Y0M A;  3TQ7 P;  3TU4 K;  3MET A;  2E4H A;  4DA4 A;  5GAN h;  3URG A;  1RAC B;  1ABO A;  5LJ5 g;  2QGF B;  1G5V A;  5FLX E;  2DIQ A;  1OZ2 A;  3I56 Q;  4HCB A;  2MK5 A;  1C0M A;  3VJP A;  5CK9 A;  1S72 Q;  3LW5 E;  1YJ9 T;  1YBY A;  3ZBD A;  3M54 A;  2MMP A;  2QEX T;  3TSW A;  1JO8 A;  2RHZ A;  4J9F A;  2AZV A;  4C92 G;  2KR3 A;  4R0K A;  1LCK A;  4QQD A;  3OYN A;  2K3X A;  2CP3 A;  5I2S A;  3E1S A;  3SWN C;  4J9E A;  3MP6 A;  2X35 A;  3EGU A;  3M5A A;  2JTM A;  3EGX B;  2A08 A;  4RUG A;  3CEY A;  1TXQ A;  1TTH B;  1VQ8 A;  2DVJ A;  4M7A A;  4M78 A;  5I11 A;  1YWO A;  4M75 B;  3U23 A;  3EGD A;  5I2M A;  3OS2 A;  2XK0 A;  5FWB A;  1NPP A;  1RAG B;  3CMA Q;  2YT6 A;  4ZGE B;  2LJ1 A;  5GAN f;  1EX4 A;  3ZL7 C;  1W2B P;  1WHK A;  3CCJ Q;  4M7D C;  3L2R A;  3CC4 A;  4R55 A;  1YIJ A;  4A4H A;  2D0N A;  1QCO A;  1YJW Q;  2RQT A;  1OQK A;  5KH6 A;  4QT7 A;  3JV3 A;  2OX7 A;  1Y96 A;  4J5Y A;  1Z9Q A;  1VQK T;  3EFS A;  2HAX A;  1X2K A;  3M0R A;  2ZPH B;  2DL3 A;  1VQP A;  2IPO B;  5CKD A;  4JRK A;  4OB0 B;  4RTY A;  4IUR A;  2LQN A;  1UG1 A;  2FZC B;  1FMK A;  1WHJ A;  3MEV A;  1D3B A;  1YJN Q;  1VQM A;  4XTU A;  5CKF A;  1AEY A;  3CBP A;  1X27 A;  4FYW B;  1RAE B;  3I55 T;  1VQ6 T;  3LYI A;  1K0S A;  3IQL A;  1PNJ A;  3CC7 A;  4BB7 A;  1O9S A;  1WLP B;  1YWP A;  4J9H A;  3BFM A;  4AMC A;  1R8O B;  4OB3 B;  3CCR T;  4J6Y A;  2QTV A;  5LJ5 e;  4N4I A;  4R56 A;  1YI2 T;  3LWI A;  2BIV A;  2BZY A;  1KQS P;  4PJO G;  1UJ0 A;  2PU9 B;  4F14 A;  3OS1 A;  2DYI A;  5LJ5 j;  3THK A;  4F16 A;  1PRM C;  2YLC A;  2FPD A;  3JCM Q;  2X3X D;  2ZZD A;  3QDF A;  5ECA A;  5C6S A;  4KRT A;  3FDR A;  2X4Y A;  1MMN A;  1K8A R;  1UGR B;  5DY9 A;  1LPL A;  1M27 C;  4RG2 A;  2DXT A;  4JPB W;  2QDL A;  3SDZ A;  4C92 B;  2GCX A;  2IG0 A;  4X34 A;  4C5I A;  4J6X A;  2B8A A;  3PTA A;  2MAM A;  1IO6 A;  3QHS A;  2PNI A;  2RJD A;  2DBM A;  1NJI R;  2O9S A;  4E6R A;  3WVE B;  2F69 A;  1K1Z A;  1G3T A;  2LJ3 A;  5GAO m;  4D8K A;  2J6F A;  2XDP A;  2CH4 W;  1X2Q A;  3DLL A;  4MML A;  1GCQ A;  4MZP A;  1W2B A;  2K79 A;  4NL2 A;  2KRO A;  4N0A A;  2DFU A;  1RAF B;  1EIF A;  1M4Z A;  4LDY A;  5CAI A;  2RJC A;  1ZUU A;  2JUF A;  4FYX B;  2HKN A;  2A3L A;  1V76 A;  3AT1 B;  2QQ9 A;  1W2B S;  2HQX A;  3A5Z B;  3QYH B;  4GBQ A;  1UGQ B;  2DLP A;  2YRD A;  2RQR A;  3G71 Q;  1YHQ A;  2H3E B;  4M77 F;  2C0T A;  3NMZ C;  4M78 C;  2MYS A;  4LNP A;  3SD4 A;  3OW2 P;  1VQN A;  5HK0 A;  2F2W A;  3VS4 A;  3QKJ A;  1VOM A;  3GNG A;  3OYD A;  2DK3 A;  3CME Q;  2BE9 B;  2YUQ A;  5KYN A;  2E5Q A;  1MND A;  2EYY A;  4BY6 B;  3CPF A;  4FSX A;  1I5L A;  1G3W A;  3VUB A;  3X20 B;  1RLP C;  2ENM A;  1K8A U;  1AVZ C;  3EHR A;  1G8X A;  4XQ3 A;  3G4S T;  2HQE A;  2KGT A;  1VQ9 T;  4KGV B;  4OF1 A;  3CPW P;  1M3A A;  1QWF A;  4AFZ C;  2C0I A;  2VYT A;  3X26 B;  5KYW B;  1KQS A;  3X25 B;  3OYB A;  3E2U A;  2O88 A;  4RTT A;  5KCO A;  3CCV T;  2KQW A;  1NJI U;  3VRY A;  3A8H B;  2PQW A;  2LJ0 A;  2XMF A;  3OYF A;  1Q95 G;  3HRU A;  2CP5 A;  5LL6 S;  5GAN 4;  2RPN A;  4CC3 A;  4PJO B;  2K2V A;  2DO3 A;  1Q7Y R;  4PJN A;  3JB9 D;  2BTT A;  2O2O A;  4CC2 A;  4JRQ A;  1OV3 A;  3JCM g;  1BB9 A;  3LH5 A;  2GQI A;  1HXD A;  3ER0 A;  3QG1 A;  3OYH A;  1KD1 C;  4IUP A;  4ELY C;  3A98 A;  5FU6 C;  2L8D A;  4Y91 A;  2SEM A;  5J39 A;  1K76 A;  2LVM A;  2EPD A;  1KK7 A;  2A28 A;  1ZA2 B;  4HVU A;  2CP2 A;  4XTY A;  1D1A A;  2WAC A;  4CI0 C;  1YJ9 A;  2QEX A;  2VXF A;  3C4S A;  2HBW A;  4M7D F;  2RJF A;  1NLO C;  2L3R A;  2DL5 A;  1WHH A;  1WGS A;  2YUO A;  4B9X A;  2DPP B;  2FZK B;  2LQK A;  3CCM T;  3PGG A;  1Q81 R;  1AZG B;  2AIR B;  1PG5 B;  4OMQ A;  2HEQ A;  3FC3 A;  2DEU A;  3RES A;  3QO3 A;  2HKQ B;  2AZS A;  3EG2 A;  2E6N A;  3NGP A;  2H3J A;  1GXI E;  3EG3 A;  5KYU B;  3OW2 A;  5A0G A;  2RHI A;  1QVP A;  2YUP A;  5LJ5 d;  1H64 1;  1U1T A;  4C8Q B;  4II1 A;  2F5K A;  3RKW A;  2L5Q A;  1H3H A;  1D1B A;  2D8H A;  1VQP T;  4FU6 A;  2F1L A;  1GCQ C;  4EPC A;  2FB7 A;  1IRE B;  2JTF A;  2KE9 A;  3OYL A;  2EGA A;  2LCS A;  4LXC A;  1W1F A;  1E7O A;  1K8A C;  1SG5 A;  3V7R A;  1Q7Y U;  1IZ6 A;  3ZEH A;  3P8B B;  2PVD B;  1TS9 A;  3M53 A;  4OML A;  3WXM B;  4MDX A;  4FT4 A;  3QBY A;  3VS7 A;  3L2U A;  3A1P A;  2OTJ Q;  3VUZ A;  5LJ5 h;  3CCE T;  1ZUY A;  2QDY B;  4E7I A;  1VQ8 Q;  2YWW A;  4RTW A;  3MEW A;  4V2S A;  2ZPB B;  2DD4 A;  5FU7 B;  3RNJ A;  4M7A D;  2KNB B;  4DBR A;  2OI3 A;  4JDS A;  1WQ7 A;  3RER A;  2KEA A;  5GJV B;  4ANJ A;  2CP0 A;  3OBW A;  3CBO A;  3JRZ A;  1QW1 A;  4PFZ A;  3EH2 A;  2DIL A;  3KUF A;  2CDT A;  1M1K C;  3I55 A;  1VQ6 A;  3OSV A;  1Q81 U;  3KXT A;  3CC4 Q;  1TU0 B;  1ACM B;  4J7F A;  1TH7 A;  1YIJ Q;  2JZ2 A;  3G6E Q;  1SEM A;  5CQY A;  1WPY A;  2R58 A;  3JCM e;  4JS4 A;  3CCR A;  4XTW A;  1QKW A;  1D1C A;  1YI2 A;  2ED0 A;  1XTD A;  2A7Y A;  2QYZ A;  2CRE A;  4KUL A;  3TEE A;  2LC4 A;  2O9V A;  1U1S A;  2RI2 A;  1Q86 R;  3CXC P;  3QYG B;  2OAW A;  5LJ3 g;  1VQM Q;  4RCC A;  1VYV A;  1X01 A;  2COZ A;  2QQR A;  4M7A E;  1R0B G;  2COY A;  2J7I A;  2E41 A;  2LNH B;  1I0C A;  1OPK A;  3CC7 Q;  2CP6 A;  1PWT A;  2EJG A;  1T0J A;  5LJ5 f;  2ROT A;  4M78 F;  2A0F B;  2E10 A;  3INZ A;  2M0Y A;  1MV3 A;  4C92 A;  2I2L A;  3LLR A;  2KXD A;  1UEB A;  5CVI A;  3QSU A;  1UE9 A;  4VUB A;  2M02 A;  3HKS A;  3M0S A;  2FPF A;  4FIB A;  3V8J A;  1U8R A;  3EG9 B;  2M1H A;  1WNL A;  1Y7X A;  2HCK A;  2K2M A;  2W0Z A;  4TVR A;  2D9T A;  5J26 A;  2DF6 A;  3MKD A;  4JLI A;  4CC4 B;  3OYI A;  3OYA A;  2E64 A;  2YSQ A;  1LOJ A;  1QVF S;  5KYX A;  4DBF A;  4GY5 A;  3S3O A;  1X75 C;  4M77 G;  4B9W A;  2RI3 A;  2WSF E;  3LGF A;  4Y28 E;  4JJC A;  2BZX A;  4D6W A;  2FPE A;  4RTV A;  2D1X A;  3OYE A;  4XTV A;  1UGS B;  3T9N A;  1KJW A;  4C0D C;  5GMK m;  1WXT A;  2CGH A;  4EMG A;  3C94 A;  2MIO A;  4AFS C;  3GOX A;  4KUD K;  2RK2 A;  1H92 A;  3DLM A;  4HT9 A;  5D6W A;  3A8M B;  5D7U A;  1QLY A;  3JB9 H;  1PKS A;  2DMO A;  4ZGD B;  2L3Q A;  1Q81 C;  3L2Q A;  2QQS A;  3VKI A;  2JM8 A;  3PMT A;  3FEO A;  2XIC A;  3V8L A;  1MNE A;  2ROL A;  1UHC A;  2WSE E;  4RMO A;  2BUD A;  3H41 A;  4E7H A;  3G4S A;  2JMA A;  1Y57 A;  2DRM A;  2HZY A;  4E7S A;  2I0N A;  3REA B;  1ZSZ B;  1KC8 C;  3QDR B;  1YHQ Q;  4EMH A;  2E12 A;  1M2O A;  2R5M A;  1WI7 A;  5GAN 2;  2OAU A;  1WZO A;  3CCV A;  2ZGW A;  1VQN Q;  2CS7 A;  4ZGJ B;  2RJE A;  1T0H A;  1FMW A;  3CXC A;  3FRN A;  3S3M A;  1YFN A;  4IUV A;  2MI6 A;  1KSW A;  1VQL A;  3PT9 A;  1KHI A;  5LJ3 e;  1MMG A;  5DM7 R;  2JJ9 A;  3OBY A;  1JRI A;  1EFN A;  5FRM A;  3JAM E;  4PJO A;  5LJ3 j;  5CO7 A;  1M8M A;  2QQA A;  3H9N A;  2IIM A;  4C0G A;  3J7A F;  4JS5 A;  2Y90 A;  4E7Z A;  4A4E A;  1SHG A;  5A0D A;  3NTI A;  1ZSG A;  2EIF A;  2FVU A;  2LQ8 A;  4M7D G;  1WXB A;  3VYG A;  1E6H A;  2QGG A;  2RN8 A;  2EGC A;  4BAC A;  4EMK B;  1QVG P;  1UEC A;  2D0Q B;  4JZ4 A;  1G3Y A;  1OX8 A;  2FHD A;  2G3R A;  2A37 A;  3M56 A;  1ZBX A;  3CCM A;  5DLQ E;  1AHJ B;  4OB1 B;  1VQ5 T;  2GTO A;  4ZTF A;  4J6W A;  3CCU T;  1UFF A;  4DEY A;  1NYG A;  4DQ2 A;  2V26 A;  1RAA B;  4X9D A;  1K9M C;  4XAX B;  1O75 A;  5GAM d;  1GFC A;  2P4T A;  3G1J A;  5HCK A;  2DE0 X;  2QG9 B;  4XU0 A;  1B34 A;  4O6J A;  3RBB B;  4F7U E;  1XNI A;  1T3L A;  2OTL T;  2ED1 A;  3I35 A;  1BCO A;  2VV5 A;  3MEA A;  5IH2 A;  4M77 B;  3HTR A;  2BE7 D;  1KD1 R;  1YJ9 Q;  4C8Q A;  1Q86 C;  2CUD A;  3O8V A;  1QP2 A;  4Z8A A;  2QEX Q;  1SSF A;  2LNV A;  1BI2 A;  4C5H A;  1OPL A;  1Q82 C;  2AK5 A;  2M0O A;  7AT1 B;  1WDX A;  3DB4 A;  3CCL T;  2MCN A;  4N4H A;  3I9Q A;  4JLG A;  4KH1 B;  5GAM h;  2XHC A;  2KAF A;  3JCM J;  4KT0 E;  2XID A;  4IIO A;  2GFA A;  4YTL A;  2EQM A;  3CCE A;  4HCC A;  3QJ6 A;  4QQG A;  3OMG A;  3UDC A;  2YUN A;  1XQH A;  2XU8 A;  4BI4 A;  3HFO A;  1LJO A;  3TRE A;  4NS5 A;  3M55 A;  3OA6 A;  1M3C A;  2P0Q A;  3M0P A;  1NM7 A;  2XD0 A;  1W6X A;  3VS5 A;  2HNI A;  2AT1 B;  1WQW A;  3CBM A;  2F5T X;  3SWN B;  4N4G A;  3OYM A;  4O5V A;  1YCS B;  4OB2 B;  4ELZ C;  1FXX A;  1TUG B;  2Y4Y A;  4Q5W A;  1KG1 A;  1WX6 A;  4EDU A;  1VQK Q;  4AFU C;  1YN8 A;  2NUP B;  1QVG A;  3TCJ A;  2OJ2 A;  1ABQ A;  1W4S A;  1N8R C;  4L5G A;  4PFP A;  1KD1 U;  2VWF A;  1LNX A;  1GBQ A;  2JNG A;  2L3S A;  1KFZ A;  5IHN A;  1SRL A;  1NEG A;  1TG0 A;  4Z88 A;  5KE2 A;  4M7D B;  3TVT A;  5GMK i;  5L8R E;  4M78 G;  3I55 Q;  1VQ6 Q;  1FMV A;  1P92 A;  5GAM f;  3FB9 A;  1JXM A;  2DXB A;  1NG2 A;  5KYY A;  2K7A A;  1JJ2 P;  1YNZ A;  1M1K R;  3CCR Q;  2RHY A;  2XKO C;  5GAO r;  1YI2 Q;  8ATC B;  3C12 A;  3EH1 A;  4QQ6 A;  3FIF A;  3TSZ A;  2EYQ A;  2LDM A;  1WFW A;  5GAO n;  4M7A C;  5GAO l;  3VS6 A;  4DOV A;  3REB B;  5CQX A;  3R6O A;  3CD6 T;  1N9R A;  2DZ9 A;  1PSF A;  5IN1 A;  5LJ3 d;  4FYY B;  2X4J A;  3A8L B;  1BIB A;  2RQV A;  4PJM A;  2FRY A;  4PFO A;  2V1Q A;  2PZ1 A;  1PCX A;  2JTE A;  2DET A;  2O4X A;  4F7U A;  5DLO A;  1I1J A;  3PE0 A;  4C92 D;  1PD0 A;  1B3Q A;  1MV0 B;  3JB9 J;  5GAN 7;  2NYS A;  3N5B B;  1QQJ A;  1BU1 A;  1UUE A;  3GLX A;  1X6O A;  5FWC A;  1RUW A;  1WA7 A;  2E70 A;  2PVG B;  3M0T A;  4FSS A;  2P4R A;  1JB0 E;  1K0X A;  3O5Z A;  3GF5 A;  5LJ3 h;  1KQS S;  5GAO q;  1R77 A;  3M0U A;  1VQL T;  3GP8 A;  1ARK A;  4A54 A;  2QI2 A;  1FX7 A;  4AG2 C;  2L3P A;  3EAE A;  3BW1 A;  3A8O B;  2K3B A;  3OS5 A;  3V7C A;  1SPK A;  3QUI A;  3UT1 A;  5J3B A;  1M1K U;  3CC2 T;  3QPH A;  1VQO T;  5IHI A;  1M30 A;  1I5O B;  4UC4 A;  4PLI A;  1ZQ1 A;  1RI0 A;  2RHX A;  1M1G A;  8AT1 B;  4F17 A;  3BDL A;  1ZA1 B;  4C92 E;  5GAN 5;  2VKN A;  1JQQ A;  1YIT T;  1N5Z A;  3CMA A;  1H8K A;  3VRZ A;  2QA4 A;  1K73 R;  1TUD A;  2QQB A;  3MP8 A;  1GCP A;  4BI8 B;  2DL7 A;  5GJW B;  1G83 A;  2RD1 A;  1JJ2 A;  4FW1 A;  2MPX C;  3HPW A;  3G4S Q;  1VQ9 Q;  3M4G A;  1RLQ C;  2RF0 A;  1FYN A;  1WJS A;  2RM4 A;  3SHW A;  2MF2 A;  4M78 B;  3S3N A;  3HRT A;  1X6B A;  3VYH B;  1JJ2 S;  5IXF A;  3OYK A;  1VQ4 T;  2YLB A;  3CCV Q;  4E7K A;  3UA7 A;  1KC8 R;  4QVC A;  2JOY A;  4Z02 A;  3EGX A;  3EHQ A;  2B86 A;  1OOT A;  1MGQ A;  1NZ9 A;  5LJ3 f;  4EMK A;  3PMI A;  3MHX A;  3SB2 A;  4OGE A;  4KGX B;  4WF2 A;  3JB9 F;  1IGQ A;  2XDD A;  1OZ3 A;  2Y4X A;  4M75 A;  3RKX A;  3OW2 S;  1OX9 A;  3ASK A;  4N0A C;  2YRV A;  4RKU E;  1VQ5 A;  2O01 E;  3CCU A;  5A0L A;  4JRI A;  4PJO D;  3NFC A;  4OGC A;  2HMA A;  3X24 B;  3CCS T;  1BCM A;  1WYX A;  3E19 A;  4IUQ A;  2RQU A;  4PLL A;  2K5I A;  3CPW A;  3OQ5 A;  1H3Z A;  2KRM A;  5L23 A;  1U06 A;  1HD3 A;  2VB6 A;  2LCL A;  2OTL A;  3BY7 A;  2GGR A;  4M4Z A;  1CKA A;  4PK4 A;  2JXB A;  3V8K A;  1ZBJ A;  3CPW S;  1B07 A;  2KT1 A;  4XU1 A;  1E6G A;  4XTZ A;  2FYK A;  2HL5 C;  1U3O A;  2EJ9 A;  3UF4 A;  2QK0 A;  3CCM Q;  2XI9 A;  5CCA A;  1MUZ A;  3V7S A;  2K6D A;  4HVV A;  1VQ7 T;  5D6X A;  4FCY A;  1MMA A;  1BI3 A;  3CCL A;  2EKO A;  3L42 A;  1AWX A;  1PKT A;  4JUV A;  5FU6 B;  2KSS A;  1NPR A;  3GNF B;  4PJO E;  2V8K A;  1K9M R;  4OMO A;  4NOY A;  2LTO A;  2KK4 A;  3D7S B;  1KC8 U;  2CUB A;  2NUT B;  2QAZ A;  2EYW A;  3E9G A;  2K9G A;  3OSS C;  1YCY A;  3H0H A;  1VQP Q;  1M90 C;  1QMC A;  2DKG A;  4C8Q D;  2F2V A;  2J6K A;  3GPL A;  2D8J A;  5AT1 B;  1M5Q 1;  1M9S A;  3AHU A;  2FG0 A;  4KBM B;  3FJP A;  2KVQ G;  3SWN A;  4ORZ A;  4K11 A;  1Q82 R;  2J6O A;  1VA7 A;  2CSQ A;  1WIE A;  3NPF A;  3JCM b;  4Z89 A;  1M2V B;  2EJF A;  2RK1 A;  4LDX A;  2GQV A;  3CCE Q;  2XG8 D;  4M7A F;  1KHC A;  2PUO B;  2IVW A;  3NTK A;  2EGE A;  2P0K A;  1RI9 A;  1U5S A;  4WCI A;  2ABL A;  2AHJ B;  1NLP C;  2L89 A;  3EG0 A;  3PFS A;  1BIA A;  3GBQ A;  2DVE A;  1JXO A;  2K4Y A;  4C8Q E;  2VVK A;  2RMO A;  4X1V A;  2DJZ A;  2ESW A;  2CT4 A;  2G6F X;  1G2B A;  1UJY A;  4PNO A;  1M3B A;  1QCF A;  2EAY A;  1K9M U;  4LD6 A;  5C0M A;  2FO0 A;  3MEU A;  2HQH A;  3LH0 A;  1SKU B;  5IAY A;  2DTO A;  2E65 A;  1S72 T;  4CRI A;  2CZ7 B;  3CD6 A;  1K73 C;  4M75 C;  2GF7 A;  1N8R R;  3L1A A;  1ZLM A;  3FLG A;  1Q86 U;  3VS2 A;  3JCM X;  2FEI A;  4QVD A;  2KDS A;  1Q82 U;  4ME7 A;  4XU2 A;  1V1C A;  3M58 A;  4XK8 E;  4C5E A;  2X4X A;  1N27 A;  4A4G A;  2RA2 A;  2YRC A;  4RTZ A;  3ULR B;  5A2Q E;  3UWN A;  2KXC A;  4GLK A;  4A4K A;  1RAH B;  1DJ7 B;  3RDV A;  5GMK l;  3PIO A;  2CH4 A;  5KYW A;  2AKK A;  1BI1 A;  3GIB A;  5CKE A;  2D6F A;  4HCK A;  2ZPE B;  3CMA T;  2KMT A;  4KH0 B;  1BK2 A;  2QA4 T;  2E3I A;  3HFN A;  3CCJ T;  2E5K A;  3CXC S;  3JCM W;  3CC2 A;  2CP7 A;  1TSF A;  3M57 A;  1GBR A;  1YJW T;  1UB4 A;  2SRC A;  1VQO A;  4QW2 A;  1M8V A;  2PUK B;  2HDA A;  1JU5 C;  2GFU A;  2CZ0 B;  4OP0 A;  3RKY A;  4BE1 A;  4PL6 A;  1W70 A;  2YXY A;  4LE9 A;  1YIT A;  4MDW A;  2JW4 A;  3NHN A;  4DOW A;  1OUL A;  1NEB A;  2CT3 A;  3OB9 A;  1YJN T;  1N8R U;  2C06 A;  2LQW A;  2HSE B;  1AWO A;  2F2X A;  2XDB A;  2DZC A;  2KT8 A;  2EKH A;  1LVK A;  2HL3 A;  2KI7 A;  1IXD A;  1D0X A;  5HKC A;  1PSE A;  2M51 A;  1OI1 A;  3JCM c;  2X3W D;  2VGM A;  4E2F B;  4FT2 A;  2M9U A;  2OTJ A;  1X43 A;  1RAD B;  1OYX A;  4BDZ A;  2GBQ A;  2QTX A;  4C0D B;  4C92 C;  4HVW A;  4JJD A;  1VQ4 A;  1CSK A;  2LCC A;  1PM3 A;  1K4U S;  4LUE A;  1J3T A;  3JB9 G;  4JZ3 A;  3JCM d;  1BI0 A;  2Z0W A;  5KYU A;  1AZE A;  3C0C A;  4FW2 A;  1C1A A;  5D6Y A;  3LX7 A;  2QA4 Q;  2H8H A;  1RL2 A;  3A8G B;  1WHL A;  1G3S A;  4F7U F;  5KCH A;  4E7L A;  2ZPG B;  3G6E A;  2L0A A;  4AG1 C;  2CZ6 B;  3CCS A;  3DKM A;  4D8D A;  2DM1 A;  3ME9 A;  4E7J A;  1A0N B;  2RI5 A;  1K9A A;  2DRK A;  3MCA B;  3S6W A;  4FL6 A;  1VYT A;  5GAN 8;  2DA9 A;  2QXF A;  1Y71 A;  3JCM h;  3UAT A;  3VS3 A;  3HHT B;  5FRN A;  3QJY A;  3OY9 A;  3EFR A;  1TUC A;  1GL5 A;  2DER A;  1FWZ A;  2ECZ A;  1VQ7 A;  4M75 D;  2K3Y A;  1VQ5 Q;  3VV0 A;  2COW A;  3CCU Q;  1R0C B;  1UGV A;  3I5R A;  3CCQ A;  2P84 A;  3MO8 A;  2ZPF B;  4BY6 C;  3OYG A;  4HXJ A;  1PC0 A;  3CQT A;  3RIR A;  2LRQ A;  4BE0 A;  1Z9Z A;  4IUT A;  2KYB A;  2VUB A;  2VC8 A;  3G71 T;  2OTL Q;  3RR6 A;  2E1H A;  4A53 A;  3HL8 A;  2X4W A;  3JCM V;  2NUT A;  1JBM A;  4M77 D;  4J9D A;  3OMC A;  1WHG A;  3CME T;  4JJB A;  2EQU A;  4JRP A;  1C6V X;  5M9O A;  1RAI B;  1I8F A;  4PKC C;  2MWP A;  1NYF A;  3EFO B;  3CCL Q;  1QVG S;  5GAN g;  1IB8 A;  4M7A G;  4Y92 A;  4ZNX A;  4PJO C;  4OVA A;  4BD3 A;  2KBT A;  4LUD A;  4M75 E;  2ZPI B;  4J9G A;  5GAN 3;  1AWW A;  3JCM f;  1M2V A;  5HY6 A;  3P8D A;  1I07 A;  1HSQ A;  2FL7 A;  4EIK A;  3H8Z A;  1OU8 A;  2DL8 A;  1UHF A;  4M75 F;  2KRS A;  4J8O A;  3ZFJ A;  4J7I A;  2R57 A;  1BBZ A;  2HD0 A;  1ZHI A;  4HA8 A;  5KYX B;  3EG9 A;  1QP3 A;  4ATO A;  5CIU A;  2EWN A;  1M90 R;  1QKX A;  4RG8 A;  4C8Q G;  4M77 E;  2ATC B;  1WJR A;  2EQI A;  2DD5 A;  1KQ1 A;  2NLU A;  1HYO A;  2RH2 A;  4A63 B;  3UA6 A;  1UGP B;  2LZ6 B;  2LP5 A;  2LX9 A;  2JN0 A;  4C0F A;  4QVZ A;  2LT4 A;  2CZ1 B;  5GMK e;  2EBP A;  3I56 A;  4AT1 B;  1F1B B;  4J9B A;  3L2Z A;  2JT4 A;  1S72 A;  4C8Q C;  1PD1 A;  5GMK j;  2CYZ B;  1SSH A;  4FM4 B;  3JCM P;  2KYM A;  1AOJ A;  5AYF A;  4DBH A;  2VXE A;  3L2V A;  4M7D D;  4IKF A;  4LD9 K;  1IGU A;  3Q1J A;  1UDL A;  1N6A A;  2V8I A;  2EVR A;  4BI3 A;  3PVL A;  2JS0 A;  1ZSZ A;  1SHF A;  1JEG A;  1I81 A;  2E6Z A;  4WTO B;  5GAO p;  2RHU A;  5IT9 E;  3CD6 Q;  3HSB A;  5FU7 C;  1BKB A;  4J9C A;  2KRN A;  5GAM g;  2GTJ A;  1GFD A;  3LWH A;  2JS2 A;  4CC7 A;  1M90 U;  4GLM A;  4PJL A;  3HP9 A;  2L2P A;  5FW9 A;  4OMF B;  3OS0 A;  3CCJ A;  4ZTJ A;  5GAN e;  2P0P A;  4JJN K;  4C92 F;  1YJW A;  3M9Q A;  4M7D E;  2JVV A;  2JMC A;  9ATC B;  3MP1 A;  2DJQ A;  3NTH A;  2MWO A;  4J9I A;  3G7Z A;  5GAN j;  2ZCF B;  1QWE A;  2OTJ T;  3QWY A;  4M7A B;  2C0O A;  3EG1 A;  4J83 A;  1VQ8 T;  4F04 B;  1I4K 1;  2JM9 A;  3VS0 A;  3EGD B;  3X28 B;  4RTU A;  4RCB A;  3H0F A;  3KFV A;  4BE2 A;  4OMP A;  1IHW A;  3P8H A;  1YJN A;  3LGL A;  4XTX A;  3JB9 I;  4ZN1 A;  3F70 A;  1VYU A;  1VQL Q;  4MZM A;  2CSI A;  3QII A;  4FYV B;  1CKB A;  2HBP A;  3OYY A;  3OYC A;  3CC4 T;  1MHN A;  1YIJ T;  3CC2 Q;  1X6G A;  4E47 A;  1B34 B;  3G6E T;  2X51 A;  1VQO Q;  1Y96 B;  5CR2 A;  2WSC E;  2DEQ A;  3UPU A;  1TWB A;  2EFI A;  2BKD N;  4C0Z A;  1S1N A;  1QVF P;  2DXU A;  1XJW B;  4HT8 A;  4AFQ C;  4X9C A;  1WXU A;  1YIT Q;  2O31 A;  2W10 A;  4F7U G;  1D09 B;  2BZ8 A;  2QAS A;  1D3B B;  2EYX A;  1ZX6 A;  1VQM T;  4M77 A;  2DTI A;  2X9H A;  1AWJ A;  1X69 A;  3RUX A;  5FRO A;  1VIE A;  1M1F A;  5I21 A;  1OEB A;  1MMD A;  1K73 U;  4P5N A;  3RMS A;  3M0Q A;  3CC7 T;  3RMQ A;  2RB6 A;  2R5A A;  2ZAE A;  3CCQ T;  1AT1 B;  1YP5 A;  1VQK A;  1NJI C;  2DX1 A;  2PVO B;  1VQ4 Q;  5GAN 6;  2YHT A;  1TOV A;  3QWX X;  4M78 D;  1WHM A;  1D0Y A; 
#chains in the Genus database with same CATH homology
 2CH4 A;  2AKK A;  3VRY A;  2RNA A;  1M3C A;  2LJ0 A;  3M0P A;  1NM7 A;  1W6X A;  3I5S A;  3VS5 A;  2XMF A;  4HCK A;  2RPN A;  4CC3 A;  1BK2 A;  1YCS B;  2BTT A;  2O2O A;  4CC2 A;  2E5K A;  1OV3 A;  1BB9 A;  3LH5 A;  2GQI A;  1GBR A;  2SRC A;  2DYB A;  1WX6 A;  5I22 A;  1ZUK A;  1PHT A;  2HDA A;  2NWM A;  3A98 A;  4AFU C;  1JU5 C;  5EC7 A;  2DL4 A;  2SEM A;  1YN8 A;  1K76 A;  3R6N A;  2V1R A;  2EPD A;  2OJ2 A;  2A28 A;  1AD5 A;  1W70 A;  1ABQ A;  4HVU A;  4LN2 A;  2DBK A;  4LE9 A;  2VWF A;  4DEX A;  1GBQ A;  2YDL A;  1GRI A;  2L3S A;  2JW4 A;  3NHN A;  1KFZ A;  5IHN A;  2HBW A;  5IXB A;  1SRL A;  1NLO C;  1NEB A;  2CT3 A;  2DL5 A;  1NEG A;  1TG0 A;  5IHK A;  2LQW A;  4Z88 A;  2YUO A;  3TVT A;  1AWO A;  2F2X A;  2KT8 A;  1AZG B;  2EKH A;  1JXM A;  4OMQ A;  2HEQ A;  2RQW A;  2J06 A;  1NG2 A;  2M51 A;  2K7A A;  1YNZ A;  2A36 A;  2X3W D;  2AZS A;  3FJ5 A;  1X43 A;  2PTK A;  3EG2 A;  4IIM A;  3NGP A;  2GBQ A;  3EG3 A;  4HVW A;  4JJD A;  1CSK A;  2DNU A;  1K4U S;  4RTX A;  4LUE A;  1J3T A;  3VS1 A;  2YUP A;  3TSZ A;  4JZ3 A;  1WFW A;  2EW3 A;  1H3H A;  1AZE A;  3C0C A;  2D8H A;  3VS6 A;  3REB B;  1GCQ C;  1PRL C;  2KE9 A;  2H8H A;  2EGA A;  2LCS A;  1W1F A;  1E7O A;  2EYZ A;  2LX7 A;  2L0A A;  2NUZ A;  1HJD A;  2AKL A;  4AG1 C;  1A0N B;  2RQV A;  4D8D A;  2DM1 A;  2FRY A;  4OML A;  1K9A A;  2V1Q A;  2PZ1 A;  3VS7 A;  2JTE A;  1T3S A;  2DRK A;  1SRM A;  1I1J A;  4OMM A;  3PE0 A;  4OMN A;  1VYT A;  2MOX A;  2DA9 A;  1ZUY A;  1B3Q A;  1MV0 B;  2FRW A;  3UAT A;  2GNC A;  3SEM A;  2LMJ A;  4RTW A;  3VS3 A;  4ESR A;  1BU1 A;  1UUE A;  2J05 A;  3RNJ A;  1KIK A;  2KNB B;  5FWC A;  1RUW A;  2OI3 A;  1WA7 A;  1TUC A;  1GL5 A;  2KEA A;  5GJV B;  1UTI A;  3M0T A;  3H0I A;  4FSS A;  2P4R A;  2ECZ A;  1XOV A;  1K0X A;  2HSP A;  3O5Z A;  2DIL A;  3M0U A;  2CDT A;  1ARK A;  3PVQ A;  4AG2 C;  1UGV A;  3I5R A;  2L3P A;  1Y0M A;  2K3B A;  4HXJ A;  1SEM A;  1SPK A;  3CQT A;  1ABO A;  5IHI A;  1M30 A;  1Z9Z A;  1QKW A;  2KYB A;  2ED0 A;  4F17 A;  2CRE A;  2VKN A;  1JQQ A;  2O9V A;  1N5Z A;  3TSW A;  2OAW A;  1JO8 A;  4J9D A;  4J9F A;  2AZV A;  2KR3 A;  1VYV A;  1H8K A;  3VRZ A;  4R0K A;  4JJB A;  1LCK A;  1TUD A;  1GCP A;  2J7I A;  2DL7 A;  5GJW B;  2LNH B;  1G83 A;  1NYF A;  1I0C A;  1OPK A;  4Y92 A;  4ZNX A;  1PWT A;  4J9E A;  2KBT A;  4LUD A;  1T0J A;  1RLQ C;  2ROT A;  2RF0 A;  3EGU A;  4J9G A;  2M0Y A;  1AWW A;  1FYN A;  1MV3 A;  3SHW A;  2KXD A;  1I07 A;  1X6B A;  1HSQ A;  2A08 A;  1UE9 A;  5IXF A;  3M0S A;  2FPF A;  4RUG A;  4EIK A;  3UA7 A;  2DL8 A;  1UHF A;  2DVJ A;  2KRS A;  5I11 A;  1YWO A;  3EHQ A;  2B86 A;  1OOT A;  1BBZ A;  2HCK A;  2K2M A;  3U23 A;  2W0Z A;  5FWB A;  2DF6 A;  4CC4 B;  2YSQ A;  2YT6 A;  1QKX A;  2LJ1 A;  3ZL7 C;  2EQI A;  1WYX A;  2D0N A;  2RQT A;  2RQU A;  4QT7 A;  4A63 B;  4JJC A;  3UA6 A;  2BZX A;  2FPE A;  3JV3 A;  4RTV A;  2D1X A;  2KRM A;  5L23 A;  1U06 A;  1HD3 A;  1Z9Q A;  2LZ6 B;  2LP5 A;  1X2K A;  3M0R A;  2GGR A;  2DL3 A;  4M4Z A;  1KJW A;  1CKA A;  2EBP A;  1WXT A;  4RTY A;  4J9B A;  2JXB A;  2MIO A;  4AFS C;  2LQN A;  1UG1 A;  1ZBJ A;  2JT4 A;  1H92 A;  1B07 A;  1FMK A;  2KT1 A;  1QLY A;  1E6G A;  1U3O A;  3UF4 A;  1PKS A;  2DMO A;  1AEY A;  1SSH A;  2L3Q A;  1MUZ A;  2K6D A;  1X27 A;  2KYM A;  4HVV A;  1AOJ A;  2JM8 A;  1K0S A;  3IQL A;  1PNJ A;  2ROL A;  1UHC A;  1WLP B;  1AWX A;  1YWP A;  3H41 A;  2JMA A;  1Y57 A;  2DRM A;  4J9H A;  2I0N A;  1PKT A;  3REA B;  1UDL A;  2EVR A;  3PVL A;  4OMO A;  1WI7 A;  2JS0 A;  2BZY A;  1SHF A;  1UJ0 A;  1JEG A;  4F14 A;  2CUB A;  3THK A;  1T0H A;  2EYW A;  2K9G A;  4F16 A;  3H0H A;  1PRM C;  2FPD A;  2F2V A;  2J6K A;  1KSW A;  2X3X D;  5ECA A;  2D8J A;  4J9C A;  2KRN A;  2GTJ A;  4KRT A;  1GFD A;  2JS2 A;  2FG0 A;  4CC7 A;  4GLM A;  1EFN A;  2L2P A;  5FW9 A;  1M27 C;  4ORZ A;  4K11 A;  1M8M A;  2J6O A;  1VA7 A;  2CSQ A;  1WIE A;  2IIM A;  3NPF A;  4JPB W;  2QDL A;  4Z89 A;  2JMC A;  2DJQ A;  4J9I A;  1SHG A;  1ZSG A;  1QWE A;  1IO6 A;  3QWY A;  1WXB A;  2PNI A;  2C0O A;  2EGE A;  2DBM A;  3EG1 A;  1E6H A;  1RI9 A;  2JM9 A;  2RN8 A;  2EGC A;  2O9S A;  3VS0 A;  4E6R A;  1K1Z A;  4RTU A;  1UEC A;  1U5S A;  4WCI A;  4JZ4 A;  2ABL A;  2LJ3 A;  3H0F A;  3KFV A;  4D8K A;  2J6F A;  1NLP C;  4OMP A;  2CH4 W;  2A37 A;  1X2Q A;  3EG0 A;  1GCQ A;  3GBQ A;  1VYU A;  2K79 A;  1JXO A;  2CSI A;  2KRO A;  1CKB A;  2VVK A;  2GTO A;  2RMO A;  1UFF A;  4DEY A;  1NYG A;  1X6G A;  1ZUU A;  4X1V A;  2ESW A;  2G6F X;  2CT4 A;  1G2B A;  1UJY A;  1GFC A;  1M3B A;  4GBQ A;  1QCF A;  2DLP A;  5HCK A;  2DE0 X;  2RQR A;  3RBB B;  1S1N A;  2C0T A;  3NMZ C;  1T3L A;  4LNP A;  2ED1 A;  3I35 A;  2FO0 A;  4AFQ C;  5IH2 A;  1WXU A;  2F2W A;  3VS4 A;  2O31 A;  2W10 A;  2CUD A;  2BZ8 A;  4Z8A A;  2EYX A;  1ZX6 A;  1OPL A;  2YUQ A;  1AWJ A;  1ZLM A;  2EYY A;  1X69 A;  1RLP C;  1OEB A;  2AK5 A;  3VS2 A;  2FEI A;  2ENM A;  1WDX A;  3M0Q A;  1AVZ C;  2MCN A;  3EHR A;  3I9Q A;  1V1C A;  1YP5 A;  2KGT A;  1M3A A;  1QWF A;  4AFZ C;  2C0I A;  2DX1 A;  4IIO A;  4RTZ A;  3ULR B;  2KXC A;  3QWX X;  2O88 A;  4RTT A;  2YUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...